3VSUA

The complex structure of xylc with xylobiose
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 240
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsuA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsuA01
2X85A 1L0PA 3GXNA 4J3SA 3UW0A 3EJPA 6TAAA 2NSXA 2E9BA 3GBDA 3WNKA 3FW6A 3VNYA 1PE9A 3D52A 2ZXAA 3KL0A 4KWUA 1RP8A 2AAAA 7TAAA 3ZSSA 2O04A 2X6XA 4XN3A 2E0PA 4UNIA 3BLKA 1UD8A 3WDIA 1QCXA 3EQNA 1XH2A 4PEEA 1KB3A 1PIFA 2FGZA 4UQAA 2ZX8A 1G9HA 1RU4A 3WY3A 2VBKA 4CN4A 2ZXBA 1WZKA 2UVEA 1KCDA 1JAEA 1UA7A 1HG8A 1BF2A 1OGSA 1VAHA 8CGTA 3S5YA 2IQ7A 3VSTA 1CGTA 1JIBA 2XVKA 3M07A 3CPUA 3QGVA 4FLSA 1WZLA 2AMGA 2BHUA 4XKWA 4PMHA 2NT1A 3GQAA 1CDGA 2YA2A 3OLIA 2F2HA 1E3ZA 4KMQA 1JXKA 3MI6A 1J0JA 1CLVA 1V3JA 1MFVA 3ZOAA 2D73A 3HG2A 1IB4A 1S46A 3L4UA 1CXEA 2V3FA 2GJPA 4U31A 3CZNA 2ZX5A 1RP9A 4HP5A 1OFMA 1BSIA 1XD0A 5A2CA 2GUYA 5I5RA 3GXFA 4UQEA 2XIIA 1O88A 1UD5A 3GRHA 3DX0A 2X2IA 5TD4A 4J3WA 1WO2A 4JL1A 2WVUA 1WE5A 4AIOA 3BAIA 3CZKA 1OSEA 1TMQA 3VSUA 2YIHA 3OLDA 4WSJA 1UD3A 1PZ2A 1HTYA 1WZAA 1XH0A 2Z8GA 3UCQA 1CYGA 3BLBA 1J0HA 1RMGA 1VFOA 3HJEA 2F61A 2QPSA 1KGUA 1Z32X 1EHAA 4HOZA 1QHOA 4XLFA 4U4BA 4AVZA 4JL2A 2F1BA 5C1CA 3DX2A 4J7RA 2Y2WA 4XLHA 1Q4NX 1HWWA 1OOCA 2D3NA 1TQUA 1JD7A 2BY3A 4DO6A 3VGFA 3EJSA 2ODLA 3B8YA 1O8EA 2NTQA 2CHNA 1JDDA 2IGTA 3D4YA 1UH2A 2EWEA 3EDKA 3KL3A 1IDKA 1O8MA 1KCLA 4GI6A 3W37A 2YKKA 3A4AA 4MAZA 3JURA 3BCFA 4JFSA 1UH4A 2WKGA 3BUPA 4NK6A 3TTSA 2O0VA 1QI5A 1D7FA 1UOKA 4OZZA 2TAAA 2OSWA 2WVSA 3S5ZA 4XONA 2WSKA 4J3TA 1UH3A 2EADA 2X6WA 1JF5A 1WP6A 3T9GA 3A5VA 1U33A 4AW7A 4CN6A 3LPOA 4J27A 1GCYA 9CGTA 1J0IA 1XSIA 2ZWYA 1UD6A 4GQRA 2D0GA 3WWGA 1CGXA 1EO7A 3L2MA 2BY0A 1UKQA 1CXIA 3IJ8A 3VX1A 2ZWZA 4LPCA 1U30A 1SZNA 3ZT6A 3B90A 4XOPA 4AEFA 4PCTA 3IK2A 5I0DA 1LWHA 3GXDA 5A2BA 1HL9A 3OLEA 1G94A 3H55A 3UEQA 1MWOA 3WY4A 4GINA 2OSXA 1JF6A 1OB0A 4WSKA 4OJLA 4NX0A 1MVYA 4XORA 3H54A 2WCSA 4Z06A 3ZPPA 3TOPA 1V3MA 1CXFA 1R34A 2BY1A 3ZQ9A 3KL5A 4NZFA 1QJVA 3ZO9A 1AQMA 1CGYA 2ZUUA 2QV4A 2V3EA 2DH2A 4BZYA 3LRKA 1GQ8A 1BLIA 3GXMA 1O8KA 5F7UA 1OGOX 1EE6A 2Y4SA 2XIBA 4UQCA 4YEJA 2XWEA 3VNZA 1HXKA 2ZE0A 3RIKA 1DBOA 1B2YA 2GJRA 3CZEA 4FLRA 3CC1A 4B9ZA 1IZJA 3KLLA 4J3UA 5A6LA 3VGGA 1KWGA 1BN8A 1AVAA 1UA3A 2Z1KA 1CXKA 3VMPA 1CXLA 3EDEA 4OJ5A 2F7OA 2PECA 3ZSTA 3K8KA 3UG5A 3LRMA 3IJ9A 3H53A 4HA1A 3UG3A 2EJ1A 2XN0A 3AMKA 1HL8A 1CIUA 3HG4A 3GQ8A 4GQQA 4AYSA 3EQOA 1R47A 2X2JA 3LMWA 3OLGA 4GI8A 3SUCA 3WNNA 3BC9A 3WELA 2QX3A 3BVXA 1XCWA 1GJWA 3BUDA 1JXJA 1MW0A 2QMKA 3VGDA 1R46A 3BAYA 3ZR5A 1SMDA 2NSTA 1VFUA 3CZLA 4PSPA 2O1DA 1TQSA 3KRGA 2BY2A 3BAWA 4FLQA 4M8UA 1GVIA 4OIFA 4AMWA 1UD2A 3L2LA 4PSRA 3WEOA 3WMSA 4WF7A 1XSJA 1O8GA 2WPGA 1EA9C 1PAMA 1U2YA 2BHYA 4XLCA 3ZT5A 4OGZA 2WNWA 3CLWA 3LRLA 2X6YA 1D3CA 5DFAA 4OJ6A 3K1DA 3A21A 1IV8A 1E40A 2QLYA 3BAKA 1DHKA 4HOWA 3BVVA 3VM5A 4UQ9A 1KGXA 1NM9A 2VRKA 4XKVA 3BH4A 2VJIA 3FY3A 1KCKA 4OJYA 2D0HA 4M56A 1JI1A 1OGMX 3DC0A 1NOFA 2VUYA 2VNCA 1JDCA 4E2OA 5E1QA 1CPUA 2ZUSA 3VU2A 2ZX6A 2VT0A 1TQVA 2E4TA 2NT0A 4J3XA 2F7QA 4NXKA 5CGTA 1C8QA 2OYMA 4MR0A 2EO7A 3A23A 5C1EA 1K5CA 4AIEA 4W8SA 1XCXA 1QI4A 5E70A 4Z05A 3HZ3A 1KXQA 4JFTA 1V3KA 4FNSA 4FNTA 3WNMA 3AXHA 2ZX9A 2WSPA 1QW9A 5CLTA 5CLWA 4Z03A 1O8DA 1HX0A 1Y7VA 1MW2A 1VBLA 2PWDA 2INVA 1JTAA 1E43A 2PYHA 4GO8A 2CXGA 4JFUA 4MB1A 5CXPA 3WNLA 1CGUA 1XSKA 1HNYA 2VR5A 2Y24A 4FMVA 3TONA 2ALWA 4H8HA 1PZ3A 2EQDA 3BAJA 4FNPA 3L4VA 3BCDA 1DEDA 1KTBA 3CGTA 3AXIA 1JG9A 3EDDA 3WY1A 3D50A 3K8LA 4FNUA 2F7PA 5I23A 4YZ0A 3L4WA 1JDAA 3GXTA 3AMLA 4W93A 1MW3A 3WN6A 1VIWA 2ZIDA 1JFHA 3BSGA 4ATWA 3EJUA 5E0FA 3EJQA 1RPKA 3BSHA 1IDJA 1TQWA 4GKLA 1CZFA 4H7VA 4YELA 1MW1A 2FHBA 3GTNA 2D0FA 4PCSA 4X9YA 3W38A 2WVVA 2O0WA 3ZSCA 5I24A 1CGVA 1JI2A 1QPKA 1KBKA 3EJTA 4AEEA 1KGWA 