4YC5A

Beta1 synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords beta1
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
total genus 97
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yc5A00
4YDTA 3SQVA 2XT2A 3SY2A 2QYUA 3NB2A 3NAWA 2XTXA 4YC5A 2O6WA 4YEIA 3DU1X 2J8KA 4YFOA 3PSSA 5DNSA 3PSZA 4YCQA 2XTYA 2QZAA 2XTWA 2XT4A
chains in the Genus database with same CATH superfamily
4YDTA 3SUCA 3JX8A 4PMHA 2QY1A 2XT2A 1DABA 4XOPA 3BH6B 3JURA 3SY2A 1GQ8A 4XM3A 2O0VA 4NK6A 4Z06A 3EQNA 4NK8A 1QQ1A 1KTWA 2W7ZA 2XTXA 4XKVA 1OFEA 4XORA 2ODLA 1KCDA 3EQOA 4XLHA 4U4BA 1IDJA 4XR6A 4I84A 4XMYA 3VMVA 2VJIA 4YELA 3BH7B 1RWRA 2X85A 3DU1X 4XLCA 1JRGA 4YFOA 1EE6A 1QRBA 2BSPA 1WXRA 2G0YA 4XQFA 2NT9A 4YCQA 1VBLA 2VFNA 2XTYA 2XC1A 1QA3A 1O8JA 4W8QA 4XLFA 3VMWA 2V5IA 3SYJA 1LM1A 2XT4A 2INUA 3LMWA 2F3LA 2YUHA 3RIQA 3GQAA 3ML3A 2X6WA 1QA1A 1QA2A 3NB2A 2EWEA 3GQ8A 3NAWA 4OJ6A 1X0CA 4XLAA 1O8DA 1LLWA 2VFPA 4MXNA 3GQ7A 4OJ5A 2BM5A 4XNFA 1NHCA 3N6ZA 2J8IA 1QCXA 4OM9A 4XONA 1K5CA 3UW0A 4OZZA 5JLVC 1PXZA 2Z8GA 1OFLA 1OFDA 2QXZA 2BM6A 2O04A 4XN3A 3WWGA 2VFOA 1O8EA 1HG8A 3N90A 3H09A 2NSPA 1PE9A 1XG2A 2VBEA 2BM4A 3T9GA 4URRA 2QX3A 2NTQA 2QZAA 5JMCB 1OGMX 2X6XA 3GQ9A 2PECA 4V02C 1EA0A 2NTBA 2O1DA 1HF2A 2VBKA 1CZFA 2QYUA 3VSTA 1BHEA 2VJJA 1EZGA 4OJLA 2X6YA 4XLEA 2IOUG 2O17A 2PYGA 3TH0A 1KQ5A 2BM7A 4YC5A 1BN8A 4XKWA 3GRHA 4Z05A 2O6WA 5C1EA 1QJVA 4YEIA 2VBMA 2J8KA 1TYUA 3PSSA 4KH3A 4HWVA 4OJPA 3AK5A 1CLWA 2VFMA 4YZXA 4YZ0A 1AIRA 1TSPA 3B90A 4OZYA 4U49A 1O8GA 1K4ZA 1WMRA 4C2LA 4JRAC 2XTWA 2PYHA 3SZEA 1RMGA 2NSTA 4OJOA 4Z03A 3SQVA 1DBGA 2UVEA 1O8MA 2BX6A 2B0RA 3P4GA 3PETA 3VSVA 1K8FA 3KRGA 2VFQA 1QRCA 1OGOX 1TYVA 1O8HA 2O0WA 3ZSCA 1TYXA 4EW9A 1IB4A 1DBOA 1PLUA 5AMVA 4MR0A 1L1IA 1TYWA 4YEJA 2IQ7A 4XN0A 4XOTA 3ZPPA 3B4NA 1O8LA 1LLZA 1IA5A 1O8IA 1H80A 1JTAA 1O8FA 1O88A 1OFMA 1OOCA 4W8RA 4XL9A 4YZAA 5DNSA 1RU4A 4W8SA 2UVFA 4W8TA 3FY3A 2NT6A 4AVZA 1IDKA 3PSZA 4YZQA 3B8YA 3VSUA 3LJYA 4OPWA 2NZMA 2NTPA 2INVA 3LYCA 2X3HA 1O8KA 5C1CA 1KCCA
chains in the Genus database with same CATH topology
4YDTA 3SQVA 2XT2A 3SY2A 2QYUA 3NB2A 3NAWA 2XTXA 4YC5A 2O6WA 4YEIA 3DU1X 2J8KA 4YFOA 3PSSA 5DNSA 3PSZA 4YCQA 2XTYA 2QZAA 2XTWA 2XT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  3SQV A;  2XT2 A;  3SY2 A;  2QYU A;  3NB2 A;  3NAW A;  2XTX A;  4YC5 A;  2O6W A;  4YEI A;  3DU1 X;  2J8K A;  4YFO A;  3PSS A;  5DNS A;  3PSZ A;  4YCQ A;  2XTY A;  2QZA A;  2XTW A;  2XT4 A; 
#chains in the Genus database with same CATH topology
