3VSUA

The complex structure of xylc with xylobiose
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 240
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsuA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsuA01
3VGGA 1CPUA 3L4WA 3TONA 1O8FA 1HG8A 3WWGA 3LRLA 4J3XA 3L4UA 4NX0A 4NZFA 2C7FA 3UEQA 1R75A 3CZGA 4GO9A 3OLEA 2VT0A 3KWXA 4XONA 1KGWA 1SZNA 3BMWA 4J3SA 1XGZA 3S5ZA 1ZJBA 1EH9A 4JCMA 1RU4A 1QI4A 3BAXA 1JF6A 1D3CA 4JFTA 4X9YA 3A23A 1CGVA 1MXDA 2VBMA 3GQ8A 1I75A 2ZX5A 1KXVA 3ZQ9A 1AQHA 3OLIA 5I0DA 1AIRA 2WVVB 3A5VA 3DHUA 1D7FA 3WY1A 3ZSSA 1WZKA 3VM7A 4PSRA 5HPOA 1O8EA 1TQSA 4U2ZA 3FW6A 4FLSA 1J0HA 3K8MA 4H8UA 4I84A 4FLQA 4HOXA 2V3EA 3T9GA 1GJUA 1KCLA 3B8YA 2OSXA 3WDIA 3CGTA 3ZOAA 7CGTA 3VMOA 1XSKA 3WFZA 3WNOA 2X2IA 2EWEA 1O7DC 4HOWA 4W8RA 5I5RA 1E3XA 4FNPA 3KE0A 3GXMA 3VGBA 1CXIA 4J3UA 3DDFA 3W38A 1XV8A 1B0IA 1AVAA 3D4YA 1PZ2A 3BSHA 3DX3A 2NT9A 1HX0A 1UD5A 2QLYA 3LPOA 3WNPA 3UG4A 4CVWA 1VIWA 1DEDA 1JTAA 1PLUA 4M56A 4PEEA 4B9ZA 1RP8A 1M53A 4UOZA 2AAAA 1KBBA 2BXZA 2WVTA 2XN2A 2ZUWA 1QPKA 4GIAA 2ODLA 4XR6A 2IGTA 3D52A 3H53A 4GQQA 3JURA 4OJ5A 4XOTA 1XD1A 3BSGA 1KXTA 2XVKA 2WANA 3A6OA 1QWNA 3GXDA 3RIKA 4CN4A 1UH4A 4JL1A 4J3TA 1QJVA 1CXHA 3VNZA 3BCDA 3L4ZA 3OLDA 3ZSTA 3HG2A 1IDJA 1PEZA 1MXGA 2ALWA 4HP5A 3CLWA 3WEMA 2BY0A 4XL9A 2YA0A 2WKLA 2NT6A 4LQ1A 4YZ0A 2INVA 1R46A 4DO5A 2ZXAA 3BUIA 4GKLA 3FY3A 3DX2A 5EMYA 3TTYA 2D3LA 3K8KA 4WSJA 5BRQA 1O8IA 2O04A 1G94A 2Y4SA 3VU2A 2EABA 8CGTA 1ODUA 1MVYA 2ZUVA 1JDCA 3B4NA 1KWGA 4JFWA 2FHCA 1HWWA 4FNTA 2F2HA 1V3MA 4FLOA 2ZUSA 3VGFA 5C1CA 3VMVA 4YZQA 3WELA 4OKDA 1WMRA 4UZUA 1RPKA 1QI5A 1BHEA 3AMLA 1MW2A 2PECA 1UD8A 1V3KA 3ZR5A 2GJPA 3IJ7A 3A21A 2EO7A 2PWGA 4M8UA 4OJYA 3S2CA 4AVZA 3GTNA 1IB4A 4NK8A 1O8KA 3HG3A 4URRA 3EJUA 3LXBA 1KCDA 1M7XA 1J0IA 3IK2A 4AMXA 4XLCA 4YZXA 1ZJAA 2QMKA 1HL9A 3BVVA 3EDJA 5E6ZA 3WNKA 1KWKA 3WNLA 2EACA 3VGDA 1O88A 1O8GA 4WF7A 4FNSA 3BUQA 5A2CA 2ZWYA 4DO4A 1CYGA 2VUYA 3LMWA 2F7QA 5E6YA 1GCYA 2X2JA 1QHPA 1BVNP 4GI9A 1VBLA 1J0KA 2WVSA 4MAZA 2NZMA 3VSVA 2NTBA 2D3NA 1MWOA 4PCSA 4AIEA 3EJPA 1JIBA 1RP9A 1UKSA 3DX0A 2E4TA 1KXQA 2CPUA 1CIUA 2PWEA 4XKWA 4YELA 1JD7A 2YOCA 1KBKA 4J27A 2F1AA 1WZMA 2CXGA 1CLVA 1NOFA 2ZX9A 3BC9A 2OYKA 2XWDA 3WNNA 1CGXA 1BSIA 1QW9A 1UA7A 5I23A 1OFMA 2ZXDA 1K5CA 4EW9A 1J0JA 1TQVA 1S46A 2TAAA 3GQAA 2ZICA 2WVVA 1BF2A 1CGYA 1BPLB 4XKVA 2DH3A 1EE6A 2F7PA 1LWHA 1WE5A 1JD9A 1OGSA 1R47A 3CZKA 2VJJA 4UQBA 2G3MA 3UERA 1KTWA 1MW0A 3CZEA 1JXJA 2OSWA 1C8QA 5E0FA 1U33A 3II1A 1UA3A 1KGUA 1OSEA 1H3GA 1UH3A 3AJ7A 1QHOA 3CV5A 5DFAA 3GQ9A 1VFUA 4HPHA 2ZE0A 3VX0A 3M07A 2FGZA 6CGTA 4MR0A 2Y24A 4HWVA 5I24A 1BG9A 3BLBA 3EJSA 1B2YA 1IV8A 2ZX7A 2QY1A 2NTPA 3MI6A 1NM9A 3GXTA 2XVLA 4KWUA 4JFUA 1HVXA 3LXAA 3WY4A 2BHZA 4GQRA 3EJQA 1SMAA 1U2YA 3KEHA 2QPSA 4U3CA 2X6XA 1BN8A 5A6MA 3BUPA 2XN0A 1O8MA 4Z06A 2YFNA 3VMWA 1G9HA 3VM5A 1MFUA 1PIGA 2NSXA 5CLTA 3L4XA 3BVXA 4XLFA 1JI2A 1A47A 1KXHA 2WNWA 4FMVA 3KL3A 2QXZA 4OJOA 2FH6A 2ZIDA 3BAWA 4YEJA 3UG5A 3A47A 1JF5A 3KLLA 1KCCA 4MB1A 2O17A 1HT6A 1UASA 1BAGA 3H55A 2PWHA 2YA1A 1DBOA 1UH2A 4U31A 1UD4A 4OJPA 1L0PA 2E9BA 1MW1A 5CGMA 3WY3A 2AMGA 1DTUA 3AMKA 5CLWA 2BHYA 2EAEA 3ZR6A 4AIOA 1OFLA 3IGUA 3GRHA 4XB3A 4MXNA 3ZSCA 3S5YA 1GQ8A 1WO2A 3LPPA 2O0WA 3GQ7A 3BUDA 4W8TA 1OT2A 1O8JA 1CXEA 2D0FA 3D51A 4KMQA 5HXMA 4AYSA 2WSKA 1UD6A 2X6YA 1G5AA 3VGHA 1PXZA 3L4VA 4XLHA 4U4BA 3IJ8A 4U2YA 4NI3A 4JCLA 2F7OA 4J3VA 1H80A 1BLIA 4XN3A 1XH2A 1T0OA 1WPCA 3EDFA 5DO8A 1EO5A 3EDEA 1E40A 1KB3A 1G1YA 4J3WA 3ZT5A 2YJQA 1JI1A 1GJWA 4UQCA 4UCFA 3OLGA 3LRKA 3VNYA 1IDKA 1VFOA 1WZLA 1QI3A 2ZX8A 2NSTA 4XLAA 4Z03A 2F61A 3BAKA 4H8HA 2OW7A 3VMPA 5KEZA 3TOPA 1JG9A 2INUA 2WPGA 4OGZA 4PSPA 2X85A 1XH1A 2WSPA 1CGWA 3VGEA 2QMJA 3BVUA 7TAAA 2NT1A 1QW8A 2E8YA 1VAHA 1TQWA 1QWUA 2BHUA 4AW7A 3CTTA 4NZJA 3A24A 1PS3A 1O8HA 5E70A 2EQDA 1DHKA 2XWEA 2EJ1A 3IJ9A 1AQMA 3FAXA 3KL0A 4H8VA 3TTSA 3WENA 1RMGA 2D73A 2V3FA 4GI6A 3DX1A 3SUCA 1IZKA 1Z32X 3DHPA 4J28A 2E8ZA 4BZYA 1PE9A 4UQEA 2Z8GA 2X6WA 2YA2A 3WDHA 1Y7VA 4OZZA 1JRGA 4OIFA 1P6WA 5HDRA 2EEXA 4LPCA 3BLKA 3CZSA 3BH4A 3HZ3A 4XM3A 5F7UA 1O8LA 4CN6A 1EA9C 3UG3A 2Y5EA 1XSJA 3AXIA 2UVEA 2WKGA 2YFOA 5A2AA 2XN1A 2BXYA 3A22A 2DIEA 2FHFA 1XCXA 1ZS2A 2VJIA 4CGTA 3EDKA 4JFSA 3GXIA 1VFMA 3BVWA 1KTBA 3GXFA 1EHAA 1V3LA 1OGOX 2Y2WA 2C8NA 1O8DA 2OYLA 3LRMA 4GO8A 4GI8A 2GJRA 4OZYA 3DC0A 2BY2A 3WEOA 4AEFA 2ZXBA 1JL8A 4AMWA 4XNFA 1R34A 4XOPA 1PIFA 1W9XA 4JFVA 4FLRA 1V3JA 4H7VA 4AEEA 4W8QA 3DX4A 4XLEA 3UCQA 1JFHA 3B90A 2QX3A 6TAAA 1UOKA 3VO0A 2EADA 1XSIA 2Z1KA 1NHCA 4OJ6A 3ECQA 3H54A 1HNYA 2ZWZA 1KTCA 2F18A 2QV4A 4C2LA 4GINA 4U49A 1JXKA 3BAYA 3DDGA 2GUYA 3A4AA 1WZAA 4UQ9A 2NTQA 1XD0A 2WC7A 3D4ZA 2OW6A 1E43A 1U30A 4JL2A 3ZT7A 1OOCA 2XIIA 3BUBA 4H2CA 4W8SA 4PCTA 1MFVA 4CN1A 3HG4A 1OGMX 4XMYA 2QPUA 3D50A 3GXNA 3KL5A 2O1DA 4Z05A 2D0GA 1CXFA 1LWJA 3KRGA 1OB0A 4CKQA 1QCXA 2BY3A 2V3DA 1GVIA 1PJ9A 1UKTA 1RWRA 1KCKA 1OT1A 4UQAA 2E0PA 2FYVA 2XVGA 3ZPPA 1PZ3A 1Q4NX 2VRQA 2YKKA 3WDJA 3K1DA 4BA0A 2OYMA 1JGIA 3BVTA 1CXKA 3VX1A 2BY1A 