2ZUWA 4FNRA 1AQHA 3DX3A 4J3VA 4XNFA 3BMVA 4J28A 2NTPA 2WANA 2GVYA 3VGBA 1VFMA 1OFLA 1PS3A 1WZMA 3CZGA 4W8QA 2WKLA 4XOTA 3CTTA 2YJQA 1PJ9A 1KTCA 3BLPX 3GQ9A 5HPOA 1OT1A 3BVWA 1IZKA 2D3LA 1PXZA 4FNQA 2ZUVA 1QWNA 1R33A 4OJPA 2F1AA 1DTUA 1JGIA 1G5AA 3K8MA 4LQ1A 3BUIA 1EH9A 1JD9A 2WVVB 2QXZA 3VMVA 4U2ZA 4CKQA 3VSVA 3KWXA 4H8UA 3ECQA 3DDFA 3CZSA 2QY1A 5AMVA 3II1A 4NK8A 5CGMA 1AIRA 2YA0A 4XLAA 3LX9A 2OYLA 1KXHA 4B9YA 4UOZA 4XR6A 2ZX7A 3A47A 3DDGA 1X0CA 3RILA 2UVFA 4XL9A 4XM3A 4EW9A 3WNPA 3EDFA 3AJ7A 1MXGA 2QMJA 1M7XA 1KCCA 3VGEA 4W8RA 3HG5A 4YZXA 2INUA 3VMNA 1PPIA 2PYGA 2OSYA 2ZXDA 1OT2A 1QWUA 1UKTA 3KE0A 1O8FA 5EMYA 1DBGA 3FAXA 4GI9A 3UG4A 3BVUA 1KXVA 1PIGA 1R75A 2G3MA 1CXHA 1TQTA 3WY2A 1KXTA 1XV8A 1BVNP 4U3CA 1J0KA 4H2CA 3LXAA 3L4XA 3KEHA 3VGHA 4AYGA 3A6OA 3IJ7A 1I75A 1V3LA 4TVUA 2EABA 2XWDA 4HWVA 4X0NA 1VB9A 4GIAA 3A24A 4URRA 3D51A 1KWKA 4OZYA 3VMWA 1KTWA 5E6ZA 1KBBA 2C8NA 3L4TA 4UCFA 2DIEA 4CGTA 3VO0A 2NT6A 2BXZA 3WFZA 2XN2A 1XD1A 1BAGA 2CPUA 4NZJA 4UQDA 2BXYA 5HDRA 2FHFA 5BRQA 1E3XA 2XN1A 1GJUA 1G1YA 2VJJA 2OYKA 3FAWA 3DX4A 6CGTA 1MFUA 1P6WA 1PLUA 2YA1A 3WNOA 1MXDA 2NT9A 1W9XA 3CV5A 5E9AA 5A6MA 3UERA 3BUQA 4QAWA 2DIJA 2PWEA 2WCGA 2Y5EA 2VRQA 4DO5A 3IGUA 1BPLB 4UZUA 2VBMA 1H3GA 3VM7A 2VBEA 3LXBA 5HXMA 2FH8A 4HPHA 3EDJA 3A22A 2E8ZA 4I84A 1QI3A 4JFWA 4OKDA 7CGTA 1QHPA 4FLOA 2E8YA 3BUBA 2ZXQA 3WDHA 1NHCA 2PWGA 3WEMA 1VJSA 4BA0A 3TTYA 1QW8A 4NI3A 1UD4A 1O8HA 1IA5A 4CVWA 2DH3A 2BHZA 2OW7A 2G3NA 4YZAA 1T0OA 4GO9A 2NZMA 1RWRA 1CGWA 2F18A 3GXPA 5BRPA 1HVXA 4W8TA 2BSPA 1H80A 1ZJAA 4UZSA 3GXIA 3TV8A 4UQBA 4XMYA 1LWJA 2YFNA 4XN0A 1SMAA 3L4YA 1QX1A 2WVTA 3DHPA 2XVLA 3LPPA 3BAXA 1XH1A 2O17A 3D4ZA 1ODUA 2FH6A 3ZR6A 1HT6A 5DO8A 2FYVA 1O8IA 1ZS2A 3GBEA 2XVGA 3KLKA 2FHCA 2X3HA 1JL8A 4C2LA 4AMXA 2F7RA 3BMWA 3VMOA 1WPCA 1XGZA 5E6YA 1B0IA 4UOQA 4U2YA 3BVTA 4LXFA 5A2AA 4YZQA 3HG3A 1UASA 2PWFA 1AMYA 1TCMA 4H8VA 4XLEA 4WLCA 4XB3A 3ZT7A 2D2OA 5KEZA 2FE0A 4JCLA 4U49A 3B4NA 1O7DC 2NTBA 2QPUA 3L4ZA 2ZICA 1XG2A 3DX1A 4NXSA 1UKSA 1JRGA 2YFOA 4MXNA 2EEXA 2EAEA 3GQ7A 3DHUA 2X2HA 3VX0A 2ZUTA 1BHEA 4U33A 3WDJA 2V3DA 2WC7A 2OW6A 4XQFA 4OJOA 2PWHA 1WMRA 1BVZA 4JFVA 1O8JA 4DO4A 1O8LA 2J25A 3LXCA 1M53A 2C7FA 3EJRA 4HOXA 2NSPA 2YOCA 1EO5A 1BG9A 3WENA 1ZJBA 3S2CA 4JCMA 1A47A 1PEZA 4CN1A 2EACA
chains in the Genus database with same CATH superfamily
1L0PA 4EMZA 3NIFE 3UPRA 1P7BA 3GJEB 1BGXL 4H20L 2DQJH 2NSXA 5F9AC 1CDHA 4PY8J 1BG1A 1TYWA 3PDGA 4BZ2L 3K2UL 2ZXAA 3RVXC 2APWA 4XO3A 3V0WL 4OM0L 1LE5B 1YYCA 3F3HA 1IM9B 4A7UA 3FT9A 2ZUYA 4HWZB 3WDIA 3I9AA 2VDML 1NCAL 4LIQE 4P2RD 3WJJC 5C1MB 4Z7UE 3QQ4A 4PP1D 2DKMA 1QRKA 4YDNA 4Q6YA 4B3EA 3MV11 4JFEE 4KZEH 1S78D 4NZTH 3SCMB 1A6ZB 1ORQB 2BSTB 4JFDE 4PP2A 8CGTA 5LLIC 5FO7B 2CUIA 3T1FA 4YHML 4GP4B 3APFA 2R2EA 4M62L 3AG4B 4XKWA 1IBGL 3F64A 2YA2A 5E2UL 3CH8A 1NGXB 4EKJA 5C0JA 3KJ6H 2TSAA 4JPSA 3LVTA 1V3JA 4ALAH 3HE6B 4MXVE 3HG2A 4P46A 5JW3H 4FXKB 4G80B 5FX3A 5LDUA 4P9MH 1JZJA 1Z9OA 3V10A 2DPKA 4WI9A 3MBEC 1UD5A 2VDPL 1LEKB 3IJYA 5DVNA 3U46B 3W81A 4D0DA 2C9QA 4TMPA 3FONB 3PWNA 4WVRA 1H15A 1YPZE 5E2TL 3FRUA 3L17A 3MGTB 3UBXG 4AIOA 4TTDD 3CZKA 2FX7L 1TMQA 1OTUD 1VCBC 2Z8GA 4N2OA 1XGYH 3MRLB 2HFGL 5FK9A 2V33A 4H26A 2AJSL 3TA3C 5TK4A 4JO4H 5JIDA 1EDQA 2X6VA 4PS7A 1VFOA 1GCFA 1OSPH 2XWXA 4U6HB 4PVNA 5FYJU 1YEDA 2PCPA 2F5AL 5HHQB 1TJGH 1TEFA 1NMAH 5GGTH 4LCWD 4WCYH 3HNTH 1ZHBA 1EZLA 2ZNWA 1QKZL 4JM4L 2W5PA 2VMFA 1OOCA 1O9ZA 2W91A 5C86A 4YEFA 2D3NA 4MNGE 1KCSH 3QWOA 2E59A 2R27A 3EYVB 2XFGB 2CHNA 3EO9H 1HDMA 4KTGA 4NZ8A 5KTEL 2ZQKA 4R97B 1V55B 1BZ7B 3ETSA 2XWBA 4DKFL 3Q9QA 4P2QA 4WTWA 5GJTL 5AKRA 3HNVL 2WVSA 2YSTA 3AQYA 4XONA 4AVJA 1CF8H 3VE0B 3ZKXB 2YMXH 2N01B 3F6IA 3LNEA 4PRHD 2P3YA 1GCYA 3V6FA 1UD6A 1A1MA 1JXFA 3I3DA 4KQ4L 5ISZD 