4YC5A

Beta1 synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1
total genus 97
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yc5A00
4YFOA 3PSSA 2J8KA 5DNSA 3SY2A 2XT4A 3NAWA 3SQVA 3PSZA 2XTXA 2QZAA 2XT2A 4YCQA 4YC5A 2XTYA 4YEIA 2XTWA 3NB2A 4YDTA 3DU1X 2O6WA 2QYUA
chains in the Genus database with same CATH superfamily
1LLWA 2VFOA 3BH6B 3WWGA 1EE6A 2B0RA 1O8DA 2J8KA 2VBEA 4OJLA 4Z05A 3GQ9A 1L1IA 2BSPA 4NK6A 4U4BA 3EQOA 2QXZA 2X6WA 2J8IA 3NAWA 2X85A 1O8KA 4MXNA 1EA0A 4JRAC 1QRCA 1BN8A 2VFQA 1IA5A 4XKVA 3RIQA 4YZ0A 2O17A 4Z06A 2XTYA 3TH0A 4YELA 1TYVA 2NSTA 4I84A 4YZXA 1BHEA 2IQ7A 2XTWA 2G0YA 2BM4A 3B8YA 4OZZA 5AMVA 1LM1A 4OM9A 1K5CA 2NTBA 4OJOA 1KQ5A 3ML3A 1PLUA 4XQFA 4YFOA 3PSSA 3SUCA 5DNSA 2O1DA 1LLZA 2XT4A 3T9GA 4XLCA 1DBGA 2QY1A 2VJIA 2BM6A 3LJYA 4XN0A 1O8GA 2X3HA 2BM7A 3JURA 4PMHA 4XLHA 4W8SA 3SQVA 3ZSCA 2VFNA 3VMVA 4AVZA 4MR0A 1EZGA 2XTXA 4W8RA 1OOCA 1H80A 3EQNA 5C1CA 5JMCB 3UW0A 1JTAA 1GQ8A 4XKWA 1IB4A 1WMRA 2NZMA 3N6ZA 4URRA 4XONA 4Z03A 4XOTA 1QRBA 1OFDA 1QCXA 2NSPA 1QA1A 2X6XA 1RU4A 1XG2A 4U49A 3DU1X 2O04A 2O0VA 2VFPA 1OGMX 2V5IA 4HWVA 3GQ8A 3VMWA 2VBMA 1QJVA 2VBKA 1AIRA 2NT9A 3SY2A 1RWRA 2O0WA 3PETA 4XLAA 1VBLA 4YZQA 3GQ7A 1IDJA 1RMGA 2NTPA 2UVEA 3SZEA 1PXZA 1QA3A 4OZYA 1QQ1A 1OGOX 1K8FA 1TSPA 3GRHA 2IOUG 4W8TA 4XORA 1DBOA 1PE9A 1O8IA 3JX8A 4EW9A 4OJPA 1TYXA 2NTQA 1HG8A 4XOPA 1NHCA 2PECA 1K4ZA 1CZFA 2X6YA 1IDKA 4KH3A 4YZAA 3LYCA 3ZPPA 1OFEA 4OJ5A 4YEIA 1O8MA 1O8LA 1WXRA 4XM3A 4OJ6A 2PYHA 4XLFA 4XN3A 2VJJA 3P4GA 2QYUA 1QA2A 2UVFA 2PYGA 3VSUA 1CLWA 2BM5A 1O88A 2QX3A 2YUHA 3B4NA 3AK5A 2EWEA 4XMYA 4W8QA 5JLVC 1O8FA 1OFMA 4XL9A 4XLEA 4XR6A 3SYJA 2W7ZA 3GQAA 2F3LA 1O8JA 2BX6A 3KRGA 2Z8GA 3H09A 1KTWA 3PSZA 4NK8A 3N90A 1DABA 4XNFA 1TYUA 2ODLA 4YEJA 2QZAA 2NT6A 2INUA 3FY3A 4OPWA 2INVA 2XT2A 3B90A 1HF2A 1KCDA 1TYWA 4V02C 4YC5A 4YCQA 3VSTA 3VSVA 1OFLA 3LMWA 5C1EA 3NB2A 1JRGA 4C2LA 4YDTA 2XC1A 1O8HA 2O6WA 3BH7B 1KCCA 1X0CA 1O8EA 2VFMA
chains in the Genus database with same CATH topology
4YFOA 3PSSA 2J8KA 5DNSA 3SY2A 2XT4A 3NAWA 3SQVA 3PSZA 2XTXA 2QZAA 2XT2A 4YCQA 4YC5A 2XTYA 4YEIA 2XTWA 3NB2A 4YDTA 3DU1X 2O6WA 2QYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFO A;  3PSS A;  2J8K A;  5DNS A;  3SY2 A;  2XT4 A;  3NAW A;  3SQV A;  3PSZ A;  2XTX A;  2QZA A;  2XT2 A;  4YCQ A;  4YC5 A;  2XTY A;  4YEI A;  2XTW A;  3NB2 A;  4YDT A;  3DU1 X;  2O6W A;  2QYU A; 
#chains in the Genus database with same CATH topology