4WLCA 3VSUA 1JAEA 2UVFA 1R33A 2YIHA 2ZUUA 3WY2A 2PYHA 3EQNA 1IA5A 4NXKA 4ATWA 3LX9A 3BLPX 1E3ZA 1HTYA 3AXHA 4U33A 2VNCA 5CXPA 1CGUA 2NSPA 4J7RA 4XN0A 2F1BA 3EDDA 3WN6A 5A2BA 1XCWA 4OJLA 5TD4A 2PWFA 4HA1A 3GXPA 3HG5A 2FE0A 3W37A 2DIJA 1CXLA 2VBKA 2F7RA 1EO7A 2DH2A 2G3NA 3K8LA 4TVUA 1TQTA 2J25A 2WCGA 2WCSA 1HXKA 3BMVA 3GBDA 2FHBA 4XQFA 3L2MA 4X0NA 3CZNA 2XIBA 2ZUTA 1UKQA 2NT0A 4FNQA 3EJRA 3EJTA 3KLKA 3L4YA 2VR5A 3RILA 2FH8A 4UNIA 2OSYA 3VSTA 4WSKA 3EQOA 2X3HA 4UQDA 3GBEA 3FAWA 3VMNA 1TQUA 1WP6A 2D0HA 1CGTA 2ZXQA 3LXCA 5E1QA 4UZSA 4YZAA 4AYGA 1KGXA 1PAMA 1HL8A 1PPIA 1XH0A 5A6LA 4PMHA 4UOQA 4HOZA 2X2HA 3TV8A 4E2OA 4NXSA 1X0CA 3BAJA 1JDAA 3CPUA 4FNRA 4B9YA 4QAWA 1VB9A 3WNMA 3QGVA 3CZLA 2IQ7A 5C1EA 2D2OA 1QX1A 1XG2A 1TMQA 2CHNA 4LXFA 4FNUA 2PYGA 3BAIA 3ZO9A 5BRPA 1AMYA 1MW3A 1UD2A 2ZX6A 4XORA 3HJEA 1IZJA 3CC1A 2GVYA 4DO6A 2VBEA 2WVUA 3WMSA 1DBGA 4W93A 3L4TA 3L2LA 3ZT6A 2BSPA 4NK6A 1CZFA 1CDGA 9CGTA 1VJSA 1UD3A 2VRKA 5AMVA 1JDDA 2O0VA 1SMDA 2PWDA 1BVZA 3BCFA 5CGTA 1TCMA 3UW0A 5E9AA
chains in the Genus database with same CATH superfamily
3MRNB 3VGGA 1CPUA 3Q48A 4GRWE 5AB2A 3BGAA 4PVMA 4UM8B 5DJ8A 1DN0A 3TT3L 4YDVA 4IOFD 4FXKA 4HIEA 3B5GA 4N0UB 3G08B 1URIA 4WDIB 5ANME 2YD8A 4GO9A 3OLEA 3QO0B 3QSKB 3FCTB 4OD2B 3K46A 4HWUA 3ELQA 3FO0L 3QJZA 4PJDE 4XNYL 1BXXA 1KC5L 2DWXA 4XVUC 3WXWL 4UIKL 2FLRT 3GO1L 1FYTD 2XBTA 4BQCA 1U2CA 1KXVA 3LMJH 1TOXA 2HCZX 3BUTA 5F0PB 2WVVB 2ZXGA 5KAQG 4H1LB 2H0FA 2EE2A 3TO4A 2EZ0D 1I8IA 5T1DH 3P0YH 1X5LA 4AL8H 2V7HB 2IAND 5I0WA 3ESVF 3ISWA 1U93A 3WFZA 3ARDB 2FEEI 4Y9BA 1CR9H 4ZDHB 1WHPA 5E6ID 2XNAA 1NINA 3W38A 4G7QB 3TFKD 3VG0L 5IMKB 1YNLL 3HBPA 3QP3A 3M7FB 1WYJA 2Y7QA 4Z78A 5EO9B 4PEEA 1IQDA 1USZA 4MDIA 1RP8A 3STZA 3G7TA 1KBBA 4N0RA 2AXFB 1IAIH 4RQQB 1N3NB 1XH3B 4XI5D 1SJVA 1J9CT 2CHXA 4LSTL 5DO2D 1L7TL 1KDIA 2X53A 5JHDD 5GRVL 3GXDA 4OT1L 1UH4A 4J3TA 1V55B 4O2EA 4QHKJ 2DLFL 3GD1C 1YEHH 1Z0NA 3VJ6A 4D9LH 2H2SD 4DUWA 1ZV5A 1BJ8A 2IALA 4Z5RA 4QHPA 4JFZH 4XMLH 2F68X 4PWEA 2LVEA 4ZTOL 4UV7L 3G5YB 1CQYA 1X5FA 2V9UA 4Z3EA 3MV8D 3QI9B 4NRZB 3UYRH 3IF1B 4Z7VA 3PWLA 4L2LA 4UTBH 2VL5A 1ZDQA 2ZOTA 4LCCB 3TTYA 1Q9WB 3MRLB 4OJCA 4QDGA 3MC0A 1BM3H 3LPWA 1XF3A 3VU2A 2EABA 1NCAH 3RVWD 4YNYB 1KB9J 1LP9B 4CKVX 3BEWA 4V1DB 3E80A 4FFZL 4Z0BH 3LN4A 2CBPA 3HE7A 1CFQA 3LNEA 1RK0A 3P2DA 2AERT 4KDVA 4S2SA 3W56A 1CFNA 1N4XH 2W1NA 4EN3D 2AJ3B 2D3JA 3ET9F 5EF1A 1INQB 1MAML 4UZUA 3ECWA 4P2RE 5FAAA 5BPPA 2GJPA 3PP3K 3PHQB 4P2OA 1BJMA 1KYFA 1SLWA 2X10A 4RWHA 5TF0A 3G5XA 4R96B 4WY7H 3VRLE 3GFUA 4X50A 3TVMB 3PRZA 4K8RL 4MMXC 1UEMA 2QMKA 4J3OG 4OZ4B 1C5DA 3VXRE 1AMXA 3QIUB 5SV4A 4DUXA 1S7XB 4P2AA 4HIXL 1KELL 3VGDA 3VD1A 2W9DH 3A4DA 3OB8A 3OAUH 3WIHA 2ZWYA 1GS7A 1CYGA 1CFBA 4F2MA 1BXUA 4AT6B 1CK0L 2R1XB 1JWUA 3LOWA 5CEZD 5B8CA 4EZKA 2QDVA 1QZ1A 3FT3A 2VLRB 4X4XB 3NZSA 2X4TB 1K3IA 1LK2A 3MLZH 2A6IA 4MKTA 4LLQB 1BZ9A 2FQFA 1G7MA 1BZDA 2CLVB 1PCXA 4G6MH 5IEHB 5I8CB 3SDCC 1X5KA 3HC3H 3PE9A 4I0PB 2Y5QA 2CIIA 4FQHA 3HPLA 4U6HA 4WWKC 1CLVA 4YR6A 1GRWA 2XWJA 2ZX9A 1R5VA 1HAWA 4ZMXA 3S35L 4WI9A 1LM1A 1ETB1 4UTCA 3LHAA 3VFPB 4OD1H 5KW9H 1QW9A 4D0DA 5DSCB 2G60L 4Y2DD 5FK9A 4NO0A 1TQVA 1DFXA 4HMEA 4NC0B 4EZLA 3CMOH 4FQXC 4MMZA 5J57B 4JFDE 4JQIA 3IFNL 2P44B 4JREB 2PW1B 3LNHA 2NW3B 2DKSA 1BD2A 1MUJB 4LLDB 5I1AA 3ARQA 3M8OL 2H6PA 2XFXB 1K4DB 3UERA 4PUBL 5DRWA 3CZEA 2APSA 5EO1A 1JXJA 2AC0A 2YPKB 3MBEC 1GC1L 3DX6B 3HG1B 4KKAC 5F6HI 3FSAA 1D6VL 4LSSL 5AW8B 3MX0B 1KYOJ 1WUZA 3PL6C 3M07A 3QNYA 2CU9A 4DT2A 4K7FB 2Q7AA 1YO4A 1KCRL 5HBBA 3HZVB 4MQSB 1ITBB 1S7VA 2R51A 1IU1A 4JM2B 4XX5A 1H8LA 2XVLA 1H3UA 3OR6A 3RA7H 3RY6C 1CICA 4R97C 4WKZA 4M6MH 4U6VH 1EQWA 2XT4A 3KGRA 3BHBA 3HJ0A 2BJMH 3EOTH 1IC5L 2R83A 3JBG7 3R1GL 4OLYH 4U4IA 3ROOA 3X11B 4BK5A 5I6XC 4PQXA 4HK3N 2TRHA 4I8DA 1G5GA 1G9NC 2XYCA 3B7SA 2HJLA 1NSNH 1MFUA 3VXNB 4OV5B 2B1OA 1J48A 1RMFL 4LSDA 1XMWA 2K6WA 3GRWA 4N26A 1MFNA 3O2VL 3SBWA 3D9AL 5L88L 4TQEH 4JG1H 3PU7A 3CX2A 2ZIDA 1UADC 1E9PA 4YEJA 2XA8H 5FF6B 3ZPDA 4JLRB 5H94A 3LEVH 3P3SA 2CO4A 2UYLA 5I71B 2HUHA 3H55A 2PWHA 1ZV2A 3AG4B 1IM9A 2ADFL 4PJGB 1L1IA 5DLMH 3ETBF 4HIIB 4GUPB 3NJLA 3WKPA 2VDOH 3MOQA 4DGIL 1F11A 2XWXA 2OMWA 4LB8A 1WT5A 5D9SB 5I82A 2GC7C 3NOIA 1OE2A 1QSED 2D31A 1LNUB 1PLGH 3UTPD 3T8XA 3Q01A 1S9KC 3HNSH 1TUPA 1ZHBB 3QVAA 4ANUA 1QUPA 5IB1B 3BFWA 3SJVA 1G7QB 4LEEA 1H9DA 1L9PA 3O3EA 1ZIAA 1JPSL 2H8PB 3WFDL 4GSRA 3US1A 1WS7A 4G3YL 5HD8D 3NCXA 4JPVL 2WZ0A 5TH2A 5C09E 4KVCL 4X42A 4HIQA 1CBJA 4Q6KA 4WJ5A 2K8MA 1J8HA 3V5KB 3FK3A 2G0YA 2JTDA 4TNWK 3AT8A 4XNBA 1FG2A 1JZ4A 4Z03A 4NRYA 3K6OA 4YS4A 3ZYZA 4IDLA 2MNUA 1W0VB 5D7JD 2WLLB 1YYLL 3GM0A 3PWPB 4P06A 2NNAB 3PXJA 3LQZA 4OGZA 5CEYB 4HISA 4YSEA 2CO7A 1DVFD 3OXRB 2OI9B 4WI4A 1T7XA 5F96H 4JW3A 1TYWA 3QUYD 3C60D 4AW7A 1BQRA 1VDGA 1FVDA 1ZTXE 3O8XA 3PF2A 5E94B 3V6OC 3W9EA 2IGFH 3L17A 1ZT7A 4K3DH 5TK2A 3SYPA 3PV6B 4RBPK 2RFXA 4TVPD 4Y2OB 1QA9B 4ZQKB 2D73A 1S5HB 1OCRB 1IZKA 2RALA 4MA7H 5ID0A 4M4RA 2E8ZA 1PLBA 3V6OE 4JFFD 4UQEA 5GGSB 2YSSB 3AU1B 3O41B 4LVNC 3OR7A 4EVNB 5H8DA 3GKWL 