4CSSA 5HYJA 3G08B 1SOKA 4N2GA 2GPZA 1UKQA 5IF0B 5C0RL 2A4CA 1AZNA 4Y5YB 4HS3A 5ANME 1TPXB 2BCMA 5E4IA 4A7GA 4X6EB 2AJVH 1IGTA 2VYRE 3CSYA 2Z93A 1CLWA 4N2AA 5EU5B 3UEQA 1MWOA 2Q8BH 2X9YA 5CEYB 1S9YB 1JF6A 3N41B 1BREA 5KSAB 3V6ZA 1L9PA 3GSXB 4L29B 4ZFOL 5DQJA 4J3OG 1A7OL 1N8OE 1JYWA 1MJ8H 4PRHE 4PGEB 4AQOA 4H4NA 4XZ4A 4QTFA 3BPNB 2XWJA 5KSBE 2YD0A 4JREC 3WS6C 3WE1A 4CSPA 1P5UA 5TH2A 4WDIB 3B2DC 4BELD 2ZUUA 4UT6L 4GT7A 4YXLL 3H3PH 3LRKA 5T1LA 5BO0D 4GAGL 1GYUA 4KPHH 2WQVA 4U6VH 1PG7W 1KCVL 4WUKH 5LVEA 3ESUF 4X9GA 2VDOL 1T7VA 3MRDA 4HIPA 3EOBB 2XT4A 1E6OH 4YBHA 5AZUA 5C0ND 5DQ9B 5DJAA 2NX5A 1Q9OB 4TKWA 5A6LA 2X44D 3HG1B 4LEBA 3B9KA 4HX1A 3OKMB 5DSCB 4O2FA 1CDBA 3AW5A 1M9WA 5I26A 5I6LA 2NPLX 3RY4A 5I2IA 3I74A 1FVCA 4R2GB 5GIRA 4PJHA 5JO5A 4FHKA 3WFDH 1UVQB 5I1GL 3GKWL 4CMHC 1PZDA 4KK9D 1WF5A 3GQ8A 4AYSA 1S9WB 1ORSA 3WNNA 3QXAB 4XPTH 3WELA 1U8MA 3ILDA 5CEXB 2NY7H 1YY9C 1D5ZA 3ETBJ 2QGBA 1SLWA 3BKCL 1N68A 4PREB 4WNJA 4Z7QE 5E8NA 2OPCA 4NJAH 5EOCL 1JPTL 3H9HB 3R4DA 3HN8A 4FQHA 4JY4B 5ABAA 1UD2A 1FORL 5D1QB 4I3SL 2H1PL 4WIQA 2PYEB 3GJEA 3PP4H 4IBSA 2YPVA 4XP5H 3VFNA 3LRLA 2HH0L 1D3CA 3LB6D 4F2MB 5DNSA 4LVHB 3WO3B 4B9CA 1IV8A 1YDPB 9PCYA 4XP4H 2F6AA 3DHJA 2APVA 3VM5A 1MEXH 1RZGA 1L9MA 3T4YA 3PGDB 4XNMB 1RY7B 1OKEA 1V7NH 4WWPA 1F86A 1LDPL 1LMIA 1DR9A 2UXVA 5DJ8B 1IKOP 3I50H 2ZX6A 3CVIH 3VXUB 5CD3A 1XZ0A 4HD9A 5GRYA 5KG9B 1DQJA 5C07D 1ERNA 4G8GE 5C7XH 1R6VA 1E67A 3NPSB 1OLLA 3GT6A 1MY7A 3WHXA 4LSVH 4P46B 5MEOA 4Y4KA 1I85A 4BE6A 4EZLA 4FI8A 3RPIA 4ZG1A 2COVD 3V9EA 2VDLL 3ABGA 4AV0A 2L7QA 4HH9B 3SPHA 4XBGA 2A9NH 1SHSA 1XWVA 3MGTA 4ODSL 1ZVSA 4ACTA 4H1LB 4HCRA 2VO8A 2HSIA 1HOEA 5AENA 4MX7A 3EDDA 4G59C 4H26B 3TURA 1W8OA 4X5WA 3N6YA 4Y19D 1XT5A 3KPOA 3S36X 4BFIB 3BOVA 4IYKA 3AMLA 3B5TA 3JV4A 1ZLEA 4S1DC 2IFGA 4HMCA 5E9NA 3DRTA 2FIKA 2FJHB 5B7FA 1JFHA 3HAEG 3UTSE 2A83A 2HJFB 3JSSA 4AX3A 3WBDA 4UILL 4EN3A 4Z0XB 5E99L 3TIEA 1MW1A 3ZRSA 2NZ9D 3MV9D 1WFMA 4ZS6C 3BIAX 4J5VA 2PP8A 1IAOA 3VFUA 2YUHA 2X9ZA 5HP5A 1DJZA 2H6PB 3MYZA 2GHWB 3DX3A 4J3VA 3UTZB 3IRZA 1GOFA 2WANA 4PJAF 2P8MB 5GS0H 3D1MC 1OL0A 2CH8A 4PLJD 2VDPH 5L0QB 2I5YL 4KH9A 5F72S 3QUKA 2QQLH 1BMZA 2JIXA 1QBMH 4E5XB 4QOKB 4E9WA 3MRKB 1HILB 4YHIB 2CE6A 4XPHL 2P8PA 4GUOA 2ESVE 4OB5L 3VMVA 3VXME 4YSTA 3RGVC 1O7SA 4XPBH 5EPMA 5BQDA 5HGHA 3V6FB 2F53B 4DZ8B 5T33L 4GUCA 5JR1L 4YFLI 2E7DA 2ZKHH 4RLDA 5HHOD 4GG6E 1GZPB 3B5GA 3CU7A 3HNTL 5A1AA 1JWUA 2VGLM 4JQXA 4AW4A 3STZB 4N6QA 4JFHD 5AW9B 2NNAA 2DD8H 3NZUA 5JZ7D 3VD5A 5D71L 5LBSH 4IQHA 4OUUA 4UDTA 4P2OB 3NEOA 4EDXA 2XPYA 1EZVY 4P2QD 4P2RE 3MBED 4Y4FC 2XN9E 3HB3C 1EV2E 1MLBB 3ASOB 2L04A 2YN3A 1WA1X 2XC1A 2H9GB 5I0WA 1C8PA 4H2CA 3TYFB 4FKEA 5C0GB 4AYGA 5E5UB 1QA2A 2V5TA 4DKFH 4TVUA 5C0CD 1ZE3H 1O5DT 5ACZA 3WKYA 2XWJB 1ET7A 2CDFA 3NZ8A 1TKWA 1UM5L 2AJZA 2QSVA 5SX5K 1KCWA 2VXUL 2WAQA 3TFKC 5EZLA 5I6NA 3ABLB 3MR9A 2YD6A 1X44A 5AW3B 3NJJA 3QORD 1F97A 4ZXBC 1OWRM 4BJLA 4OLZH 4QRSA 3FTXA 4JDEB 2GT9A 1BX2B 4EI6A 3HG1A 5C0RH 1PLUA 2YHGA 5IG7A 4WU5A 1EXUB 3KYKL 1DJYA 4X4XA 4BFKA 2V2TA 4FCHA 3RI5F 3ZKQD 4BIKA 1NMCB 3NK4A 5L9DL 4NAMA 1MCPH 1SDAB 4GMSL 2B15A 3P4OB 3KPPA 4FJ6A 4WW2F 3P69A 5IR1A 3X13A 1U8MB 2J44A 2B8OT 2OFQA 4JRXB 4RDQG 3HN5A 4NKQB 3SE6A 1BP3B 2NY1B 1AGFA 3L7EB 2VWEE 3IVKA 2Y07L 3ZO0A 4GO9A 3FO9B 1A9EB 1GGIH 1CL7I 3OZ9L 4YXLH 1TT6A 3U7WH 3IFOB 5IJBC 1KCVH 5D2NC 3CC5B 4FFVC 1ZLUK 3DK2A 1X5LA 3MV7B 4LRIC 5ALCL 1AD9B 1A6AA 1RULL 1B3JA 1SMAA 3BWAB 2WW8A 4HUXB 3ESOA 1H9VA 3D4ZA 4OM1L 5HHPB 3AM8C 1N64H 4G8EA 4MXQD 1E27A 4XO5A 1SVCP 1PZ5A 4QRRB 3NAAL 5F3HA 4B9IA 5MENB 3G6DH 3GM8A 3VFWA 2BIPA 2N56A 1AD0B 2FHCA 3PGDA 1J7VR 5JORB 4PV9B 4KDVA 4IBLT 1JZDC 2RD0A 4LXFA 1FO0A 3GDCA 5A2AA 1BXXA 2D7QA 12E8H 4NUMA 3VDCA 4RAUA 5JPMB 5EZOL 3DO3A 2BSCA 1BWWA 3BEVA 