4YC5A

Beta1 synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
total genus 97
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yc5A00
2XTXA 4YEIA 3NB2A 2XTYA 2QZAA 2J8KA 3NAWA 3SY2A 4YDTA 3DU1X 2O6WA 3PSSA 2QYUA 2XT4A 2XTWA 5DNSA 3PSZA 4YFOA 4YC5A 2XT2A 4YCQA 3SQVA
chains in the Genus database with same CATH superfamily
2VFOA 1HF2A 5JLVC 2XTXA 2NZMA 1QA3A 2VFMA 4XKVA 1O8KA 4AVZA 1TYWA 2QZAA 2YUHA 3VSUA 1QA1A 2QY1A 1QCXA 3WWGA 2O0WA 1OGOX 1HG8A 5C1CA 2INVA 4XL9A 1TYXA 2EWEA 1K4ZA 3TH0A 1QRCA 1IDJA 2NT6A 1DBGA 3GQAA 3GRHA 4OJOA 4C2LA 4OPWA 1RU4A 1OFEA 3PSZA 4KH3A 1BN8A 2Z8GA 1O8DA 1TYVA 2VFQA 1PE9A 3EQOA 2O0VA 3GQ9A 3H09A 2PYGA 4URRA 4W8SA 3N6ZA 1LM1A 2VFPA 1QQ1A 4XOTA 4XONA 4OJPA 4HWVA 1VBLA 1IDKA 2VFNA 3JURA 1O8LA 1JRGA 4XLCA 2ODLA 2VJJA 1EZGA 1PLUA 1RMGA 4V02C 4XLAA 1BHEA 4MR0A 1TYUA 2VJIA 3PETA 4OJ6A 4MXNA 4YDTA 1H80A 1O8MA 2F3LA 3B8YA 3PSSA 1OFDA 4OZYA 2QYUA 4PMHA 2XT4A 1OOCA 4XLEA 4XORA 2VBEA 3JX8A 2QX3A 1QJVA 3VSTA 1QA2A 4YZQA 5DNSA 3EQNA 3VMWA 3P4GA 4XN0A 4YFOA 3SUCA 1O8IA 4W8QA 2PYHA 5C1EA 2X85A 2X6XA 4W8RA 4XQFA 1DABA 4OJLA 2BX6A 2NTBA 1NHCA 1LLZA 4YZXA 3ZPPA 1XG2A 4EW9A 1OGMX 2B0RA 3FY3A 3SZEA 1O8HA 2NSPA 1O88A 4YEIA 3NB2A 3SYJA 3GQ7A 1CLWA 2J8KA 1OFMA 4XKWA 1EE6A 3RIQA 3VSVA 3DU1X 2PECA 2BM7A 4U4BA 1GQ8A 4U49A 4XR6A 5AMVA 1RWRA 4OM9A 3ML3A 3AK5A 2QXZA 1WMRA 2IQ7A 1O8GA 4XNFA 2BM4A 2NT9A 1DBOA 2G0YA 2XC1A 1KCCA 4YELA 1L1IA 1K8FA 1AIRA 3LMWA 3BH6B 4NK6A 1KTWA 1CZFA 2O1DA 1QRBA 3LYCA 2X6YA 2BM6A 3BH7B 2X3HA 4YCQA 2NTQA 4W8TA 2UVEA 4XLFA 3SQVA 1WXRA 1O8JA 2J8IA 4XMYA 1X0CA 5JMCB 1IA5A 2XTYA 1O8EA 2NTPA 1EA0A 4NK8A 4I84A 2O04A 2BSPA 3NAWA 1O8FA 2INUA 2IOUG 2O17A 3SY2A 4YZ0A 1KCDA 2O6WA 1PXZA 1IB4A 1OFLA 3LJYA 2VBKA 4XLHA 4YZAA 4OJ5A 1KQ5A 2BM5A 3B4NA 4XN3A 2XTWA 3VMVA 2VBMA 2NSTA 2V5IA 1TSPA 3KRGA 4YEJA 1K5CA 3N90A 3B90A 3GQ8A 4YC5A 4Z03A 2W7ZA 4Z05A 4Z06A 1JTAA 2UVFA 3ZSCA 2X6WA 2XT2A 4JRAC 4XM3A 4XOPA 3T9GA 4OZZA 3UW0A 1LLWA
chains in the Genus database with same CATH topology
2XTXA 4YEIA 3NB2A 2XTYA 2QZAA 2J8KA 3NAWA 3SY2A 4YDTA 3DU1X 2O6WA 3PSSA 2QYUA 2XT4A 2XTWA 5DNSA 3PSZA 4YFOA 4YC5A 2XT2A 4YCQA 3SQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTX A;  4YEI A;  3NB2 A;  2XTY A;  2QZA A;  2J8K A;  3NAW A;  3SY2 A;  4YDT A;  3DU1 X;  2O6W A;  3PSS A;  2QYU A;  2XT4 A;  2XTW A;  5DNS A;  3PSZ A;  4YFO A;  4YC5 A;  2XT2 A;  4YCQ A;  3SQV A; 
#chains in the Genus database with same CATH topology