5KVGH 5HDRA 1JRGA 5ESQB 4URTB 3RZCD 3B2DC 4LLUA 4MCYA 4Z7VF 3P73B 3UX9B 4OCWL 4XPFL 4GRWB 2O5ZL 2DWEB 1HEHC 5AVVB 4TLSA 2ZPKL 1QBLH 4KNUA 5ANMB 1U8LA 5HHNB 4C56A 2BXYA 3EO9H 3RWGB 1YEJH 3QJFB 4PTUA 2VJIA 4QYOB 4BXVA 3QO1A 2GBAA 2CDEB 4X6DB 4NC2B 4PJDB 3AY4C 1CE6A 2CO6A 3F3HA 2C8NA 1FZKA 2ITDB 5B1CA 4AEFA 1Q9KA 3C08H 3K4DA 4K0OA 1O9ZA 4KQ4H 4LKXB 5J6SA 3T0VA 3W39A 1NC2D 2CHWA 5JR1H 3KLHD 3KH3A 5EOCL 3GBNH 4JPKH 2ZTBA 3QZMA 3MU3A 3SHSA 2JJUA 3DX9A 4OJ6A 4APQD 1TTCA 5JQHC 4A7UA 5J5EA 4HZLA 3DYOA 1KLUB 2GBUA 3PDOA 4U49A 5DEJA 5ERWB 3N2JA 4JPWL 1A3QA 5K1VA 1U30A 4XN2A 3ZT7A 4ZW7A 2ICWI 1CC3A 3MHZA 3NCJL 1YN6A 3GMNA 3NH7H 2X7LB 3CFEB 3MRBA 4XT1C 3G3LA 1EJOL 1PD6A 4YFLF 3R4RA 1F2QA 1CD0A 3MXWL 1HWGB 2DD8H 4K3GA 3V7MA 1UJTA 5FO7A 4PN6A 2LGNA 2BCMA 1YJDC 3GYRA 3QUGA 3OKMB 2N7BA 2CNZA 4JN1L 1S4IA 4FMKA 4Y1AA 1CXKA 1RJCA 3UGXA 5GS0D 2V5IA 5DJDA 5I1HL 3K6NA 5IWLC 3E6FA 4GKSA 4F7TA 3BESR 4N6QA 2P5WE 1KXTB 3CMGA 5FECA 1KTDA 2DTSA 4HJJH 1YNKL 4HUMB 3EOAB 1VGKB 4TPRL 1EMTL 2EILB 3NBNA 1U8NB 2J8UF 3P4MB 2YR3A 2AITA 2F1BA 2R23B 2X28A 4U1JA 4G42B 2FX8H 3T4YA 3CHSA 1CDCA 1FFTB 4DGYH 3D3VE 3T77B 3PWVB 5EN2B 3IWUA 4GAJL 5K39B 3WL9A 4LBEB 2EDEA 1NGZA 3O6LL 4XXDA 1YPZE 3ARVA 4CADA 1OLLA 2OMTA 4OGAD 2YK1H 1FQ9C 2UZYA 4G6AC 1PJWA 3C5ZC 3FU7B 3QJTB 1AE6L 5F70A 3RDTD 4MLIA 2XIBA 3GSXA 2NT0A 2J12B 3NSFA 3VI4A 5D7IA 4P2RB 4FABL 1KPRA 3GDBA 3BN9C 4WSKA 3IFPB 1QLEB 3MRJA 1OSZA 1CGTA 2P8LB 1T1XB 4RGOH 3EXJA 5MP6L 3RL2B 3U4BH 2XG4A 1HL8A 5JNYA 3ARGA 3QWQB 3P77B 1FL6B 1ZVNA 4E2OA 2DKUA 5ILTL 3VXRB 3OKEB 1BG1A 3QJQB 4E9WA 4Q9RH 4J6RL 4OI8A 1KACB 2CQVA 2OK0L 2OMUA 3K2UL 2RCSL 3AQXA 4MMXB 5AWNH 5IBUG 3ZE2E 2CHNA 2HKFL 4XBMA 5EULV 4ZXBD 2AQTA 3BAIA 3MFGB 3QHFL 4UUJA 3MLWH 1YEKH 3V0JA 3W5NA 4PHZA 2HTLC 3U30C 4W93A 5HYJA 1MAJA 1A8ZA 1LL1A 5EU5B 1JPGB 1SF5A 3E6HA 4WU7A 4GMTL 5E1AB 3ESNA 2D7QA 3CN2A 4ZUTB 3U7YH 1Q94A 4KZDL 4F33A 3MFFA 1OAYH 1QLEL 3G6DH 2HFGL 4WI8A 4UM8A 2H0PA 1A7NL 4HKZB 1G87A 1P4IH 4ZAKC 2JIXA 2DYPD 2QR0A 2WWKO 1NKGA 4L9LC 3Q8AA 3SDCB 5JHAA 3B2VL 2GHWB 4HIHB 4LSRH 4WWKB 4Y1TA 4LGPB 1JF6A 4GOSA 1OVZA 2ARJA 4JFDB 1PQZB 4OB5L 1R24B 5ENWB 4ZUSA 3VQ1C 1U6AH 5DYOA 3ZQ9A 1NGWB 3L2NA 2VDPH 2XG5A 1BYOA 4ZFFA 4FQXB 4GP8B 4OZIF 4FA7B 2HRPH 3FW6A 4GJTB 3M1CA 1F0LA 4AGNA 1TTFA 3HFMH 1TFPA 3OJ2C 4WK4B 2W80C 3MLUL 1W6LA 2BSTA 2YHGA 3MRDB 1F4YL 4W9ZA 5D71L 5EU6E 5CR1A 5MENB 1E3XA 1GAFL 4YDNA 3V0EA 1AIFA 4KKZA 2ZKXA 3TT3H 3MBEB 4N90E 5GGTH 1K5WA 3EYUL 3VXUE 1IKNA 3CU7A 3DX3A 4G43A 2QLYA 3WNPA 4PJFA 3PL6B 4X83A 2DOCA 4X9FA 5IVXF 5DHYB 5TE4L 4PLJD 3FO0H 1HOEA 4XNYH 1KC5H 4NKQB 1JGEA 3WXWH 4UIKH 1CE1L 3S36H 1Q9OB 5EUKB 1S9YB 1QPKA 2ZUWA 3ISRA 5H35B 5EEWA 5JXED 3D06A 4XR6A 2A38A 4R97B 3IE9A 3OF6D 3RVTD 1FAIL 1I1RA 3I9IA 3NSYA 3U1PA 4JL1A 4QHUA 2FNWA 5I6XB 4TUJB 1RHFA 2DJUA 4NKDB 5GSVB 3WIFB 4U0RC 4BH7B 3QJHB 3NEEA 3S98A 3FRPA 2Y5TB 3L54A 3UPRB 1BF5A 2AF2A 1C08A 4LQ1A 3VB9A 3MRLA 4YAQB 3VG0H 2DY2A 5B39B 2M2DA 5EFIB 1JJUA 1ILUA 1VFAA 3CQPA 3FB5B 1UCBL 5KWYC 5KBDA 4HSQA 1CN4A 2RIKA 5KUKA 4K23L 3AREA 1JDCA 4QNPF 4F7EB 2V6HA 4KROD 2FHCA 1H6TA 4LSTH 1L7TH 2V2TB 5D1QA 3GSWB 1I53A 4YFEA 5C0BD 3CFKA 4QTFA 3SOTA 1GGUA 4OT1H 4NYLB 4P2YA 4Y4HD 5DD3L 2DLFH 5DJCA 1RSFA 2ICWA 2JJTC 3FZUC 2M8XA 3SGJA 5IIEA 4R7NB 3AMLA 1QUNA 3FTSA 4YVNA 3ZR5A 3A21A 3O3AB 3PJSA 3KPTA 5ABAA 1G9NL 3LRSB 4UV7H 3J7HA 3TBYB 1IGIL 4P46C 2DS4A 2C5DC 2R8SL 1DQJA 5BXFA 1HI6B 2Y3NA 4XMWA 4XP1L 2COQA 2Q5BA 4RMTA 4AM0A 4YHPB 3C9NA 4NJ9L 2EH8L 4UWQB 2XWRA 4DO4A 3OKLB 4P5SA 3QJVB 4FFZH 1I9RL 5BZDB 2VW6A 1QHQA 2YD6A 4AYID 3SKMA 3I50H 1W2KT 4YHML 3HI5H 3CSYA 4I0CC 5LCVL 4PS4L 2V0AA 5ECJE 3VTTA 2IPKB 4NO5B 2SEBB 1MAMH 2R29L 4WGVB 4M7JH 5IEHA 3IWVA 4PJBA 4XKWA 1DLFL 4PVNA 2EIEA 4CSTA 4IK6A 1SJEB 2K3TA 5E8EA 3O9WD 3UOAB 2CGRL 1THAA 2VSKB 1UOVA 2G4EA 3UPAA 4FTDA 5CIPA 5CSGA 4LVNB 4DSYA 5HYSA 1QRNA 4FXGA 5BVPH 1DQQB 4K8RH 3KVPA 3UAEA 4IOFC 4EDXB 4F5CE 3FB6B 3V0HA 4HIXH 1KELH 4CMMB 4H5SB 4KZ0A 3LSOA 5C6TL 1DUZA 1CK0H 2G9HA 3ARPA 3DTXA 1SUJA 1U42A 3QZWB 1MUJA 4OI9A 1GW0A 4GPVA 4PD4K 1SF3A 1JUFA 1ZTXL 2GJ6E 5I1DA 2XFXA 4KV5F 4JPQA 5D7IF 3OG4B 1JD9A 1OGSA 4LSPL 4F91B 4FFYL 1A7RL 4TUOB 4I1PA 4HHGA 2FO4A 4GRMB 2EZ0C 1QFWM 3CV5A 5JO5B 5DFAA 4ADGA 2FT8A 5F3FA 2ESVA 3HZVA 4R4FL 5BO0D 4HWVA 2Q8AL 2WN2A 3B2XA 3S35H 1XXFC 5E6IC 2VC2L 3PNRB 2LFEA 4O02A 1B2YA 5DF0A 2G60H 2IANE 3TFKC 3SBQA 2Y25A 4WO4D 3Q8BA 2AXGB 5IOKA 1J9TA 1M05B 2QVMA 1ASPA 3V2AR 5IGXL 2FVNA 3L3HA 4JJ5A 1IM3D 2E9JA 1ZT1B 3BYTA 1P4LA 4PRID 1HF2A 3DK2A 4TSCL 5KBNC 4XI5C 4NGHL 4DPRA 3OKDA 5DO2C 5D6DC 2BWDA 4HH8A 5AG9A 3IMUA 2EIDA 4PUBH 3MBWB 5IESH 1F1GA 3KL3A 4S1RL 2IXQA 4NIKB 3BAWA 1JF5A 1GC1H 3KLLA 3BZEB 2H2SC 4OQ1A 1D6VH 4LSSH 2WXNA 3HAEH 4AUJA 2K70A 2P5WB 3ZK0A 2KZBA 3H4FA 2YS4A 4IU3B 4TUUA 1I3UA 1DYZA 4JUTA 4JKMA 3X14A 3QULB 2AMGA 1KCRH 3WMQA 3IRCA 4PWJA 1V7NL 5F1IA 2BNRE 1FVEA 4JZNA 5IB5A 1VACA 2PR4L 2I32A 3MRIA 5EPMA 1OFLA 2J5WA 3GRHA 3PXHA 4MXNA 4GYBA 1YDPB 1NIDA 3SE3C 4WWOA 3CXDL 1Z6JT 2C1PA 5HI4D 4W8TA 3RVWC 4HCGA 3MV8E 3R1GH 4EIBA 