2YQBA 5HI3D 5AW2B 4D8PB 5HVHB 2X53A 2PNDA 5HYQB 4M7KH 1SDDB 5MEPA 4U33A 1SYVB 3HZKB 4XQFA 2H32B 1RD6A 3WD5H 5GGVH 3L81A 1O8LA 3LXCA 3EJRA 3HI5L 2NSMA 2E9GA 1OCCB 3D85B 2E7BA 3CQPA 4JZNA 1QSVA 2VMEA 1A6UH 3IXAA 3KBPA 5C0AA 4FABL 1K3ZA 1TITA 1HESA 4Y2DB 1EK3A 4LPTA 3EJPA 4J3OH 4AY0A 3UIZA 4Z7NF 3SGKA 4UT7H 2BIIA 4NYLB 1RMFL 3KL0A 4MJHA 3WHE0 2AAAA 3H42L 4WV1A 5HPMA 3SGEI 4Z3EA 3T2QA 1LDPH 3TF7C 5H37H 4UUJB 1KJMA 2FJHA 1LM8V 3Q6GH 5I1JH 3IDJB 1WZKA 3VYPA 5HJGA 3W2DH 1UA7A 5IB4A 4N5UA 2R9HC 5C7XL 2YRZA 1SQ2N 3NCEB 1J5IA 2PXYC 2YXFA 5C0FA 4GRWB 3U2SA 3V5DB 3VRIA 3UTTB 2WTOA 3K74B 4KHTL 4N26A 5D7JC 3I3BA 1A7PH 1CDGA 3BGMB 1RZFH 1XB8A 3QNYB 1UXWB 1Z9NA 3IJSA 5E1HB 4AQAB 4XB7A 1CLVA 3QIUB 1D6EA 5K9JL 2D73A 2NLJB 1BHGA 2VDLH 4UNTA 4V11A 1Z66A 2E7HA 1I1YA 4QXUH 3CSGA 3X12B 3EBGA 2YPVH 3MLVH 5D1XD 1P84K 4QHLB 1ORQA 2BSTA 4GSXA 4OGYH 2ZOTA 4JL1A 3M45A 4NRZB 3VSUA 2PCFB 5C0DB 3APMA 3D39B 4K3EL 1XH0A 4NERA 2HA1A 3ARBC 2QFRA 4L3CA 5DFWH 1RMGA 2C9SA 2RQ8A 3U6XS 4C83A 5D7LE 4FXKA 4KAQL 2HJLB 4AQ1A 3GO1L 2EDNA 3D06A 3KWVA 3O8XC 2H5UA 2NNAB 4DP5X 3D05A 5CUSH 1IL1A 1JNJA 2F1BA 5D5MB 2QQKL 1I3GL 3MUJA 4CMHB 4P2OA 3T3PB 2BM4A 3O0RL 1BD2B 1K8IA 3GRWA 1N59A 4OD2A 1EGJL 4FS0A 2WLKA 3H4FA 2PXYB 3CZUB 2BY3A 3SKJH 5GS1B 1MHCA 5J13B 3PDOA 1LEGA 1SHMA 4KJWC 8PAZA 1NCWH 1JDDA 5CEZL 2E27H 3MRGB 1UACH 2VZVA 1ROCA 1DFBL 2ZCKL 3CXHK 4GI6A 4MMZA 4NPYB 4YSRA 3BCFA 5AW5B 5BRZE 1M2VA 4O2CA 5JIIA 5JQ6L 2PPFA 3MODH 3SE8L 1ZGLB 1EO8L 2V9RA 2XJKA 4OB5H 2X10A 1FUNA 3FSVA 5I1LB 3GHEL 2E7LA 2A99A 3DX9B 5DR5L 4JPIA 4MKMA 5LBSA 3LN5A 4GKZA 4XH2B 3PYCA 1J0YA 4M4RB 5DWUL 2IG2H 3PFQA 1G4RA 4R3SA 4AYFB 3CHOA 3UGXA 2QSCH 4Y1TA 1MWAB 1UXSA 1OVZA 2DLFL 2YBGA 3X3GH 3RVWD 1ODAA 2BOBB 4JDVA 5CINH 2VJ0A 3N2JA 5DURB 1SPDA 1HZLA 3CFIC 2NY0C 1FZOA 5B1CA 5LCVA 4LEXH 3FFCA 2YMOA 2DBLH 2V6HA 3RWGB 2ZWSA 1OB0A 2E9JA 3BGFC 1I8MA 3L5WA 3LH2H 4JRXA 4B3VA 5EV7A 4DEPC 5IESH 5DLLA 4UAHA 4JY6A 1MWAL 1LXMA 2VQUA 2NW2A 4DUVA 2P7TB 4Y5YA 2B1HL 3REWA 4I3RL 1X7TA 3RVUC 4PRBA 3QULB 5DK2A 1MIEH 4BFNA 5DEJA 4RRPM 5AOJA 3CXDH 2H2SC 4E36A 5DJDB 4FYTA 5CEYA 3VNZA 4N8PA 1DQDL 3NFSL 3ARFA 5CR1A 3HUJF 1JK8A 2CUAA 4AM0Q 1X4YA 4UF7C 4C57C 1HN1A 2AI0H 3B37A 2ZSVA 5E9DD 3R06A 1G9NC 4PJ5A 2EICA 4MS8D 3KGTA 3ZSTA 5IZ7A 4WEUD 2W7ZA 1RJYB 1A25A 4PJXF 4WDIA 3U6XA 4PYHA 2H8PB 5DMJB 4K5OA 3HE6D 1OSZB 2BNRD 4ODWA 3EQOA 4O9HL 4XN1A 1AZBA 2GJZA 3EOBA 3K2IA 1N5YH 3BVXA 2QPFA 1GJWA 4XVSL 4R7XA 2GEEA 4PJCA 2AERT 2QMKA 3CVHA 5BUPA 1FIEA 2NYKA 1MHPH 1ZOXA 5B39G 2IADB 2ZXEB 3RU8H 1HIMH 4DN4H 5MI0C 1GYCA 3NPSC 1U3ZA 4A2DA 3PV7A 4LEEA 4U0RB 3HC3H 1OCOB 3JV6A 4XVJL 4FFWC 3QPQC 2WPGA 4OLWH 4L0YA 5FOBA 1CS6A 1J8HE 1XH3B 3VXRD 2HT2D 3LZQA 4G1EA 4PJ7E 1YYLH 1AGCA 1ORSB 3N9GH 4PR5A 3VFVB 2D7PA 5GSVA 4AMKL 1CN4A 7FABL 1NAKL 4KY2A 4GG8B 2UZIH 2O93L 1UB6A 5DVMA 5KYXB 2JSFA 1CVSC 1DBBH 1HCYA 1KGXA 1X5XA 5EEZA 3I02A 4CSZA 1GW6A 2M2DA 1N10A 1JI1A 5TPWH 1AZZC 5IROC 4LVHC 4NHUA 1L5GB 3RDTA 2YEVB 3D69A 1AS8A 3VU2A 1U42A 4Y16A 4YFDB 2PYEA 3SE3C 2ENSA 4K5LA 4MA1C 2JB5H 3GFUA 3S8WA 1P4LB 1H5BA 3F2LA 1X4XA 3T0ED 3PABB 4W9FC 2VMDA 3HI5H 2HRPH 3KNBA 4MSWB 3TPUA 2MTAA 1LLZA 1XCQB 4YZFE 4L8SC 3G6JB 5EEVA 4L3FA 1G87A 3AT0A 1CLYH 1ESOA 3Q0HA 4IEFA 5D1ZD 3CH1B 4B5EA 5BMFL 4N2KA 2AJYL 2R15A 3N1QC 4FE9A 4QKXB 5EO0B 4GO8A 5FA3A 2IEPA 2XWCA 1BQUA 2APBA 1QNIA 1S7SA 5T1KA 3WNLA 2R1XA 5CP7A 4PLNC 3H42H 1F13A 5E95B 4IOSA 3SKMB 1ZGLP 2FEJA 3FU6A 1O6VA 2NNRA 3I75A 4NQCE 1THAA 1WAAA 3MOAL 1ZKAA 3SBRA 2DYPD 2CJTA 2DQTL 4L3CB 1N5AA 15C8L 2BJML 2OR9H 4K8RL 1L4IA 3A6CH 4QR7A 4TUKL 4WI7A 1E2WA 4XNUH 5FV1L 3UZEA 1XGRB 5DJ2B 3K4AA 1HHHB 5HTSA 1BVKB 1NLDL 3C5JB 3GSUA 3OKEA 4G1MA 4JMNA 4KFMA 4R5XA 5B8CC 1RZFL 5F7KC 5HHOE 1JSYA 1NC2A 4FA6A 3EG9A 2J2ZB 4KVNL 3DYPA 5DEGB 