 4YDT A;  3SUC A;  3JX8 A;  4PMH A;  2QY1 A;  2XT2 A;  1DAB A;  4XOP A;  3BH6 B;  3JUR A;  3SY2 A;  1GQ8 A;  4XM3 A;  2O0V A;  4NK6 A;  4Z06 A;  3EQN A;  4NK8 A;  1QQ1 A;  1KTW A;  2W7Z A;  2XTX A;  4XKV A;  1OFE A;  4XOR A;  2ODL A;  1KCD A;  3EQO A;  4XLH A;  4U4B A;  1IDJ A;  4XR6 A;  4I84 A;  4XMY A;  3VMV A;  2VJI A;  4YEL A;  3BH7 B;  1RWR A;  2X85 A;  3DU1 X;  4XLC A;  1JRG A;  4YFO A;  1EE6 A;  1QRB A;  2BSP A;  1WXR A;  2G0Y A;  4XQF A;  2NT9 A;  4YCQ A;  1VBL A;  2VFN A;  2XTY A;  2XC1 A;  1QA3 A;  1O8J A;  4W8Q A;  4XLF A;  3VMW A;  2V5I A;  3SYJ A;  1LM1 A;  2XT4 A;  2INU A;  3LMW A;  2F3L A;  2YUH A;  3RIQ A;  3GQA A;  3ML3 A;  2X6W A;  1QA1 A;  1QA2 A;  3NB2 A;  2EWE A;  3GQ8 A;  3NAW A;  4OJ6 A;  1X0C A;  4XLA A;  1O8D A;  1LLW A;  2VFP A;  4MXN A;  3GQ7 A;  4OJ5 A;  2BM5 A;  4XNF A;  1NHC A;  3N6Z A;  2J8I A;  1QCX A;  4OM9 A;  4XON A;  1K5C A;  3UW0 A;  4OZZ A;  5JLV C;  1PXZ A;  2Z8G A;  1OFL A;  1OFD A;  2QXZ A;  2BM6 A;  2O04 A;  4XN3 A;  3WWG A;  2VFO A;  1O8E A;  1HG8 A;  3N90 A;  3H09 A;  2NSP A;  1PE9 A;  1XG2 A;  2VBE A;  2BM4 A;  3T9G A;  4URR A;  2QX3 A;  2NTQ A;  2QZA A;  5JMC B;  1OGM X;  2X6X A;  3GQ9 A;  2PEC A;  4V02 C;  1EA0 A;  2NTB A;  2O1D A;  1HF2 A;  2VBK A;  1CZF A;  2QYU A;  3VST A;  1BHE A;  2VJJ A;  1EZG A;  4OJL A;  2X6Y A;  4XLE A;  2IOU G;  2O17 A;  2PYG A;  3TH0 A;  1KQ5 A;  2BM7 A;  4YC5 A;  1BN8 A;  4XKW A;  3GRH A;  4Z05 A;  2O6W A;  5C1E A;  1QJV A;  4YEI A;  2VBM A;  2J8K A;  1TYU A;  3PSS A;  4KH3 A;  4HWV A;  4OJP A;  3AK5 A;  1CLW A;  2VFM A;  4YZX A;  4YZ0 A;  1AIR A;  1TSP A;  3B90 A;  4OZY A;  4U49 A;  1O8G A;  1K4Z A;  1WMR A;  4C2L A;  4JRA C;  2XTW A;  2PYH A;  3SZE A;  1RMG A;  2NST A;  4OJO A;  4Z03 A;  3SQV A;  1DBG A;  2UVE A;  1O8M A;  2BX6 A;  2B0R A;  3P4G A;  3PET A;  3VSV A;  1K8F A;  3KRG A;  2VFQ A;  1QRC A;  1OGO X;  1TYV A;  1O8H A;  2O0W A;  3ZSC A;  1TYX A;  4EW9 A;  1IB4 A;  1DBO A;  1PLU A;  5AMV A;  4MR0 A;  1L1I A;  1TYW A;  4YEJ A;  2IQ7 A;  4XN0 A;  4XOT A;  3ZPP A;  3B4N A;  1O8L A;  1LLZ A;  1IA5 A;  1O8I A;  1H80 A;  1JTA A;  1O8F A;  1O88 A;  1OFM A;  1OOC A;  4W8R A;  4XL9 A;  4YZA A;  5DNS A;  1RU4 A;  4W8S A;  2UVF A;  4W8T A;  3FY3 A;  2NT6 A;  4AVZ A;  1IDK A;  3PSZ A;  4YZQ A;  3B8Y A;  3VSU A;  3LJY A;  4OPW A;  2NZM A;  2NTP A;  2INV A;  3LYC A;  2X3H A;  1O8K A;  5C1C A;  1KCC A; 
#chains in the Genus database with same CATH homology
 4YDT A;  3SQV A;  2XT2 A;  3SY2 A;  2QYU A;  3NB2 A;  3NAW A;  2XTX A;  4YC5 A;  2O6W A;  4YEI A;  3DU1 X;  2J8K A;  4YFO A;  3PSS A;  5DNS A;  3PSZ A;  4YCQ A;  2XTY A;  2QZA A;  2XTW A;  2XT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...