4ZD3H 1RZGA 4YHYC 2W7ZA 1MCWM 1YPZB 3MRMB 1G5AA 3Q13A 4XLHA 2J1XA 1RMFH 4EN3C 1UWXH 3E1F1 1A2YB 3O2VH 2VOTA 3D9AH 4NUPA 5L88H 2R69L 4HEPA 3E7JA 2CWRA 3W5MA 3VDCA 1WS8A 4YUEL 1A6TA 3GF8A 4G7YL 5DTFA 5C0CD 5DA4A 5DO8A 1IVTA 1AZNA 3TN0D 5K9OB 5TDNB 3C5ZB 1DBBL 5CP7A 2WWMC 2AABH 2ADFH 2YJQA 5IQMA 1THCA 2ZX8A 4LIQE 3VFOA 1NMCC 5LJYH 2F61A 2DIBA 4F7PA 4DGIH 1TZGH 2WSPA 4PV9A 3V8OA 3MOAL 2J88L 1QWUA 2RACA 5ISZE 4I48A 3QXAA 1KJ2B 3ZE2B 4F8NA 4L4JA 3WFDH 1JPSH 4NB7A 3E9UA 1AANA 2WQVA 1G1OA 2QQQA 4G3YH 3ZE0E 3EUDA 2PO6D 1X4XA 4KMLB 4JPVH 1D5IL 5KSBE 4KVCH 4OIFA 4LOUC 1QP1A 3L5XL 2GYSA 4A7GA 1XBDA 1A64A 1A3RL 3WKYA 2JNZA 3MKGA 3L81A 3U30B 2AXJA 2QZAA 5I8EB 4E9RA 2X88A 1I85A 3BUYA 2DYRB 1YYLH 3I75B 3CFBB 2JELL 3TFBA 4Y2DC 4K9EL 2EDWA 4CRPA 3IM1A 2XZZA 1L9NA 3O6ML 3RIFF 5HDQL 2ZQKA 1NZRA 5BW7A 1XGUB 3MCYA 4ZAKB 5SX4I 5I6OA 3GNML 3N85L 4L9LB 2GJRA 4QTHA 2ADIB 3ZTCC 4HH9B 2WYZA 3GLAA 2BFVL 4KHTL 2CKBB 4FLRA 5I6PA 3FS9A 1P7QB 6TAAA 4X98B 4QY8B 1DUYA 5C86A 5T5FA 4ZFOB 2DTML 4G7RB 2ZSVA 5LNDA 3HBGA 3IDJB 1HHIB 2F18A 2J3SA 4RX4A 5C0GB 5IM7A 3KPRD 4M5TA 4M43L 4OCWH 4XPFH 3VXMD 3DDGA 2O5ZH 2BM5A 1RUAH 3RBSA 2ZPKH 4M93C 3KGSA 4JL2A 1SY6L 2EDLA 3TPUA 2XIIA 1U3NA 3QUHA 3UTSA 1BREA 2GTZA 4JG9A 4NQSA 3D50A 1NLBL 2FYYA 4HGKC 3QRBA 5FYJD 4Z3GA 4KK5D 2ILLA 2WNKA 1QCXA 2N56A 3B5TA 1PZDA 4BQBA 1QBML 3EIFA 4IW4C 3CSBA 1WC7A 3F2LA 5IUSA 3LZLA 1SN2A 2F8VA 4ZOCA 4PJBF 4I2XE 3F7KA 4G5AA 3L3JA 2J72A 1A02N 3KWTA 1EBAA 5EOCH 2WAHA 2P8PA 3O4LA 4AENB 4F9LC 1BF8A 4MA8L 1JAEA 2MCG1 1LLWA 1S7QB 2A6DB 1ZGLM 3EQNA 2GCYA 5E4AA 1ND0B 1F86A 2CUMA 4JPWH 1W16A 4WFGD 2UUDK 2EC9T 3EJYC 3FOMA 4PRDA 3NCJH 2BIIA 4U0RB 1RJZA 3S4SG 1PD1A 3IKCB 1EJOH 3GZKA 4KXDA 2A7BA 3OX8A 3BEVA 3ULSB 4IBSA 4XNMB 3FU7A 1FZOB 3BMVA 1WWWX 5AUMB 1QSEE 4XQFA 1YMMD 2VQ1B 4JN1H 5EIIA 3LH9A 5HHME 3ZHFA 3EJRA 1EHXA 1U91A 5BVJA 3S34L 4GUOA 2VR5A 3UTPE 5HD8C 5EB9A 2DWDB 5LO7A 4OZFA 3UTQA 3BKYH 4RIRB 3T6VA 1WP6A 5GS1B 4JM2F 1YNKH 4BRJA 4TPRH 2X4SB 1FZMA 4ONGL 4ZMTA 4JKPL 4U1HB 1XB8A 3ECBA 2R15A 4XCNA 4Z7WE 3OKEA 3RY4A 5D7JC 4F8OA 4PRPD 4N2EA 1S7UA 4B97A 2BC4B 4P46B 4HDIB 4YGAB 1DVFC 4PBVC 3DMMA 4GAJH 4QYAA 4QF1B 4ZX4A 2MKLC 3C60C 3QUYC 4FHBD 4JVPA 4EUPG 3RIAF 3GHEL 5J3HC 1U0QA 3K2IA 3T71A 3KH4A 2X40A 2DM3A 1LE9B 3MGOB 1AE6H 5DVKA 4PIBA 3GSNB 4ZFQA 3MSPA 3LN9A 2ZOWA 2CUHA 4EZMA 4FGMA 4PJGF 3SDDA 2APWA 2AKRB 4X8JB 1CDGA 5GRJL 3S9DB 2GK2A 4N9GA 4TVPE 4J3OH 2VRKA 1ZLWK 3F7LA 2Z92B 1LO3L 3RZCC 3KYNB 4G8GA 3G6AA 5MP6H 3QXDB 1BYPA 3ZYJA 1JF1B 1M6OA 3DRQA 4JFFE 5HYQA 3BDYL 2NLJA 1O75A 5EO0A 4HIHA 5ILTH 1CDJA 1KIRA 4NZFA 4B5EA 4Z7IA 5DVLA 3BH8B 3PPEA 2XJKA 4J6RH 3TYGL 4UMSA 3C8DA 2OK0H 3K2UH 2RCSH 2HXAA 2IGLA 2L4OA 4JFTA 4X9YA 3D87B 4U0QB 2HKFH 1M7IB 2GJ6B 3QHFH 1F8TL 2K7PA 2UZXA 2Y0SA 1DBJL 3NFSL 1P7KB 1C12A 3X3GL 1D7FA 3KLHC 1IMHC 4B9IA 3BISA 4GW1A 3IU3B 1U8HA 1RZ7L 4HOXA 1FYTB 4GMTH 4KZDH 1A4JB 1A4BA 1WFNA 4GW5A 3E8UL 1QLEH 4XN4A 1KJMB 2HFGH 2WLYA 3MGTA 3UPCA 4APQC 3ETSA 1TYUA 3HPJB 3JYBA 4G8EA 5F9JA 4KO6A 1FL3A 4AWJC 3UZQB 2AEQL 3NJGA 3QFJD 2B59B 5I5IA 2IANB 5I66B 3PAUA 2NT9A 3L48A 5JORB 3D48R 1PLUA 1CJYA 5E6IB 1IAKB 4OB5H 4U1LB 3NCYS 4XC3L 5DYFA 5I73C 1OL0A 2HFEB 4EJ1C 1T80A 1A7PL 1LE5A 4K3JL 3JURA 1ADQL 1SOQA 4AZ8B 4MVBD 2XVKA 3IDGA 4HC1L 1FE8L 1NDTA 5F0JB 5GS0C 1C1EL 3BIKB 5GSVA 1TVHA 1Q0EA 4BGDA 1MLCA 4N2OA 2B9BA 4L29B 3ZSTA 4XE0A 3GT6A 3HG2A 3MLUH 1IDJA 1F4YH 5D71H 1GAFH 2ZF9A 5EZIL 3ZW3A 5KANI 2NT6A 3HLAB 4X6DF 3EYUH 3APDA 2BNRB 3QH3B 3ES6B 4PJDF 3BUIA 3IMVA 2OX5B 1GGCL 1DQTA 3W57A 5DMKA 2QELA 5TE4H 2AJZA 5EG6C 1MQKL 1AC0A 1EANA 3T3ME 4CVZB 1IC4L 1O8IA 1OP4A 3C5JA 3MV8B 2ZUVA 1CE1H 1CTMA 4RMQA 1D7DA 3FTVA 4LKCA 3TH2T 3W81A 4L4VA 3DO7A 4OGAC 3FH5A 2ZONA 1FAIH 2H32B 4PJ9A 3HNVL 1OB1B 1SGKA 3RDTC 3RWCA 1ZIBA 4IKLA 4KKBD 4K3HA 4YHYB 4J8QA 8FABB 4Y1SA 1UT2A 1U95A 5FCUH 3MCKB 2EYRA 4QCIB 4ZW8A 4Z6AT 4EN3B 4HF5L 1G7JB 3MACL 5GSRB 2XWBA 2EDRA 3KWWB 5BQ7B 2VJ0A 5EBLB 3MAWA 4JDTL 5HHXL 3E9TA 3V10A 2AK4D 1M7XA 1ZJAA 5T33L 3SPGA 1NLDH 3KDMB 4WSGA 5IFJA 5DHVH 4WEUD 2D7TL 4PS3A 1ZXKA 5E6ZA 1FP5A 2GIMA 1KWKA 5AAPA 3OKLA 2CUIA 3BUQA 4K23H 4PS8A 1NMCB 2KZWA 1Y6NR 4N2BA 3B2MA 2W07B 1BP3B 1GGIL 4O2CB 2UZIL 2V8LA 4V2BA 4ZXBC 2BW4A 1IJNA 1NIFA 1E9OB 1M2VB 2I9LA 3ZKND 1ASOA 4YX2H 5KS9A 3T3PE 2FIKA 3ZE0B 2WLIB 2IF7A 1M71A 5KSBB 1FNHA 2BIPA 3RVXD 3QDJA 3U79A 1HC1A 4YGVB 4OCYL 2XPZA 3MRRB 3BC9A 2R8SH 3QE5A 3ZDZF 3OKOA 4I18C 2LVCA 3FB8B 4L8DB 2J2ZA 2EIZB 3H8NA 4LIQL 4XP1H 1K5CA 1MFMA 3IN0A 4BZ2L 1TZ8A 5K1JA 3STLA 1KJVA 5D4IA 4A55A 4NJ9H 3QDMD 3U0WL 4PVLA 2WWNA 1M1XB 1YEWA 3CX5K 1NDMB 2HFTA 3C8KA 2DH3A 4W6YB 4ZOBA 2O4EA 3FTYA 1QRKA 3FCUB 1EDQA 5LCVH 4Y2DB 4PS4H 4Y19A 1WE5A 4PVBA 1XGQB 4GXUN 1A3ZA 4MB3A 4O51A 2R29H 1CYWA 3ALWA 1MW0A 4YLCA 2OSWA 4AQ1C 1XVSA 1F45A 1DLFH 1C7SA 3VRLF 3NCWA 3B8SA 1VFUA 3JTSA 4AQOA 2CGRH 2MIZA 3VXOA 5DS2A 5DRNB 3S97C 4C58B 3CFJA 2XWCA 4E36A 1CZ8L 2X0UA 2ZP9A 2A73A 3K2KA 3MI6A 4KWUA 4N20A 4JFUA 2BHZA 4PJIE 3UAAA 4PLJC 4XNXL 5C6TH 4RMRA 3C6SA 3BAEL 3AACA 4M93B 4M6OL 1YMHB 2YUVA 