3S4SB 3VACA 4OKVB 1KBGL 4ZUWB 1MKFA 4AEHH 4QXUL 3UAEA 4OFVA 1DUYB 3VGBA 3O3EA 3MRGA 4QNPE 4KK9C 2P49B 5F89A 2Y22A 1M2VB 3FF7A 3GC3A 3Q5OA 4ZMYA 2A6DA 2DTML 4OAWB 5C7ZA 3VI3B 4LASL 4HKZA 4L2LA 1KCRL 1X5IA 5D2NB 2OSLB 3OXSA 4JG5A 2D03H 3TIEB 5HD8C 2I9TA 5CN2A 1VFAB 3RZCD 3MJ7B 1JRHL 2JELH 3FB5B 1PD6A 3VFUB 4GKZB 4N9GB 5IMKA 5CBEA 4KO9A 4ZUUA 2QY1A 2BVTA 1G6RH 3SDDC 2I32A 2WWOA 3HC0B 4NZUL 4XHJC 4XNZB 5L8JB 5HDBE 4UOZA 5D96C 4BZ2H 4X6DB 2BOBA 1I3GH 2GTQA 2QMJA 4MAUL 4PGZA 4OM0H 5DRZA 3V6BR 4RSVA 5ES4B 4NZRL 1NFDA 1NIDA 2YGOA 4K2UH 3E6HA 3VYOA 4GBXB 1A7QL 3KE0A 5AOMA 3MZTA 3M88A 1UKTA 5C07E 1S7VB 3RL2A 3FAXA 3P11H 4PWIA 5D4HA 4G83A 3QCVL 4E41D 1XGQB 5D1ZC 3MLZH 3WXWL 3BQVA 2G3MA 1I8MB 1TNNA 1EAJA 3EGXB 4B9GA 4PIRF 3GMRA 4TNFA 4XWGH 3SE8H 3KGSA 3BQUB 2FBJH 3SPVB 2H26A 4AM0B 5G4NA 5DRNA 3V6OC 3F05A 4M1DH 4YXHH 2I25N 3C09B 4WKZB 3ZE1F 3BD4A 5BVPL 5EC1B 3PHAA 1PZAA 1S7RB 1F00I 1NL0L 1TCRA 4OCRL 2VR7A 4OTXH 5DFTA 5C0EA 5I71C 1EXGA 1RURL 2BFVL 1A0QH 4NZJA 3N0PB 1YA5A 2XFXA 1F1AA 5BRQA 4K9EC 4M8VA 5GGSY 6CGTA 3ME0A 3QA3B 1A9BA 1NFIB 1PGRB 1JK8B 1U6AL 3PWVB 3S48A 3OXRA 5CINL 1MXDA 1U8LB 1W9XA 2I69A 2AQPA 2VXVL 2VDLB 4EZMA 3UTQB 5KAQG 4IBWA 1SRDA 2IXQA 4DO5A 3DUHA 3AY2A 3MV9E 2VZ3A 2CDFB 4U6YB 2DI7A 3AWFA 2YWZA 2G3ZA 3ARGA 4JO4L 2E8ZA 5HVWA 2Q10A 2K6YA 2ADGA 4LKCB 4RGOL 2AEWA 4PAZA 2Y7MA 2R29A 1YNKL 2GJZB 3BN9D 1WIUA 3OM3B 3ZRFC 1A7NH 4BA0A 1ZA6A 1PLGH 3QIWC 4TUJA 3O2WL 4QO1B 3EXJA 1KG0A 1T03L 4WCYL 4YXKL 2HPTA 1N8ZA 1T20A 1JHTB 2CO2A 2XVBA 1RUQL 4JM4H 3MCYA 3P0VH 4UDUA 5KBDA 4ZS6D 3U2IA 4KXBA 5DHDA 3VXNA 3KYMB 3W0WA 2NXZD 3AADB 3U4EB 1P7HL 4LPWA 3TWYA 5D2NE 5IW6B 1DJSA 3U30B 2YMTA 4X8JB 5I71B 1OCWL 3UO8B 3LD8B 2OXHA 4EEEA 3CNKA 4QPEA 1E5BA 5BXFA 4I1PA 2LW3A 1I7UA 1SGKA 4BHUA 5H35A 4OZHB 1JL8A 3KPRA 3NZHL 2WXFA 2XKUA 3NJGA 1I7TB 3MRNB 4C54A 4XZUA 5E6ID 4G7QB 3HG3A 4NHUB 2HWZH 1AJ7H 5JHLH 1WUNT 1IBFA 3GB7B 5EUOB 4B7IA 1E2VA 4DWHA 3BZ5A 3DX1A 4N1EA 4XPFH 1H5BB 5D6CA 4L37A 4GKNB 1F3RB 1MHPL 3DHUA 2UV3A 1NWOA 2PO6B 3U1SL 4E9XA 4JGJA 4ECNA 4DZBA 4DF9A 5FYKU 3SZEA 1AQKL 2YD9A 4DPBX 4IS6A 2HVBA 4RAUB 4Q0XH 3LKQA 3DI3B 4LKXB 3GXNA 4X5RA 2VH5L 5CP7B 3V4PB 4JPQA 3DA0A 1ZK9A 4OCNC 1PSKH 2FWOB 4Y2NA 7TAAA 3VXOB 1LP9A 1BW8A 4UT6H 1SYVA 3BW9A 3C8KB 1PYWA 3ZE1E 3EOYG 3PUUA 4KPHL 5FXCH 4JM2F 2OZ4L 1XGRA 2ZXGA 3ZHKA 3MBEB 4PJFA 2WINA 5F7DA 1SEBA 2NNXA 1WGOA 3FQNB 3NA4A 4HS8H 1MQKH 5FKPA 2NTFB 3N42B 2R8SH 1BF2A 4YLCA 5IHZA 4TTDC 3THMH 4ZMLA 3IGKA 1T0PB 2IQ7A 3VSTA 3L8QA 5FOJA 4TTGA 2RB8A 1CFVL 2J2ZA 3QGVA 5C6WH 4WFGD 4NYLA 4F80A 1E3ZA 3HAEA 4ZX4A 2QGDA 1J0JA 3SKNA 1DUYA 3H1ZA 1EDHA 4Q6IB 5F7LB 5E24E 4XCEA 3RURA 1JZ7A 5F89B 4LCYA 2ZX5A 4ONFH 1RHHB 1OP4A 1TO4A 1UWXK 2NDFA 2VXQH 2AXFA 1MQ8A 2GUYA 3I6KA 3OKLB 4HKZB 1EFXA 3QEUA 4PBWD 4J3WA 1WO2A 2KDGA 3P30L 4ZODA 2CM6A 2VAAA 5EO9A 3FFCD 1NC4B 3RZWA 4F33A 2YIHA 4F8QA 4XP1H 1UD3A 3MV01 2V8MA 4YBLC 4AC2A 5EWIH 2NY6D 2IBZY 2OJ1A 4ZYKB 4BH7A 5C0NC 3H7BA 3TV3H 1A9VA 2J20A 3TO2A 4HEMA 3NJMA 4L4TE 2F61A 4HUUB 4P2YA 1KN2L 4BFFA 3ATBA 2ETWA 5KS9B 1B6UA 2BINA 1BYPA 3NT0A 4OZHE 1MFNA 5AB0A 4BCYA 1PG7L 1IBYA 4FI6A 3DX2A 1Q4NX 4N6RA 2IBGA 3IWVA 3WGVB 4G7VL 3QJXA 3TS8A 1MLCB 2ARJQ 1V7NL 1YPZF 3MRJA 4ZW8A 4YVNA 3VGFA 2ODLA 1CFQA 1VZGA 2VOTA 4KRMB 1OSPL 1O8EA 1E28A 3B9KD 4F7KA 1TJGL 4R2GC 3KL3A 4XMTA 1OB1A 3BGFB 4G6FD 1NMAL 1SBBA 2WXRA 3UAJD 3A4AA 3JWDC 2D03L 4MTMA 1F4XL 2EDQA 4FYRA 3DOSB 4JKPL 2EKJA 4KMTL 1TJMA 3SQVA 1FSKB 5SWSE 2X1OA 1FL5A 2MCPH 1YG9A 1Q1PA 4UB0L 1WAEA 3D2UB 1BD2A 1U8IB 2X6WA 4YIQA 1IUZA 4OJFL 3ME0B 3QA3A 5J6GB 4JFPA 3LPOA 1FNEB 3PWLA 1MRCH 3LN9A 3O41A 2EIEA 2P5WD 1Q0XL 4HT1H 3AQZA 2VDKB 4LMQI 5KSAC 1U8CA 4ODSH 3UTQA 2D9QB 4GRWH 4JFXA 3LEXA 4YVUA 3S7GA 3H7LA 1CF8L 1JCVA 4IJ3B 4XOPA 3ARGB 1SY6L 5I1LA 1JYXA 