 2VFO A;  1HF2 A;  5JLV C;  2XTX A;  2NZM A;  1QA3 A;  2VFM A;  4XKV A;  1O8K A;  4AVZ A;  1TYW A;  2QZA A;  2YUH A;  3VSU A;  1QA1 A;  2QY1 A;  1QCX A;  3WWG A;  2O0W A;  1OGO X;  1HG8 A;  5C1C A;  2INV A;  4XL9 A;  1TYX A;  2EWE A;  1K4Z A;  3TH0 A;  1QRC A;  1IDJ A;  2NT6 A;  1DBG A;  3GQA A;  3GRH A;  4OJO A;  4C2L A;  4OPW A;  1RU4 A;  1OFE A;  3PSZ A;  4KH3 A;  1BN8 A;  2Z8G A;  1O8D A;  1TYV A;  2VFQ A;  1PE9 A;  3EQO A;  2O0V A;  3GQ9 A;  3H09 A;  2PYG A;  4URR A;  4W8S A;  3N6Z A;  1LM1 A;  2VFP A;  1QQ1 A;  4XOT A;  4XON A;  4OJP A;  4HWV A;  1VBL A;  1IDK A;  2VFN A;  3JUR A;  1O8L A;  1JRG A;  4XLC A;  2ODL A;  2VJJ A;  1EZG A;  1PLU A;  1RMG A;  4V02 C;  4XLA A;  1BHE A;  4MR0 A;  1TYU A;  2VJI A;  3PET A;  4OJ6 A;  4MXN A;  4YDT A;  1H80 A;  1O8M A;  2F3L A;  3B8Y A;  3PSS A;  1OFD A;  4OZY A;  2QYU A;  4PMH A;  2XT4 A;  1OOC A;  4XLE A;  4XOR A;  2VBE A;  3JX8 A;  2QX3 A;  1QJV A;  3VST A;  1QA2 A;  4YZQ A;  5DNS A;  3EQN A;  3VMW A;  3P4G A;  4XN0 A;  4YFO A;  3SUC A;  1O8I A;  4W8Q A;  2PYH A;  5C1E A;  2X85 A;  2X6X A;  4W8R A;  4XQF A;  1DAB A;  4OJL A;  2BX6 A;  2NTB A;  1NHC A;  1LLZ A;  4YZX A;  3ZPP A;  1XG2 A;  4EW9 A;  1OGM X;  2B0R A;  3FY3 A;  3SZE A;  1O8H A;  2NSP A;  1O88 A;  4YEI A;  3NB2 A;  3SYJ A;  3GQ7 A;  1CLW A;  2J8K A;  1OFM A;  4XKW A;  1EE6 A;  3RIQ A;  3VSV A;  3DU1 X;  2PEC A;  2BM7 A;  4U4B A;  1GQ8 A;  4U49 A;  4XR6 A;  5AMV A;  1RWR A;  4OM9 A;  3ML3 A;  3AK5 A;  2QXZ A;  1WMR A;  2IQ7 A;  1O8G A;  4XNF A;  2BM4 A;  2NT9 A;  1DBO A;  2G0Y A;  2XC1 A;  1KCC A;  4YEL A;  1L1I A;  1K8F A;  1AIR A;  3LMW A;  3BH6 B;  4NK6 A;  1KTW A;  1CZF A;  2O1D A;  1QRB A;  3LYC A;  2X6Y A;  2BM6 A;  3BH7 B;  2X3H A;  4YCQ A;  2NTQ A;  4W8T A;  2UVE A;  4XLF A;  3SQV A;  1WXR A;  1O8J A;  2J8I A;  4XMY A;  1X0C A;  5JMC B;  1IA5 A;  2XTY A;  1O8E A;  2NTP A;  1EA0 A;  4NK8 A;  4I84 A;  2O04 A;  2BSP A;  3NAW A;  1O8F A;  2INU A;  2IOU G;  2O17 A;  3SY2 A;  4YZ0 A;  1KCD A;  2O6W A;  1PXZ A;  1IB4 A;  1OFL A;  3LJY A;  2VBK A;  4XLH A;  4YZA A;  4OJ5 A;  1KQ5 A;  2BM5 A;  3B4N A;  4XN3 A;  2XTW A;  3VMV A;  2VBM A;  2NST A;  2V5I A;  1TSP A;  3KRG A;  4YEJ A;  1K5C A;  3N90 A;  3B90 A;  3GQ8 A;  4YC5 A;  4Z03 A;  2W7Z A;  4Z05 A;  4Z06 A;  1JTA A;  2UVF A;  3ZSC A;  2X6W A;  2XT2 A;  4JRA C;  4XM3 A;  4XOP A;  3T9G A;  4OZZ A;  3UW0 A;  1LLW A; 
#chains in the Genus database with same CATH homology
 2XTX A;  4YEI A;  3NB2 A;  2XTY A;  2QZA A;  2J8K A;  3NAW A;  3SY2 A;  4YDT A;  3DU1 X;  2O6W A;  3PSS A;  2QYU A;  2XT4 A;  2XTW A;  5DNS A;  3PSZ A;  4YFO A;  4YC5 A;  2XT2 A;  4YCQ A;  3SQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...