3KXFD 4LE8A 3FUNA 3WFCL 4UNVA 2HPOA 2BSEA 5J0BA 4WKXA 4KKQA 4X9GA 5JXEC 5C07D 2X3BA 2FSEB 4JFXA 4I2XB 3RVTC 1S9WA 2R2EB 4FFYH 1A7RH 3HLKA 5CBAB 1ORQA 3I2CL 3UG5A 3TJHD 4UT9L 4MB1A 3ULVL 4QRUB 2JCCA 4NQEA 1TR7A 3N41B 5G5DA 5AW0B 2EYTB 1F13A 2Q0ZX 1BFTA 4R4FH 2QKIA 3MRHB 4HHWA 4R5TA 2Q8AH 1A9EB 2DJ4A 1PY0A 2VC2H 5EZJA 2X2UA 5GRZA 5AZUA 4ODTL 1DBKL 2VQTA 1OP5K 4G8AC 1ONQB 3GSUB 4IBUA 3EOBB 3LKSB 2EEAA 4ACPA 3TURA 5IGXH 1K5NA 5F9WC 2OULB 1CVRA 3D69A 5F7FA 3D51A 2IMMA 5IF0A 2D7MA 2FJGA 1W8EA 2ZWLT 2ITEA 4L4TD 5F7DB 1S78D 2BNUA 4KPHL 4XVJL 4KROC 4NGHH 1BJ1H 1KB5B 4YDMA 1T2JA 4PBXA 1VZGA 4CJ0A 1QSEB 3IJ8A 4CC4C 1MCJA 2OZ4L 4Y4HC 1JS4A 4J3VA 1HZKA 4PWFA 2ZWNA 4HUWB 4Z7UB 5T1LD 2Z8SA 4IBQA 4D8PB 2HVJA 5AAMC 5C0BE 2PTTB 3Q9QA 4HG4J 3TIDA 2NSTA 5BZWA 4MHHG 1V7NH 3NJFA 5L8JB 2JLPA 1TO4A 4QRTB 1I9IH 1HH6B 1FFNB 1SM3L 1ET5A 1J9QA 2INUA 1G4MA 2FZ3B 2DLTA 3HC0B 3CXDH 2AQ2A 1WICA 3BVUA 4G7VL 2WGNB 2CCLA 5FX3A 4IRSD 3DUUA 5D7JB 2J6WA 5ETUB 4ICXA 1NCIA 3RWEB 2VO5A 3ZZSA 2Y1AA 4MQTB 4UTBA 1DVFB 1UTDA 4DCQA 2Y1VA 2R69H 1R3HB 3GLDA 3MV7A 3C60B 2MHAA 2X4OB 3QUYB 3ULUE 1N5YL 4DEUA 4YUEH 4G7YH 3UABA 2R1WA 1GGBH 2EXYC 3FQRA 4TTGA 2XQBL 1UB6A 1DBBH 3RIFK 5HGAA 3O9WC 3I75A 1XSJA 3HR5A 4JFFB 3QFDA 5JHLL 4L8BB 2WKGA 2DLGA 1CD1B 5DUBA 2PCYA 5DJAB 1XGPB 4G8IB 2VISB 1YQ2A 3RZCB 4BINA 4HMDA 3MOAH 1XGUA 4AKQA 2CNYA 2J88H 4W9LC 4D8OA 5L8LB 4PG2C 4X99B 4NP4L 2IPTL 1I3RA 1IGJA 3EF7A 4GH7B 4PU2A 1R5IA 5DMIL 5F88A 1JL8A 3TCTA 4PGBB 4JO2L 3DX4A 5FKPB 1D5IH 2HKHH 4MNHB 3L5XH 3RWFB 4HKBB 5BJTB 4Y4FA 4K15A 1NCGA 2O1AA 1FFOB 4HUVA 1NC2B 4N8PA 4Z7OF 2OJEA 2FO8A 2NYZA 1K8FA 4M29A 3MYZA 3D0LB 4PCYA 2JELH 4UILL 1J1XL 4K9EH 3VRIB 4WO4C 4HIJA 4OD3L 3RFZC 1O7VA 4APQB 5EV7A 1KPUA 3O6MH 1L5GA 5HDQH 1JPFB 2KLTA 3KRGA 1BIIA 4WZ9A 3VXPA 1BEXA 2VDNL 5D1XD 2FL5A 1O7DE 3GNMH 1O9WA 3N85H 4FZEL 2XVGA 1JV2A 5KS9F 2PW2A 4AVJA 3GJFH 3KVDD 2BFVH 3PGDA 2VRQA 3GIVA 4NQDD 1G7IA 3K1DA 1JWSB 5L9DH 5FKAA 4UOW1 3L45A 3MMEB 3VX1A 5ECGA 5I73B 3IN2A 4L23A 4CC0A 3JT0A 1MRFL 4ORZC 4A6YB 3HHSB 3BWZA 4DKDC 1JGUL 2MCAA 1K8DB 2NY7L 1CFSB 4M43H 4AV0A 2O5XL 1QSFD 1GZHC 2QQNL 5A7BA 3LNFA 1SY6H 1XCWA 1J10A 3MYJB 1W91A 2QGDA 2FUQA 4PP2B 2BNQD 4HK3J 1NLBH 3T3MB 4L3CA 2DIJA 1H5BA 5HI4C 1ZPUA 4NQXA 1UQSB 1V54B 4IOSA 1DSWA 1KG0B 3P2TA 3T2OA 4A2LA 1QBMH 2WINA 2O26U 2Z93B 32C2B 2WXFA 2KERA 2VJ8A 3EGDB 3ZDXE 3ZKQD 4KKCD 2Y7NA 1NC4D 3MLRL 5F8QC 4UINL 3F84A 4M61A 4PREB 5CJQH 3HZYB 2B8OT 3KLKA 3RDJA 3SQRA 3H3BC 2A2QT 4MA8H 3CVDA 4I4WA 4LVHC 4QXTB 1QEWB 5GS1A 4JFED 5TGBA 3D0AA 4JRYD 3TA3A 1E3FA 2WJ7A 3TN0C 4JO4L 1ID2A 4WUUA 2FLMA 3RDTB 4LEXL 4KH3A 4PJHE 4B60A 3V6ZA 1XB6A 5EORL 2WAQA 4HDIA 5I0YA 4OIIL 4PWKA 4IIQC 1GMEA 3X13A 1I7ZA 2CLZA 5E99L 1TVBA 2GJZA 4BIKA 1W0YT 4GW4A 4IHOB 5AVWB 4AQAB 1MW3A 2ZOUA 1VADB 3CSGA 4KTDL 3OMIB 2AKRA 3L3KA 3S34H 2JCCF 3OJDA 3EGXB 2ARJQ 2PO6C 1ETZA 5D5MA 1IE4A 1ZVSB 2HRLA 4ZXBB 4P57B 5FGBC 3P02A 3KYNA 5C3LD 1SUHA 1G6RL 2FRGP 1U8KB 4LVOC 2OKMA 3FULA 5E9AA 3WTWA 3TEYA 4JKPH 5AZ2H 3HS0A 4S10A 4OLUL 1D5BB 2IAMA 4ELME 1E8YA 1YPZF 2X4NA 1JZ3A 4GBXD 4G80B 2BVPB 1IRAY 3RX7A 2YN5A 2CE6A 3DXAE 4CU8A 1HE7A 4JCMA 4CNIB 4W6WB 4WJKB 4I18B 2AEPL 3GHEH 5HYEA 4UQ3B 1MXDA 1XF5B 3ZYOA 3ILPB 3GDCA 1JNHA 3KD4A 2VLKA 2E7BA 3AM8C 1I7TA 4H0LC 4D9QD 3MUGB 1ZE3H 3VM7A 1O8EA 4ZSOA 3FQNB 5I5JA 3FFCD 5GRJH 3LIZL 1WBYA 2H6UA 5E6UB 4X5PA 1LO3H 4BYHA 2EWEA 3P2BA 1UURA 1P5UA 3D8MA 4W8RA 1JZ5A 1DCLA 2Y2YA 4AQ1B 2OJ1A 3BDYH 1XV8A 1OALA 1AHKA 4N2KA 5JW3H 4L48A 3ZE2F 1JTAA 1BWMA 5LXVA 2BOBA 4AV4A 4U1LA 5LAXA 3VXME 4E41A 2HRHA 1S7RB 2CLRA 4KK5C 2XN2A 2AQPA 5G4OA 2NUTA 2HT3D 1DEEA 4F9PC 1FNLA 2Q3AA 1F8TH 5IV2B 1DBJH 1LO4L 3A6OA 4LMQE 4JDVA 5FYJE 2DEYX 1QJVA 5BS0E 2IAAC 4HHAA 2RAMA 3RBGA 2AVGA 3O2DL 1RZ7H 4JRLA 3PPSA 3NZUA 5JHDA 3L5JA 3FH7A 2XFGB 6PAZA 3E8UH 1J88A 1TNNA 3CHXA 1MXGA 5T1MB 5B1KA 2FT6A 1D7CA 2IBZY 5T3ZL 2JI2A 2MJWA 4IS6B 3WI9A 2AEQH 2W8CA 1R46A 3N0AA 1PVHA 1QTYT 4N8VB 1BJ1J 3K0YA 4KKNA 4UB0H 2BSBA 3EFFB 4Q56A 1F42A 4YIQB 5T1JA 5B38A 5CD3B 1J5IA 4APXB 2F15A 1RV6X 4RDBA 3D05A 3QJOA 4XC3H 3G6JE 4WEEA 1A7PH 4K3JH 1PZAA 3VGFA 5C1CA 2Q7YB 4AM0Q 4BFJA 4HC1H 3DSNA 4EXPX 5F9WB 4ECNA 1FE8H 4N68A 1AAJA 5D6CA 4MXQD 2OA9A 4AV5A 2VGLM 5EHFA 3S8WA 1FC2D 4KROB 5KVDL 4XNDA 3PAYA 3OAZH 4KTYA 4AVZA 1CD9B 5C0BB 5I6MA 4NK8A 4Y4HB 1U3ZA 1K9TA 3KDMA 1WZ1L 1I1YB 2VZ3A 3V0IA 4BFIB 1GGCH 1E2VA 1FSKC 3WHE1 4XVTL 1RIHL 3UO1L 2EUWA 3BH7B 3OGOE 2RB8A 3FTZA 4HGWB 2QEJA 1IC4H 1HXMA 4GKOA 1WLHA 1GYAA 1UZ6F 1IFGA 2I24N 2BVQB 1EUTA 1P4BL 2MPAL 3RGVD 2YZ8A 3REWB 5ES4B 3WFEL 2IJ0C 4H8PA 2MRYA 2P49B 1KTJA 3A67L 3HNVH 1MWOA 3DETD 4GAYA 4YDKL 1F4HA 1ZVYA 4R3SB 1A8JH 5TJWK 3T65A 5IB2A 4H26A 4JQVC 5CSZB 5F3BB 1LXMA 4HF5H 2WXHA 3AUVA 4RFOL 4NC1C 5CN2A 4GO6B 1E2ZA 4JDTH 5HHXH 2PR9A 1DQDH 3N9GL 5A2FA 2E59A 4HSAC 5IVZA 4XBGB 5AW4B 5EU3B 2D7TH 2WP3T 1W8NA 2VERN 4Q6YA 3O9WB 4GT0A 1UENA 3CVHB 4Z9KB 5K33A 2WYIA 1PZ5B 2VDML 4DAGL 2DMGA 4W9EC 5FFOA 3WLWD 1KYUA 1AO7A 4ZUUB 1GGIH 3H9ZA 2UZIH 3VXTA 1Z9NA 3NJXA 2ODIA 2DM4A 3S3JA 5DJYA 3A6BL 