4HVBA 4GXVH 2ADGB 4IRSD 1F3DJ 4LKCA 1U3JA 4JPIB 1LEIA 2A9AA 2IALB 3O2DH 2DL2A 4I85A 4PGCB 4ETQA 1KN4H 1NCNA 1G6VK 1ZA6B 1G9EA 1T6VN 1S7WB 2OYPA 4MBRA 5E99H 5EBMA 4XMKL 2BNUB 1WTGT 5LG1A 2VDQL 1BEXA 4AYFA 3ZMRA 1IX2A 1RZPA 2IWKA 1BFVL 2J7LA 2RCSL 2QGEA 1G9NL 3AQXA 4L1TA 1AQMA 5E8OA 1OP5K 4E9LA 5GZOA 1BCIA 2DH2A 2X4OB 3DRQB 2JVUA 3T2PA 3OF6D 5IW6A 3X3FH 1EE6A 2WXIA 3TO4A 2GI7A 1Q9KB 2I5YH 4LPXA 5AKSA 4QWWC 5KW9H 3GEWB 2FNBA 3MRHB 2OXHB 1L9RA 1MJ8L 3MROB 5FM5M 4BYHA 4M6OH 2UY6A 1RK0A 5T1KD 2KI6A 3MGAA 3OKNA 1G7QA 4JGUA 5DC4B 1OM9A 4I0PC 2NW2B 4YPGB 4RDBA 2XACC 1WD8A 4X7CC 1PW3A 4XMZA 4PRBB 3VVWA 4N0UB 4FKKA 3L3OB 4LLAA 4OPWA 5EUOA 2P9RA 4NM4L 3HG4A 3MLPA 3CXFA 5IB1A 4XNDA 3S9DB 5J9PA 5IB2B 4KI5D 5DJDA 1U3HC 1VFBB 1FE8L 1L9SA 1CDCA 1WBZB 1XCWA 1XIWD 1XL6A 3BUDA 3KHOA 3PDDA 3ARFB 5L2KE 3HG1D 5LN8A 1PEWA 5CKGA 5FF6A 5HDLA 1FZKB 2O26U 4PSPA 1TQSA 3R06B 4FN0A 3MVSA 2CGYA 3KAAA 4E41E 4OIFA 1ZSDB 3FQTA 4GSRA 3ABKB 1CICD 3P9WB 4ZUSA 1ILUA 3LJYA 4GBXD 5SWQB 3OMNB 4LKXA 1MAJA 3SYJA 3QI9C 5H8DA 1NIFA 3EO1B 2WXHA 3H56A 2X2YA 1ZT7B 3SE4A 4DTGH 1J05B 2R56L 1F42A 4IIQB 2XETA 3ECVA 4TNVF 3JVGC 5A2IH 1U41A 1A1OA 2XWRA 4QRPA 1ASPA 1J86A 2KT6A 2V9UA 2H0EA 4PJDB 1JPSL 3WTTA 1BZOA 4L0PB 2NXZB 3SHSA 2MQCA 2D0HA 5DU7A 4NCC2 1G43A 4ODVH 5FYKD 4DAGL 1FYTB 2HN7B 2QVMA 4X4ME 3IGAB 1ID5I 3WYRA 2N4IA 4BWUA 4QHNB 5C70A 4LOUD 3BO8B 4NQEB 4I9WD 3LNFA 5KVFH 3MLSH 2ENQA 5L9DH 1UB6B 3QR2A 2X70A 4I77H 3CFEB 3K6OA 4Q6IA 1TU2B 4UTCA 5TE4L 1KB5A 1L3WA 2AHIA 1FGVL 5J6SA 3ARDA 3DVNB 1PSKL 3OGCA 3AC0A 2Y24A 4EBQL 5JMOC 4JDTL 1NC4A 2YBRB 2NR6D 2G3XA 3Q3GB 5JDJA 1TJHH 4AEIH 3D50A 1P9MC 5I23A 4QDGA 3Q7JA 1JDAA 4U1JA 4HUUA 1OE3A 5JLZB 1L7IL 4AWJC 4WUUA 5C09B 2DQDH 4XT1C 1ZHLB 2ICWB 5EOTB 1TO5A 3V6OA 3VFTB 5DRWA 4TQ8A 2PYED 1JZEA 2BRRH 4GKSB 3FTGA 3GSOB 4XCNB 3SZKC 3SKMA 5I24A 3D9AH 1TNMA 3C12A 1QPKA 3NP4A 5E6IA 5DO2C 5JUEH 1KGIA 1BXVA 5DZVA 3E8VA 12E8L 1CFQB 3PGFH 4UAOB 4O5LH 4KROD 2NTPA 3ARED 4ONFL 3W39B 3DMMA 1SJMA 2GQHA 5J06A 1ZSHA 5T3XH 2ICEB 1BMWA 3AQDA 2WKLA 1UEYA 3N0AA 4LDLB 3HNSH 3GSUB 3OKEB 4G3YH 4G1MB 3W11D 1Z9PA 1QWNA 4LQ1A 1EH9A 4XBEL 4WY7L 4YSCA 5LQBL 4FOMA 5D7HA 4PV1C 4AK1A 5DJZB 3KWXA 1UYWL 3SE3A 1BQHA 2WIIA 5AMVA 4NK8A 4IDJL 1UUNA 1KGCD 2QQLL 4N2EA 1KXHA 4YNYB 4TSCL 3IAQA 4M48H 2BSSA 4PBVC 2HMID 1LO5B 4OQTH 2VCOA 1M7XA 3D5OF 4G7VH 1ZHNB 2B14A 3HG5A 1H6TA 2INUA 2B3IA 2Z31C 3VXSD 5CEZE 3SDXE 1R19A 2X1XR 1WK0A 3MJ7A 3TXAA 1OAZL 2EH7L 2AJUL 1EEYB 3U36B 1ZANL 5DUBB 3GPSA 5FLUA 5C08E 1T83C 3NDYE 3HS0C 3GMNB 3S34L 3Q01A 2JIXD 5JHDD 3PXHA 3FT4B 3L4XA 4KMLB 3HZVA 3VGHA 4TOYH 5IVNA 4KMTH 1QFWM 4AE1A 2PPEA 1AO7E 4LCCA 1CI3M 5LAXB 4OF6A 3D51A 1AC0A 4K7FA 3WIIL 3K6SA 4V1DB 5BV7B 3GWJA 4JO1L 1FIGL 4HQQH 3U79A 1U8QA 2A74B 3LDBB 1UURA 5DD1H 4YR6A 1Q0XH 3TBSB 1X5FA 1QLEH 1GJUA 2VB5A 2VJJA 1UWYA 3BZFA 3JT0A 4MJJA 4DJMA 4OCYL 4C4BA 1DBKL 3EFDL 1HZKA 4PJ9C 3S5LA 4N2IA 4MQXC 5KAQF 4FTDA 3B56A 1NJ9B 5ADOL 5DRNB 4YBQC 1H3GA 2QV2A 2UWEE 1LK2A 2JTYA 3LXBA 5HXMA 4RSYA 5CHNB 2XTJD 1T7ZA 2YO3A 1VKXB 3QEQD 4N4YB 3SIKA 2HTKD 5IB2A 2P52A 1MREH 1OE1A 4G70B 3BUYB 4C8XA 1RPUA 2EEDA 2GJ6D 5AVWB 2B5IC 1A9BB 4WI6A 3AU0A 2MMXA 2BVQA 4OFKA 2DH3A 1G9NH 1I3RA 4R90H 4JFFA 4NIKB 1H3WM 3NJIA 4KK6C 4G42A 4ZUTA 2EC9T 3ARVA 1HS6A 3TV8A 1GAFL 3VFPB 1LWJA 4CADA 3NVQA 3GJFB 5FUOH 2YFNA 2R1WA 4UT9L 5DURD 4M6OL 2ZCKH 1ZT7A 2GY7B 2W80C 3R1GL 4FL4B 5I16A 1EO8H 2YQ3A 2Z3FA 2UZXA 4JAMB 2FIRT 4Y1AA 3GBEA 5T1MB 1Y18B 3U4AA 1RZ7L 4MVBC 1UM4L 1WFTA 3ZIMA 4NNPH 1DVFD 2X0WA 4Z7VF 1WH0A 5DZNA 4KK8C 1XMEB 1GHFL 1U8OA 4HGWA 2N7SA 4XCFH 4GH7B 5ANHA 3LYCA 2Q6WA 2X1QA 1V54B 4BUHA 3TPKA 4LLDA 3KPSE 3F12A 5BS0A 1TZHA 1IAMA 3L4ZA 2VO5A 3OD3A 5IQMA 1M7IA 5CZXC 2QVKA 2EEXA 3H6JA 4X8JA 4QY8B 5KUKA 2ZUTA 4Y2LA 4ZAKA 3SQBB 2JQMA 