 1LLW A;  2VFO A;  3BH6 B;  3WWG A;  1EE6 A;  2B0R A;  1O8D A;  2J8K A;  2VBE A;  4OJL A;  4Z05 A;  3GQ9 A;  1L1I A;  2BSP A;  4NK6 A;  4U4B A;  3EQO A;  2QXZ A;  2X6W A;  2J8I A;  3NAW A;  2X85 A;  1O8K A;  4MXN A;  1EA0 A;  4JRA C;  1QRC A;  1BN8 A;  2VFQ A;  1IA5 A;  4XKV A;  3RIQ A;  4YZ0 A;  2O17 A;  4Z06 A;  2XTY A;  3TH0 A;  4YEL A;  1TYV A;  2NST A;  4I84 A;  4YZX A;  1BHE A;  2IQ7 A;  2XTW A;  2G0Y A;  2BM4 A;  3B8Y A;  4OZZ A;  5AMV A;  1LM1 A;  4OM9 A;  1K5C A;  2NTB A;  4OJO A;  1KQ5 A;  3ML3 A;  1PLU A;  4XQF A;  4YFO A;  3PSS A;  3SUC A;  5DNS A;  2O1D A;  1LLZ A;  2XT4 A;  3T9G A;  4XLC A;  1DBG A;  2QY1 A;  2VJI A;  2BM6 A;  3LJY A;  4XN0 A;  1O8G A;  2X3H A;  2BM7 A;  3JUR A;  4PMH A;  4XLH A;  4W8S A;  3SQV A;  3ZSC A;  2VFN A;  3VMV A;  4AVZ A;  4MR0 A;  1EZG A;  2XTX A;  4W8R A;  1OOC A;  1H80 A;  3EQN A;  5C1C A;  5JMC B;  3UW0 A;  1JTA A;  1GQ8 A;  4XKW A;  1IB4 A;  1WMR A;  2NZM A;  3N6Z A;  4URR A;  4XON A;  4Z03 A;  4XOT A;  1QRB A;  1OFD A;  1QCX A;  2NSP A;  1QA1 A;  2X6X A;  1RU4 A;  1XG2 A;  4U49 A;  3DU1 X;  2O04 A;  2O0V A;  2VFP A;  1OGM X;  2V5I A;  4HWV A;  3GQ8 A;  3VMW A;  2VBM A;  1QJV A;  2VBK A;  1AIR A;  2NT9 A;  3SY2 A;  1RWR A;  2O0W A;  3PET A;  4XLA A;  1VBL A;  4YZQ A;  3GQ7 A;  1IDJ A;  1RMG A;  2NTP A;  2UVE A;  3SZE A;  1PXZ A;  1QA3 A;  4OZY A;  1QQ1 A;  1OGO X;  1K8F A;  1TSP A;  3GRH A;  2IOU G;  4W8T A;  4XOR A;  1DBO A;  1PE9 A;  1O8I A;  3JX8 A;  4EW9 A;  4OJP A;  1TYX A;  2NTQ A;  1HG8 A;  4XOP A;  1NHC A;  2PEC A;  1K4Z A;  1CZF A;  2X6Y A;  1IDK A;  4KH3 A;  4YZA A;  3LYC A;  3ZPP A;  1OFE A;  4OJ5 A;  4YEI A;  1O8M A;  1O8L A;  1WXR A;  4XM3 A;  4OJ6 A;  2PYH A;  4XLF A;  4XN3 A;  2VJJ A;  3P4G A;  2QYU A;  1QA2 A;  2UVF A;  2PYG A;  3VSU A;  1CLW A;  2BM5 A;  1O88 A;  2QX3 A;  2YUH A;  3B4N A;  3AK5 A;  2EWE A;  4XMY A;  4W8Q A;  5JLV C;  1O8F A;  1OFM A;  4XL9 A;  4XLE A;  4XR6 A;  3SYJ A;  2W7Z A;  3GQA A;  2F3L A;  1O8J A;  2BX6 A;  3KRG A;  2Z8G A;  3H09 A;  1KTW A;  3PSZ A;  4NK8 A;  3N90 A;  1DAB A;  4XNF A;  1TYU A;  2ODL A;  4YEJ A;  2QZA A;  2NT6 A;  2INU A;  3FY3 A;  4OPW A;  2INV A;  2XT2 A;  3B90 A;  1HF2 A;  1KCD A;  1TYW A;  4V02 C;  4YC5 A;  4YCQ A;  3VST A;  3VSV A;  1OFL A;  3LMW A;  5C1E A;  3NB2 A;  1JRG A;  4C2L A;  4YDT A;  2XC1 A;  1O8H A;  2O6W A;  3BH7 B;  1KCC A;  1X0C A;  1O8E A;  2VFM A; 
#chains in the Genus database with same CATH homology
 4YFO A;  3PSS A;  2J8K A;  5DNS A;  3SY2 A;  2XT4 A;  3NAW A;  3SQV A;  3PSZ A;  2XTX A;  2QZA A;  2XT2 A;  4YCQ A;  4YC5 A;  2XTY A;  4YEI A;  2XTW A;  3NB2 A;  4YDT A;  3DU1 X;  2O6W A;  2QYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...