3CDGA 1RZKC 4PLKC 3QEGL 5I17B 3ULUL 4OZHB 4LF3B 4BFBD 4UBDD 5DRNA 2XPYA 3VX0A 1JPST 4OCYH 5EDXA 2HX9A 1ZLUH 4MR0A 2YRLA 3NJNA 1NBZA 5FOJA 2VFNA 4EBQL 4X7CC 2QY1A 2DEWX 1CDUA 2A99A 4BZ2H 3MRCB 3OV6A 5C0RH 4JB9L 1OGPA 4FF9A 3OZ9L 2GG1A 4GQRA 3EJQA 1ED3B 5MHSD 2CO3A 3U0WH 3PREA 3IPBA 1U8QB 3L9BA 4WTXA 4U3CA 5F7MC 3QWRD 1LO5A 4JO3H 4Z06A 2YFNA 4WO4B 1FNGA 3RFZB 1G9HA 1T0NA 1EHNA 1PIGA 4Z7NE 4ADJA 1SLUA 3L95A 4UU9B 1SVBA 4MVBC 5CBAA 1T1WB 3A6CL 2WXIA 1IM3B 1E4KA 5EZOL 2I5YL 1UXMA 4OF0A 3NIGE 1OCOB 5FM4A 1B4TA 4XXWC 2BVOB 2E74C 4FHJA 2XTJD 3RL1A 2NZ1A 1CZ8H 4X6EA 3Q7JA 2PYED 1E50A 3CC5B 3FHQA 4W9JC 1JGLL 1AQDA 1JZDC 4N6RA 2BOCA 4EXKA 1VA9A 5C97A 1NFDE 2GT9B 4HIPA 1E7UA 1U8MB 5DD5L 2KPWA 4P5TD 4PHXA 4XNXH 1HHGA 2B14A 2W92A 3IETA 2W0FB 4WW1B 5JLZA 3F85A 3C09C 2MNJB 5IQ9A 5LGJA 2Z31A 1UD6A 1J5DA 3WFCH 2YEZA 4WIQA 5GGTA 3FQ1A 4E42B 3ZDXB 4U4BA 4NHCL 1T1ZA 2YJLA 3QIWA 1T6BX 4OF8A 2VIRB 1OQXA 4KX7A 4ORGB 4KXBA 3I2CH 43C9A 2YQGA 1WTLA 4UT9H 5ABDE 3ULVH 2YUHA 4P2QD 1FV1B 2HX7A 1O7SA 5JHMA 4J3WA 2K78A 4BFRA 3RNQB 3APFA 1DE4B 1JI1A 3BSZL 4QRTA 4L0ZA 4G59C 1ZLEA 1E8WA 3F8UB 4PJHB 3W0WA 4ODTH 4ZUWA 4ZBJA 4LVHB 2NSQA 5C0CB 1HQRB 5D70L 3S0PA 3HR6A 3RWHA 4MNQD 5GGRB 3TN0B 1FNFA 2N1KA 3ME0A 2QMJA 4DF9A 1XBRA 4NSKB 3H2PA 4XAWL 4F2FA 3X1GA 1FI8C 2WZPD 1RIVL 1TYEB 4HQQL 4KPHH 4MJID 3UTTD 2NY3D 2RR3A 4HS3A 3SDYH 3KPNB 1GS8A 1HHHB 4OIBA 3MODL 1B0RB 4Z7AA 2OZ4H 2QADD 3DKHA 4J28A 3IS1X 3S8GB 1N6VA 1FRGL 2X6WA 3RVUD 3CBJB 4XWGL 3D2UB 1UB5B 2D4DA 1SYSA 1O8LA 1LYQA 4PJEA 4ODVL 4H8WL 1J9SA 4XRCB 4EUPH 2PO6B 5E24E 3AXIA 1M1SA 2BVTA 3BKJH 1D7BA 1SM3H 5HHOE 2UXFA 1FH5L 1OTSD 1PZBA 2R1YB 4JFSA 4G7VH 4LVOB 4POUB 3VSQA 5I2IB 5FDWB 2QVFB 4FZ8L 5JZ7D 2APTA 2ZXBA 2P26A 1R34A 3X12A 1PIFA 3QDME 4ACTA 3DECA 4N2DA 3TO4D 4PW3A 3MNVA 4TQHA 1A7QL 1N5YH 4QOKA 2CHZA 5BJTA 3ASWA 2A83B 2XQBH 4FFZA 2XX0A 4BKLA 2ZYIA 3DBXA 4H4NA 1BQLH 3T0AA 1IFRA 2YZ1A 2OR7A 1OCCB 4MXVE 3PABB 1ET8A 2ZF8A 4RAUA 3VRIA 1JV5A 1WD8A 1WGVA 2OMXA 4NWTL 5TK4A 4FDWA 3T5WA 3TASA 4RFEA 2CH8A 2QPUA 1KY7A 3KL5A 2MCMA 3UAJA 4AW4A 5C2UB 4BQ9A 3KPRB 2EYSB 3FT4B 1XMEB 2HH0H 4NP4H 3VXMB 4PV8A 3M86A 1GVIA 2EC9U 2GK0B 3PP4L 3BDXA 3ZE0F 1KCKA 1TZHB 4UQAA 3PSZA 4JDEB 5DMIH 2X2YA 2HVKB 3NEXA 3L3OC 1R4XA 1X9LA 3KPOA 4ONHB 2CO1A 4JO2H 5KSVB 2BM6A 2R56L 3MA9L 2GC4C 1KLFA 3KXFE 3TJHC 1KN4L 3U2SB 4LVEA 4NXKA 1QA2A 5TF1L 4DGUA 1I8KA 3BO8A 5MEQB 1XTMA 5I75C 4HXAL 5CINL 4JANB 3F7RA 3II2A 3GMMA 5H2BA 4N0FA 4UILH 1J1XH 3WLBA 3WXVL 5TD4A 1QR4A 1Z3GH 1P9MA 2VR7A 2VDNH 3ABGA 2AEWA 2Z93A 1RL1A 3QARA 4MD5A 3QNXB 5LUMA 2VLMD 3G6JB 1T21B 3A0OA 4FZEH 4P3CL 1S78C 1ZLVK 4AG4L 4N28A 4OF7A 1XWVA 1ZA3A 2VE6B 2EIKB 4L3EA 1FZJB 1JZ2A 5DK0B 3F83A 2XI9A 1R3LB 5KBPA 5FYJL 5MEPA 1MCNA 2YD9A 2B1AL 4L4TE 5DS8B 4HV8B 3D6GA 1MCDA 1MRFH 4PJ5A 4P2OD 2FJHA 1B0GB 5SWSE 3GBEA 4XN8A 3KVQA 4X5LA 1JGUH 2KI6A 3GMRA 3MLVL 2NY7H 5IQNA 2O5XH 4UZSA 2IV8A 3IMWA 4ZPTB 1BZEA 3D18A 2QQNH 4XOEA 2A6JA 4QXGH 2DQMA 1UVQA 5AVXB 4I85A 1QFWL 3MRFB 1JDAA 1G7PA 4HU2A 1QKZL 4FG0A 3P1VA 4XMXA 3HAEA 3BH9B 3OSVA 3I85A 4P4RA 1P84J 3V5HB 4AQAA 1KFGA 1FSKB 1ECZA 2W9EH 3PHSA 5FOBB 2MSPA 4OGYL 1LEIA 4PBWD 4LDOB 3MLRH 4XORA 4UINH 3N41F 5JQ6L 2N4IA 2V5RA 3RU8L 1MY5A 2BSPA 3G04A 3VWJC 2BIMA 2NNFA 3ARYA 4A2HA 4JO4H 4U1GC 5CEXA 2WLKA 3BCFA 3VE0B 1KCSH 4GNKB 3QK0A 3UW0A 5C2BH 4LEXH 5FA3A 3QUML 1OTTC 4L0YA 2H9GB 5EORH 5K5YA 4NO0D 1AG6A 4OIIH 4JHWL 4JE4B 3EOYG 1KGWA 4J3SA 1S9XB 4Q4EA 3O11A 5E99H 4HK0B 2DYPA 2JVUA 1L6ZA 3BPOC 2Z4TA 1A1MB 1OW0A 1BD2D 5CM1A 4Z7UF 1AQHA 3FOLB 1UEYA 2E86A 2YAEA 3CUPB 4WHYG 4R90L 3T4AA 4HUNB 5KVEE 3NCMA 4KTDH 4DZBB 3FXIC 5MERB 2VCOA 4Q9CA 3LZPA 1TQSA 1D5MA 3TBSA 2CO2A 2WO4A 3T9GA 3QUZA 1IX2A 1CTOA 2ENQA 3B8YA 1RK1A 3QPQD 4AYEC 4AVKA 5J9PB 2XPGA 1G6RH 2NR6D 3WNOA 3JVGC 2V9RA 4WNSA 3FQTB 2P8MB 2CK0L 4FNPA 3QWNA 4L1DA 1ZT4A 4N24A 4OLUH 1KLGA 1W72L 2KZKA 3EZJB 1AP2B 3C6LC 3Q3GB 4JK0D 3JVFC 3RURA 5IR1A 1EDYA 1OE3A 4PRBB 3VI3A 1CICD 1NEZG 4KJPD 2WQSA 1PDKB 5I1EL 2FWSA 3PUCA 3SY2A 2X1QA 4EDWH 2AEPH 4JKWA 1G9ML 3NZHL 3THML 3BQUA 4U3HA 5D1XC 3U82B 3QFJB 1INEH 1XD1A 1DJWA 2UX6A 4LP4A 2WXPA 4LP8A 5IBUB 3K4AA 5DQJB 4KUCD 5D1XE 3D5OF 3LIZH 4HW6A 4Z3FA 2VDLB 3Q06A 2VLLB 3ARTA 3L8QA 2YRZA 3AQDA 3NIGB 4HBQA 4JY5L 4PJEF 3UBXG 1B4LA 3BIAX 1ZXQA 2Q76B 3GI9L 4HP5A 4IS6A 4NQDE 1YNTB 3LB6D 4UDUB 3SZ6A 3DUSB 1JGDB 3V6BR 4HJGB 4R26H 1YEIL 4FJ6A 5AVQB 3VD7A 2GSIA 2NSMA 1IEAA 4LPUA 4A04A 3GWJA 4WSJA 5DFVD 4EOWL 3VD9A 35C8L 2PP7A 3NSXA 5D2LA 3QYCA 2GSGB 2OMYA 4X6BA 1KWGA 4JFWA 3APMA 1L0XA 1QQDB 1A4CA 1LO4H 2BP5M 3NCBB 3SJVD 3N44B 2BNQE 3RLSA 1NCOA 5C9JA 3TBVA 3C09B 3F58H 4GKZA 1MHHA 3O2DH 1TQBC 5FO8B 3BT0A 2HP4A 4ZFGL 4UM9A 5CBEA 2EO7A 4BKTC 2HMIC 2VDLL 2OQJA 2VUKA 3QAZC 4XZ4A 3EJJX 5FIEA 4ES8A 3GTNA 3H0TA 3K72B 2WTRA 5T3ZH 3HG3A 3WD5L 5CNHA 3LXBA 3Q2VA 3IBEA 2AMUA 4LCYA 3CZJA 4WV1A 3DTUB 4JFEE 4TF4A 1JHTB 1F4WL 3EDJA 2B15A 4WW2A 4NQCA 5SWZE 1KBPA 2C9PA 2ZAGA 3EJZD 1I9JH 3KPQB 4UYQA 2P24A 3TWCL 3LMWA 4QEGA 1EAPA 1R3JA 1MCRA 4FJYA 3MRKB 5CWSB 1X7TA 4JG0L 2C1OA 