4P3CL 3INOA 2OW6A 4WTZA 3CZFB 2EDLA 1X9QA 4FQPA 4P9HL 4JFVA 5EU7C 4XN7A 5H35B 4CA4A 2OJZL 5C3TA 4NUJB 5HY9A 3WI9A 5AVUB 3CFDA 4ISVA 3WIFA 2NSPA 4PJBE 4XZUB 1BG9A 4ODXB 1YN7A 3IE9A 3L3HA 3MJ9A 4XWOD 5E9DB 1J9CT 3MO1B 3OGCB 4M7KL 2C1OB 1OGTB 4KDTA 4N2FA 2ADJA 3TBTA 4YMPA 4D0BA 2XBTA 3UAJA 4YGVB 5EEYA 3RE0A 1F6FB 1RP8A 4KBPA 3T0WA 5MEQA 1MIEL 2A6JB 3S88L 1QCXA 2HT4D 1A5FH 3MCKA 5HGGS 3D39D 4P57A 2BOLA 2WLHA 3ATDA 3JUZA 2YKLH 4CN4A 4NC2B 1W16A 2QHRH 4JQXC 5IQ7H 1UQSA 2BZCA 5C9JB 1JAEA 1ZPUA 1E42A 3LKSA 1LEKA 3MSPA 5TDPB 5F0PB 5C3IA 3HLKA 2WZ0A 3NIGF 2IIJA 5I75C 1JXKA 1CFBA 4LFHG 4Z78B 4KKBD 3QAQA 1ZPLA 1MCNA 5I1JL 1WBYA 3T5WA 5I8CA 5CSZB 2I60H 3N90A 3L4UA 3FT3A 4ODTH 4PJHE 4U31A 4XC3H 4HP5A 4XVSH 5DYOB 4EBQH 2KBGA 1Q38A 5FKPB 5F3BA 4XC1L 4OBRA 5JDSA 3GBLA 4Y4HA 2Y1YA 1TJHL 3GMOB 2C3VB 4FI7A 2EKSB 3WKMH 5T3XE 4LLVA 4UM9D 3KYNA 1DQMH 4CUCA 4PJXA 2PW2A 4HW6A 1YEJH 3MUGB 4OZIF 2YAOA 3HC3L 4GYBA 2Y7OA 1A6TB 1RZKC 3D25A 3BLBA 3HHMA 4XNYL 5IBTH 5BRZB 2YAQA 4MAYC 4JJ5A 5HGAA 4L05A 5GGRA 2B4CL 3DV6B 3F84A 3B2UD 3B2XA 2XRAL 5HDBB 2DIAA 2L8AA 4GUPB 4J7RA 3WNJA 4P5RA 1WRFA 3CG8A 3MQIA 3V8OA 5B38A 1O6TA 2CM5A 1R3LA 3QIBD 1TQUA 4ICWA 5J1AB 3GMNA 3VRLF 4Z7UB 5KYUB 5F7EH 3TO2B 1CZ8H 2W95A 3NIGE 2CALA 4MDRA 3QYNA 3EDKA 3MRRB 2X0UA 3FSOA 4KKCD 3W37A 5JW4N 3ZE2F 4XBEH 4N85A 2ERJB 3F7LA 1E4HA 4NUPA 5D2LA 1CYXA 1D7FA 4TQHA 2TAAA 1ETA1 4LCVA 4W9IC 5I8OL 1S9YA 4PP1C 2QFPA 4QCIA 2EVFA 1AHKA 4HIQA 3VWJC 3KYOA 4MHHG 1J88A 4IGBD 3SDAC 1S78C 4TSCH 3S37L 3TU6A 4X4YA 2YS4A 5CFHA 9CGTA 3EYFA 1E28B 3ML3A 4GQRA 4X6BB 3O2VL 1JBJA 1QRNB 5DA4A 1VEPA 1SVBA 4JRYE 1EEUA 2XZAH 2EXWC 2GIMA 2XY2A 3VA6A 4RGMC 3ZN6A 5TH2B 5ETUB 2ZOLB 4YHOL 4G11A 1KTRL 2K7QA 5A2BA 3DX8A 3HPLA 1HL9A 4FULA 4NS0A 4G43A 4P9ML 1RFDH 3RWIB 1NLDH 1NCDL 3O4LD 3S96B 3TFBA 5DQ9A 5J6GA 1X7QA 3H54A 4LL1A 1OP3H 1G7HB 3QR0A 4B53A 4MMYB 4Z7OF 1KIRB 1V3MA 1I3RB 1ACXA 3VFOA 1COBA 5D93C 3IAGC 3CFBA 1BFSA 3TZVB 3DTUB 4LEXL 1JE6A 3CFJA 1OK0A 4ZUTB 3REVA 3LEXB 4PJHB 3MXWH 2IOIA 5E8DL 5IHBA 3FU7B 2Y4SA 4ABVA 5F96H 3HRZB 2VDPB 2XSKA 5IW1B 1MWAH 5DFVC 5DI8B 5KANG 1D9KC 3BD3A 2DJMA 2CA4A 4JFOB 4HKJA 2CKBA 3K71A 4KTEL 1RI8A 1UA3A 5I8EA 4OD1L 1OEZW 3EJJX 4CU7A 1FGNL 4TRPH 1A3ZA 4PBDA 3IJ9A 4EUPG 4AZ8B 2V2WA 2ZSWA 5EZJB 1BQLL 3ZKNC 1A6PA 2ESVA 1HL8A 3LPGA 2WO3B 3EBIA 3GKZA 4Z7UF 1GYVA 5JMCB 2H0JA 1KGYE 1PD1A 3GSWA 5GRZA 3TO4B 2BWQA 1U8HB 2M83A 1SJEB 2RHEA 1RZKH 3TCTA 1INEH 1MW0A 4FQLL 4M61B 4X6DF 3UP6A 2W94A 3QDMB 4TSBH 1FNGB 3HKZA 3ZR5A 3C60D 2MPAL 3JWNE 5T1JA 1A2YA 3CFQA 3MFFA 2V7HA 1MUJA 2YZ8A 5I1HL 3RKDC 4R4NC 4I3SH 1ND0B 4PSRA 5EH1A 3TASA 1PY9A 3TESA 3WEOA 1HL4A 4XN8A 5C09E 3TBYA 5B3JF 3NJHA 2NXYC 1KDJA 4ERSL 1NEPA 2CSPA 3IPFA 1OGTA 1PAMA 5F3FA 5EF0A 5IB1B 3FN9A 3RL1A 4EO5A 4I88A 4FDWA 1OAUH 3GS0A 1U8NB 4HUWA 4R4BA 3MNWA 4OD3H 4HK0A 1KELH 4YSAA 1NL0H 2GJ6B 1R24B 1KFAH 1A0QL 2UZYA 2XZCL 4KK5D 3ZYZA 5T5FH 4OJYA 2HMIC 4OCMC 2WZAA 3FQTB 1E9PB 3QJFA 5F7BA 5EC2A 1KTKE 2VNCA 5GS2D 1FVEA 4PJ6A 2ITCB 3D0VB 1NAKH 3EO1A 2JKLA 3F7YB 4AUYA 2YAHA 1ZVSB 4ENEC 1Y0LB 1QI4A 4Z78A 1KXQA 3UO1H 2J8UA 2K3HA 1AZVA 3K0WA 4R0LB 3AXHA 5AYQA 1XF5A 2ZX9A 4RGND 3FU9A 3JV4B 5E4OA 5AAMC 2WJ5A 1TENA 4GO6B 3IKKA 4R7DA 2MSPA 4U1HA 3QQDB 1AS6A 1NCOA 1FYTA 3NCBB 4KO7A 4PY8I 3T0AA 3UPRB 3KWWB 4W9DC 3V4UL 1MFDH 4QHNA 3BAJA 5EO1B 2WB7A 3KYNB 3S88H 1QBLL 1T80A 5TE6H 4H44C 4NQEA 1KTBA 1GRWA 1A5FL 2YJLA 4LVEA 4MXWL 4LEOA 5E08L 1XGPA 2DRUA 2IPUK 4O00A 4UV7H 5CZXD 5C8JA 4JJ5B 2C3WA 3FL7A 4S1DD 1J1PH 1KCUH 1FPTH 5GGRB 1FFRA 2AVFA 2OMXA 1L0QA 1M05A 2DZEA 5FDWB 1N26A 3EYUL 4HU8A 4M3HA 1JGEB 3UTTE 1RPKA 2HTLC 1HILA 4JFDD 2YEQA 1XXDC 1IE5A 1OGAA 3RX7A 4YSOA 3UTPD 2O0WA 1G7IA 4S2SB 4KKLC 1KBKA 4HIJA 1KPUB 5HVFB 1RH8A 2HWZL 3T8XA 1JMXA 2CR0A 3V8CA 2EINB 