3S36X 3V4VB 1DLHB 1HH9B 5KVFE 3C2AL 3PIQA 2XIDA 2UY7A 1DN2A 3MZGB 1PSKL 3EJPA 1AGCA 3QDGA 3WUWG 1GZQA 2QTVA 1FO0B 1K2DB 4PYHA 4QRSA 1BMGA 2B4CL 2Q2EB 3VFSA 5KVDH 3LEYL 4Q2ZB 3EBGA 2R2HB 3PHAA 4R5VA 4N2GA 3FSWA 3T3MF 3ELAT 1BEYL 1JVLA 1WZ1H 2XWDA 1EEYB 1SHXA 1I3GL 3FT1A 3FBKA 4XVTH 3U46B 4C56D 1RIHH 3HA0A 3UO1H 4DPCX 1RZIB 2E7DA 2WB1A 4ALAC 4GBXC 3E1ZA 4EW9A 2C7UB 3NT0A 4HJ0D 4JAMA 2OXHB 4OKVA 1T7WA 1YUHA 1PG7L 1P4BH 2K7QA 2MPAH 3Q44A 3VD0A 5EIVA 1GY2A 4NUJB 3H42L 4PY8J 2J20A 5ACZB 5CHNB 5ITFA 3K6SA 1II4E 3WFEH 3A67H 2VJJA 4YDKH 3QDMB 2B08A 2B1HL 2FJFA 4UQBA 1P1VA 5JMRA 2DLHA 1C8QA 5EIIG 3WN5A 1U33A 1SBSL 3ARWA 4LZKA 3HI1B 1U92A 2XT1B 3ARFA 4RFOH 5BUGA 3QZLA 1CF8H 4ZW6A 4D9QE 5ADPL 1HYSD 3N9GH 3NYKA 3PFUA 2FIRT 4N0YL 3GPSA 3FFCE 2ZX7A 2NTPA 1GY1A 2D9CA 3CXFA 1NM9A 3O6KL 4OZGA 4UDTB 2WW8A 3UZEC 3SYJA 3KEHA 1J05B 2VDMH 4U1IA 4DAGH 2EP6A 1D5RA 2C3GA 1OGTB 2FD6L 5HDLA 4BZ1L 3V55A 1YEDA 3P30L 5ESVB 2VQUA 4MZ3A 4ZO6A 1S8DA 3CPLB 4Y1AD 4PRIA 3A6BH 2NY2D 1N5AA 3QEGH 2HKAA 3GK8L 2Q3ZA 3BW9A 2MNWA 2RH0A 3KXFB 4N2AA 1XIWC 3ULUH 1P69B 3JWOH 1A3LL 1FN4A 2XV6B 3RB7A 5HPMB 4XGZB 3JWDL 3L3OB 3IT8D 3QPKA 3FCSB 4WWPA 5C07B 3PWNA 1SXCA 1PZCA 2GUOB 4EBQH 3MUY1 1N6UA 1A4KB 5JA9A 2HLFD 4HYTB 5FYLL 2HAZA 4OFKA 3WMPA 4ZMNA 4JB9H 3R7QA 3RFRA 3OZ9H 5CCGE 4XMTA 4F80A 4YHIB 4MA3B 3FJTA 5I75B 4IU2A 1NAKL 4HLZG 1LEGA 5JUEH 5F3HA 1B6UA 2F1EA 3DRTB 3HKZA 3N1QC 5AAWC 1XF4A 3AG1B 4ZTPL 4G9DA 4LOEA 1ZDSA 2WIIA 2HG5B 2I69A 3A6CH 1D5XB 2F7OA 4Z77A 4MXQC 4X6CB 3IMBA 4A39A 5EZOH 2I5YH 1XH2A 4L4TB 1K3ZA 2IH8A 3P9MB 1BVNT 5HVGB 5SWSB 4RDQF 5J13C 3LEXB 1R5WA 2C4FU 3R4DA 4QPEA 2PXYA 5DXWA 1JVOA 1G4RA 1VFOA 5TQ2L 2Z34A 3VI3F 5HJ3B 3ARGD 3EZ8A 2J55A 2OW7A 5D7EA 2I9TA 4P9HL 5T1LB 1JGLH 5J1TC 2ID5A 4MDJB 1JRHH 3S5LB 4A7TA 5DD5H 2X85A 1I8MB 4YQXL 4LLYA 3KPPA 2LLNA 3VTAA 5C3IA 1TQWA 4XVOA 1QR1A 1PCSA 5DJ0B 3RGVC 3GUTB 2IV9A 3IJ9A 4LARL 1AQMA 1INDL 2Z35A 3FUKA 4LL9A 4Z3JA 5D2NC 4JGJA 2V3FA 4PJ6A 3FRUB 5L7XL 3DHPA 3DETC 5INDB 1U8JB 2A4ZA 4K9JA 1HS6A 2NY1D 3QQ4A 3S37L 4A2MA 1G7LA 2ZOKB 4J4PD 4P07A 1ZANL 4XCYB 5D2NE 3BH4A 4XM3A 3QA3A 3UROR 1P7HL 3BSZH 2G75B 2BX5A 2KS0A 4KBPA 4NZUH 3UG3A 3MJ8B 1BVLB 2JIXD 3QORA 3VWJB 2YFOA 5D70H 5EUOA 2ZNXA 2R1YA 3I02B 5F72S 4BKSC 2FHFA 1UM4L 4PGCA 3D33A 4XAWH 5C0FA 4N2HA 4WHDA 1DJGA 1A7BA 1NKRA 3I6KA 5GGUB 3MJ7A 5DRXB 4HQQH 1OE1A 2NW2B 3WAKA 5C0DB 4L8CA 5DA0B 2IWFA 3MODH 4JX0A 4AY0A 4NBYB 5DHVA 1ADWA 1V3JA 3TNNA 2Q3XA 3OJMB 1FRGH 3PYCA 2YAFA 5CZXD 3BPOB 2QX3A 2JH2A 1NHCA 3PNWA 3H54A 4ELKB 4UBDC 5KUMA 1ITCA 1B9KA 1Z9SB 4K7PL 4ODVH 2JJSC 1IBGL 4H8WH 4R7DB 4WI7A 4WW2F 2IADA 1CF1A 2D4FA 3WEXB 1DO5A 4PS7A 3UC2A 4H25B 4F8TA 3LDBC 1FH5H 4PCTA 4F8LA 4DGVL 3EO0A 4JY4B 1HXYB 1OD9A 3NB2A 1BFVL 2G0KA 4ODXB 3C6LB 1GIGL 5B7FA 5KSVA 1SDDB 3LRGA 1BQHG 2PNDA 2I7SA 3WDJA 1ZSDB 2OYMA 4OBRA 3CFDB 3VFVA 5MHSE 1A7QH 2O30A 3OC5A 4BH8B 3P3UA 3GZOA 5D1XB 5IJKA 1KQ5A 2AQ1A 5IJDC 4XODA 2YIHA 1W15A 4UIMB 1EVUA 3MREB 5LCVA 4QHNA 4NQDB 1FJ1B 1KN2L 3KDPB 4LCUA 1ZKAA 4RISL 1DJZA 3IPFA 2VNCA 2R29A 4NWTH 3LYCA 1RZFL 3L1EA 4U1KB 1WBZB 3VGAC 5F6IC 5CP3H 2PWFA 4YLQT 5HHPA 2OCFD 5EF2A 3L4CA 1EXUA 3TZVC 2FE0A 4KJYA 4FFWD 4P5TC 4XTRD 5C09A 2AJSL 2DICA 1JMXA 2P4AB 3ARED 3D34A 5IHZA 3HUJA 3PP4H 4HKJA 1QSFB 4DQOL 4WUKL 1GA2A 3L3IB 3VUAA 1VEPA 5D1QD 2VXUL 3QJUB 3H3PL 1IL1A 1RERA 1J1OL 2BNQB 3NFNB 4OZHF 5DK0A 2VXSL 1X5HA 2R56H 3MA9H 2WN3A 4FNQA 1L9RA 1F02I 1KN4H 2OSYA 4LNRA 4QHLB 5AL8A 1YMMA 2IFGA 4PIRF 4UQDA 2KUTA 1PG7W 3DWTA 5TF1H 1NC4B 2ZXQA 1RJLB 5AVTB 2N3JA 3BPCA 3C5XA 4CW1B 4HXAH 1TQBB 4OZGF 3PCYA 5CINH 4FFYA 1EVTC 5AYUH 2H1PL 5HHVL 3WXVH 5BV7L 3NIFB 1OCWL 3QAZB 1HAUA 2EEFA 4JFEB 5HDWA 1UXSB 1S7TA 1JTOA 1XGTB 1GYCA 1OZUA 1DQVA 1VB9A 3ASNB 1RUKH 1MWAA 3QGVA 3LZQA 4PRPA 2QBWA 1QX1A 1UT1A 2G3ZA 4P3CH 4AG4H 1H15B 2NY3C 4FNUA 3LHPL 4MNQE 1UD2A 1QACA 4NQTA 5KOMC 4XC1L 4DO6A 1CL7I 2QKSA 2B2XH 1NCDL 2QADC 2KDYA 1AGBB 2B1AH 2C9SA 4D94A 1Y6KR 5ID1B 4NK6A 3UTTE 1GTFA 3IMRA 1QWHA 4YEIA 1MRCL 4M48L 1RZJL 3MLVH 2VXTL 3EGSB 3T0WA 4M9PA 3AG3B 1HILA 2TSBA 1QRND 4B3VA 1O8FA 1H19A 1AZCA 3CZFA 3FFDA 4FXKC 3LRLA 1EZLA 3FL7A 1VKXA 3CJJA 1S9XA 5DJ6B 5E00A 5JHBA 2LQRA 4LESA 1OTSC 1QKZH 3WGUB 1XGZA 4M3KB 3SCMA 3ZDXF 4I3SL 1NGXB 2DI9A 3ZQWA 5JZ7C 1I75A 1A1OA 2A9ML 1KXVC 4OGYH 4GBXB 4IEFA 4ZW3A 1FLTX 1ERNA 2KH2B 2EVIA 3MLSL 5A16B 1MCCA 5JQ6H 1F18A 4EE2A 1WZKA 1UWEL 2YPLA 2Q6WB 3RU8H 3TO4C 2K6YA 1X5IA 4UOW0 4DPAX 1NCBL 4IYKA 4PJHF 1ZS8A 2H7WA 1NBYB 1O6SB 3GSRB 1Y18A 2ESVD 3EAKA 1AZZC 3T2PA 2B39A 4AC4A 3WV0A 4M6AA 2DV6A 3QUMH 4RRPG 2R69A 3FU3A 1SEBA 5GS2D 3FFCB 1TO5A 1CT8B 4JHWH 2PPDA 5DK2A 1DEDA 1XF2A 2YMTA 1AYRA 4MQ7B 1E5AA 5AOMA 3KHQA 4P49A 3QFJA 4GP4B 5EA0L 3RNKB 4AXWA 3ZTNL 1ACCA 3EYFB 3GB7B 3F01A 1KMGA 5E2UL 1NGYB 2R2BA 3QCUL 5ICZB 1CLCA 2KPNA 4EEEA 4R90H 4M62H 4HJEA 2WANA 3BP6B 4OBSA 4W9FC 5FR3A 3KPMA 3WOVA 2Z91A 3D3VA 1LEKA 2J71A 5C92A 5DNSA 3L4ZA 2WQAA 2W9LA 1PEZA 4UDUA 2JKXA 3U9UB 4HJGA 2CK0H 1A14L 5DU7A 1W72H 2INVA 1AGDB 1XIWB 4TNFA 2DQDL 3TIEA 3HIZA 3X1BA 4ZX3A 5I1EH 3NJHA 3QPXL 1AZBA 1G9MH 2EVJA 4ODSL 3NZHH 3THMH 2OMVA 4Z7VE 3ESOA 3HE7C 1EPFA 4U6YA 1V3MA 3OB0H 4L37A 5T3XE 1OTUD 3UDWA 1D6EB 5C7XH 4URKA 3VFRB 4MJ6B 2OMZB 4E0RB 1NMBL 4Z95L 4G9FA 2J1ZA 1Q72L 4LDEB 1S3RA 2VLME 3N1FC 4JY6B 4X7FC 3HN5A 4JY5H 4HEMA 2E75C 4P2OC 4MJHA 5F21B 2X3CA 3GI9H 1OFDA 4U7MA 4IK7A 3QUKB 3GJFA 2X4RA 3EJUA 5HHQB 2FCBA 4PTTA 3B7YA 1IUZA 2VN6A 1YEIH 5C7ZA 1JYWA 3GGWB 5DEZA 5J1AA 1X7QB 2IQAB 4JPIA 1ZGLA 5J13B 1BZ7B 2VDQB 2JJVA 5KYWA 2BP0B 1E5CA 3KLAB 3FT2B 5C0AD 2DMKA 4ZOEA 1EGJL 1E6OL 4EOWH 2AK4A 1T83C 35C8H 1N9PA 1DLHA 3IYLW 4LFHD 5B8CC 4FP8L 1C7TA 3FO1A 3PUUA 4G1MA 2HFFB 5F7KC 1SY6A 4O2FA 1T4KA 4ZMAT 5HY9B 2FSDA 2TSAA 3PWJB 4F2ME 3MCLL 3DOSB 5D1ZI 4WRLA 4UANA 2WXOA 2XX1A 3PJLA 3ZL4H 3RGVB 3I74A 1L4IA 4ZFGH 3U9WA 2VDLH 5AD0A 5D2NB 3VQ2C 4J27A 1QNZH 2CXGA 4LU5L 4OCXL 3WD5H 4GG6A 2VDRB 5DZPA 4CBZA 4BUHA 2ETWA 1ES0A 1F4WH 1J0JA 3I9GL 5DQDL 1DO6A 2XV3A 2ZCHL 5AALA 3TWCH 1PFCA 1ILSA 4MAYA 5JW4Q 4MMZC 3TYFB 1LM8V 3P3TA 5CHNA 1KTLB 1N0XL 4CAGA 1NUNB 1FVCB 4JG0H 4YSAA 2X4PA 2ICES 1PSKH 3N40F 3VXUA 2G3MA 2KMWA 1KNOA 2VR9A 3TBWA 2B4CH 1RFDL 3NK3A 3II1A 3LEYH 1BD2E 4R2GD 5E5MB 3DROA 3QPQC 4J8RA 4RX4D 3ARRA 3IE4A 5BRZE 4QRQB 1NMAL 4LPVA 1KIUA 1BEYH 1Y07A 3DJSA 4N3TA 1I3GH 2K0RA 3H7BA 4M7LH 2H3NA 3UTSD 2BSSB 2VDRL 2PCPA 2XBZA 5D55A 4XCEB 3WYRA 2FJSA 4DK3A 5GRWA 1CICC 3SQBA 1KEGL 4EMZA 1T89A 3BVNA 4DOHE 2J21A 1PG7H 4KRMB 3HZMB 4BK5C 1T22A 5ESVA 3H42H 1OY3B 4JFPB 4LCWA 2K3HA 2Y3AA 3LDBB 1ZA6A 1UWXK 2NSXA 3SDXA 4IQHA 2MTAA 3L4XA 3SBWC 2B1HH 5IMOB 3MTRA 2VZVA 1ZRUA 3CDZA 3O4LD 1TDQA 1HHJB 5DJ2A 3AAZB 3U6XA 4FTVD 1SBSH 2XJLA 2AAVA 2XKSA 4K5PA 1BAGA 5K9KB 4PB0H 4U31A 1UGKA 1J8SA 1MW1A 4PWIA 3WY3A 5ADPH 3LB6C 4N0YH 3VH8G 4PRHE 3NABL 2F5AL 2YUXA 4HKXB 4AIOA 3ZSCA 5IQLA 3IGUA 3O6KH 1WT5C 3DIFB 1CLZL 4L1SA 3S5YA 2H0EA 1E27A 3DLQR 2BS8A 4QI3A 2RMNA 5DFVC 2FD6H 3M1BB 4BZ1H 2PYEB 3ML9A 4G1EB 4RNRA 5AVYB 3BYYA 3LKRB 2F54D 3VGAB 3P30H 1BMZA 2CIKA 5A7EA 5F6IB 2VN4A 1AOHA 3QISA 3TZVB 4Y4KA 4Z3HA 3MLYL 4G6JL 4P5TB 3S48A 1N7ML 2FDBP 3BZ4A 4MJ5A 1XGRA 3GK8H 2APXA 3OL2A 5IJCC 1HE8A 2YXFA 1UZ8A 1A3LH 1BGXH 3L1OL 3SJVE 1M3JA 1VRSA 2X1WL 3JWDH 5E5UB 3RPIA 4BSWB 5IQ7L 9PCYA 2X9XA 5E23A 2LHAA 5FLUA 4UCFA 2CDFA 4YPGA 3GMQA 4PYGA 2FWUA 5FYLH 4TSBL 2NMSA 2JI1A 2CMRL 5A43C 4OZIE 4IOIA 3V5DA 4OLZL 1J8HE 3SPIA 4P2QB 1DANU 4PSPA 3DMMD 4PRAA 4U3XA 1YEGL 1QW8A 5DJ0A 2DM7A 3EJZC 2CBTA 2ADGB 3O8XC 1HSAB 1NAKH 3IFOB 2FEJA 2NX5A 3ARSA 3F7YB 3TTSA 1MKFA 2ZXEB 3ZBMA 4MNQB 4DERA 1A9BB 3C5SB 3NIGF 2E7LA 5C0IA 4GI6A 3IJSA 4AH2B 4BZYA 2Y7SA 4F5CA 4IRSA 3PP3H 5IVXE 1YNTF 3SDDD 2XY2A 4C4BA 4PLOB 4MJIB 2H26B 3UTTB 2NY3B 4G5ZL 1E8XA 5TDPA 3FUIA 1E28B 1NCTA 3MJ8A 4G8GD 4PI0A 3BP5B 2QADB 1I9EA 1U3HA 2DMHA 3LH8A 4W9IC 4HC1A 5TQ2H 5F7WC 1U3JA 4DP5X 1U8IA 1SQ2N 2NZIA 4P9HH 5CZVL 3ILDA 4HWZB 1Z5LB 3A22A 5EN3A 3GLEA 1NM4A 1NAMB 4GXFA 4YQXH 4N5UA 3EDKA 4ZFZA 4HJ0C 3RAJL 5DJ8B 1S7SA 4A38A 1DN0B 2FWOA 3BJLA 3S3DB 4YDVB 2N7SA 4YPJA 4FXKB 3INOA 4HIEB 3LRMA 4GB9A 4LARH 4RWYL 1INDH 2X1XR 4C56E 2ATAA 5F7LB 3WEOA 2Z6FA 3IBOA 4LCVA 3MV9D 2EDXA 2W88A 5L7XH 3ARBA 5KYNA 4PY8I 2MQ0A 3S37H 3VD3A 2EADA 3MUZ1 3QXTA 1U21A 1ZANH 5AB0A 4QNPE 5E03A 4J12A 5IW1B 4R7DA 3TPKA 4YSSA 3TO4B 4C55A 2G30A 1HYSC 1I8IB 3D4ZA 5LXGH 1I7RA 1ZWIA 2EO1A 3BUBA 4H2CA 4RLDA 1UM4H 1U93B 3ESPA 1JK8A 5D1ZA 1MCSA 1PY4A 4WHYH 4U1NA 4YMPA 4NZDA 1CXFA 2XNAB 3OHMB 3UAFA 5F44A 5DJXA 4MLSA 1Z5YD 2HVBA 1PJ9A 3IJYA 1RWRA 2BINA 2HRGA 4P8QA 1GSMA 1DBML 1ZSDA 2Y7QB 5ANHA 5FHAL 4Z78B 2W0KA 5DURD 1IQDB 4MDIB 4BA0A 3STZB 4XP6L 4HD5A 1FFPA 2NY2C 2XN9A 2OTUA 1IAIM 4GG6F 5LN8A 1HZHL 1R33A 2BERA 3EYOA 3N50A 1IBGH 4Y1AE 3L7FA 1RD6A 1FORL 2IALB 1I3VA 1KGCE 3I3EA 3CN3A 1HCVA 1UT9A 3CN4A 3SODB 4DGVH 4JJOA 1JHLL 1AI1L 1XFPA 2X4QA 1NJ9A 3ESUF 1MFDL 2VBKA 4Z8FH 3T0EB 3L3IA 1VEMA 3K8LA 4L4VD 4JFOA 4Z7VB 3PWLB 2VL5B 1GIGH 2ZNWA 4N5ED 4ZODA 1S5IL 3U36A 4PJ9D 4RA0C 1XF3B 2XXMB 2BVEA 4BZ2A 1MFCL 5I1IL 1BBJA 1U3YA 3BEWB 4JM4L 3LN4B 3HE7B 1CFQB 1RK0B 1F90L 4S2SB 3Q5TA 1NC4A 1CFNB 1RJLA 3EH5B 1SNRA 3OG6B 5ISZA 2EDYA 2ZP0T 4N3UA 1KN2H 3KM2A 4KV5E 3DYPA 1H8NA 3AZUA 1KGXA 1MZYA 4PR5A 5D7IE 1PAMA 4HUUA 3VXQB 4PGEA 1RZFH 3ARGC 2FEDD 1IGCL 4JRYA 4P2OB 3WJJA 2B3IA 2NTFA 3AS0A 1BYNA 2FR4A 3AROA 2AJSH 3G5XB 5IROA 1VERA 5D4HA 5GISL 3CZLA 3GSVA 1H15A 1QFUL 3SDXF 3J07A 4DQOH 3WS6A 4X4YA 4WUKH 1G0YR 5CZKA 2VXUH 3V6FA 1CLWA 1C5DB 1MNUL 3H3PH 4KU1A 1J1OH 2E56A 2VXSH 1N8OE 5T3XL 4F2MB 1QYGL 3WMSA 1E4JA 1JWUB 2XTWA 3MNZA 1WFIA 2NY1C 4GLRH 5B8CB 3QDJD 5G2NA 3CFTA 3TJEL 4H13C 3FT3B 2M26A 1BVZA 5CGTA 1LK2B 1Z2KA 3SE8H 2WHVA 4X9HA 2Y9RT 1M42A 2A6IB 4YBLC 2CBOA 4WVRA 5HYJE 3AG2B 2W59A 1G7MB 1BZOA 2H1PH 4LPTA 2ADJA 5DJ6A 5HHVH 1OCWH 3OWEA 5BV7H 3WWGA 1R75A 4UT9A 1SZNA 2CIIB 3HPLB 4FQHB 4U6HB 4YR6B 2XWJB 1EH9A 1R5VB 3S4SA 5EBMA 4D0DB 3VVVA 1CLYL 4GY4A 4X6CF 1JHKL 5FK9B 2Y22A 3LHPH 4NO0B 3H6JA 3KS0H 1ETJA 1N64L 1DVSA 2CJUL 4PJAA 4KXAA 1WISA 4HUXA 4XC1H 3WY1A 3ZVVA 5EEVA 4MMZB 1NCDH 1WITA 2J6EL 1OK0A 5CZXC 5SX5K 3SDAA 4GEIA 1BD2B 1JXDA 1MRCH 1RJYA 1RZJH