1JNNL 5T3ZL 4PJ9A 4PLOB 3VB8A 2NY4C 2FX8L 5F1IA 1NBYA 1KQ5A 2HH0H 4APQB 1QVOA 3AS2A 5EOTA 3D3VE 3BVWA 4WNQB 4BM7A 1I9IH 4RH4A 4UINH 4KVNH 1G4MA 1SFHA 4KX8A 1M6OB 3GSOA 4XCNA 4EDXB 3QUYD 2WVVB 4XNYH 5FYJH 4B6ZA 4TVPL 4Z3GA 2A77L 4U2ZA 4XX1E 2XWTB 4QOKD 3NFNA 5JOPE 3FU3A 3GHPA 2YA0A 1J1OH 5EU3A 2DTMH 1LWRA 3EZ8A 2K70A 2ZX7A 2DS4A 2UVFA 4S1RH 2ADFH 3ECWA 1EZGA 2QHLA 3GS7A 1M7UA 4NOFA 4AGNA 1PKQE 4LIQH 3VMNA 3D48R 4I9WE 2IANA 4NUQA 4QRQA 1HI6A 1O8FA 2WQAA 2X6UA 3QXDA 3UG4A 2ED7A 4EJ1C 4ACPA 2R39A 4PTUB 1K4ZA 2X3CA 3BXNB 1EUTA 1XV8A 4MA8H 3ULVD 2FLBT 3TT1L 3O81A 2UUDK 1O5PA 1I75A 2EDFA 1CFVH 1P9MA 3O9WB 4MCYB 1DANT 4G8FA 1U91B 1OANA 4TL5A 3VMWA 1FRGL 1NIBA 1ZLUH 2HAZA 5CGYC 1U8PA 3L4TA 3RB7A 5BJTA 3O6LL 4XE0A 4LQFL 4GBXC 1EEYA 3CXHJ 3OC8A 3U36A 5JPNB 2Y5TB 4PGJA 5IW1A 3O2VH 1MFUA 3OAYH 5HDWA 1X5YA 4LF3A 2GCYA 3NCWA 4WQOA 5AG9A 5ID0A 3HZVB 4Q56A 1F3DH 3PV6A 4YC2C 3G08A 4DN3L 1Q1JL 1JCKA 5IF0A 5LAXA 2P4AB 3KJ4B 2KLTA 2G4EA 2PWEA 2W81C 4K3JL 2HT2C 4IRSA 3TNNA 3KPLB 2BFVH 5EWIL 1V7MH 3MV7A 4JX0A 1AG6A 2YEZA 4I89A 2EYTB 1IGTB 3TV3L 2ESVB 4HPHA 1TZOA 1U8QB 1BF8A 3NEEA 4B41A 3MDJA 4YLBA 1QHPA 2QELA 3W1ZA 1U8HA 2VXVH 4ES8A 4P5KB 2DM3A 3QDMA 2P5WA 3GSXA 4L29A 1AD0A 2F54D 3QO1A 2GG1A 3SODB 3SY0A 4FQIL 1A4JB 5K69A 1A2YB 2K1MA 2KKQA 4YX2H 3MJ9H 2F18A 2UY7A 3EOTL 4PJAA 5CMAA 5BRPA 5KSUB 5KVMC 1JYNA 1FG2B 1M1XA 2AK1H 4A2GA 1YEGL 3FTWA 4Y5YC 2ZKHL 2Y1AA 4RAHA 1HOCA 1YEFH 1GSMA 2O30A 4UTAH 5HYQA 3BUYA 1EAQA 4GAAA 2FH6A 2AEPH 3ZR6A 1HT6A 1M1SA 1NQBA 4OV5B 4N8CL 1OF2B 5JPNC 1O8IA 1INDL 2K6ZA 2NY6C 1UCBH 3QW9A 3DMMD 4JG0L 3MRBB 1N9PA 2BNRB 1E5YA 5DSCA 4AMXA 5PCYA 5DT1H 1XGZA 1MHEA 1XQ4A 4ZTOL 2DMGA 4JZNB 3IJHA 1KLGA 2A38A 4QHPA 4NP9A 4YC2B 1CICA 2X6AA 2K0RA 4HPYL 1DQQB 4WLCA 5G55A 3ZL1A 4NENA 3GJFA 4U49A 3KYAA 4L0ZA 2XXGA 5AKTA 1G9ML 3MRMA 2DMCA 3SYQA 5HJBA 1MY5A 5K1VA 1NUDA 4JKKA 5CCKH 3FB6A 1ZA3A 4CC4A 4WJ5A 1PLCA 2W8CA 2V3DA 5B7EA 2IAAC 4MAYA 3W57A 2CBQA 3BYYA 1F6LL 3U7AA 1MG3C 3S36H 1QQDB 5EBGA 4R2GD 2ENJA 3ZYIA 1EAOA 2CIIA 3WENA 2FO4A 4ZZFA 4X5QA 5E8PA 1PEZA 2WLYA 4HFWA 2VDRL 4QTIH 2X85A 5EU6B 5F44A 1MJUL 3U1SH 4JRXE 3KYKH 3ZZQA 1O9VA 1UT9A 4Z3IA 3TEYA 3FW6A 4ZFZB 1QSFE 3FO0H 5IIEA 1OM3H 1I9JH 3CAFA 3E6FA 4OZ4B 5HGDA 3RFRA 4K4KA 4U6XA 1H0DA 4ELMA 5C8JB 4XI5C 3BPLC 1Z9MA 3JWOL 5I1IH 3QEHA 1RU4A 2R69L 2ZX8A 3I2CH 4G9FB 4MRCA 2VBKA 4KXAA 2VUKA 4O02L 4OT1H 4XP9H 3SY6A 3VXSA 5HVHC 1XCTA 4F15C 4HSQA 4Y1SA 3B6SA 3CDZB 4CJ0A 5IBUG 3S5YA 5CD3B 1CGTA 4KHTH 4PH8A 4W9ZA 5BUGA 1XL4A 3RDTC 2Z31D 4GFTB 4LSDA 3MKGA 2F2HA 1THCA 3CBJB 3IEAA 1X9UA 5FPIA 1SLUA 3IAPA 2CDEB 3V2AR 1RULH 1JV2A 1BZEA 4V33A 5F1IB 5FWRA 4RMTA 3UYPB 4Y4KB 3PFUA 5LCVH 3U4BL 2Y7QB 4HXAL 4OCWL 2AGJH 3G6AB 1BZ8A 2D7MA 3S5LG 1XD0A 3V4UH 2Q0ZX 4MBOA 3ES6A 3G5VB 5E2VL 2WBJC 3W3BA 43CAA 5I5RA 1QBLH 3G6DL 1SVZA 4NQCB 4Y5XC 1CFTB 5DJYB 5GS3A 1HXYB 3P3SA 5EU7E 1K8IB 4N0YH 1PD0A 4A55A 2PABA 3DTXA 4H1LA 4POZD 2WTPA 4ENZA 3SPIA 1PZ2A 5BZZA 1MHCB 4FFZL 4AJWA 4X5WB 2XQYA 1CYGA 1QPXA 4OLXL 1H9DA 2EUWA 2WJ7A 1WBYB 4JHVA 4YOKA 5JLVC 5CSZA 1EHAA 3LN4B 4UIMB 1NWPA 2DI9A 4WI5A 5DD5H 3FS9A 1LJMA 3P4NA 4L3AA 3X17A 2LVCA 1N12A 3OHXC 4K8RC 5TF1L 5C2BH 3FPXA 1KDIA 3C6EA 4EN3B 1T0MB 4HCFA 1NCHA 2D31B 1HWWA 1IJ9A 4MB3A 4LLVB 3IMVA 2NQ3A 3CWGA 4PJXB 1JD7A 1NICA 5TGBB 4HMEA 3NRPA 3EXLA 4R3SB 2H0FA 4HCRL 3G5YA 4OGQC 5C0CA 3ULVL 1TTRA 4ONHA 4G8FB 1RMFH 1VPOH 5J5EA 3N44F 3WEBA 4AVIA 5KVFL 3KMDA 2BP0A 3RPBA 3TTSA 4E5XA 4QUOA 5A7EA 1P4BL 4UQ3A 2P8PB 4B9PA 2GYSA 1MFAH 3QI9D 1HXMB 3NIFB 4KRPD 5GSRB 2WNGA 1TEGA 1DVTA 3PAUA 3QXTA 5EPMB 2P5PA 4Z7UA 5KYUA 4G5AA 4UBDD 3EAKA 4PGDA 3MRRA 1EO7A 1QTSA 1W8NA 3VX1A 1YSOA 1RZ8B 3TNNB 3NYKA 1C16B 2L4OA 4XO9A 2DQGL 2K78A 3ZT6A 3CBRA 4DEPB 4WWKA 1XGTB 3C5ZA 4QJ4B 3C5ZD 1YAIA 4OUUB 4FEIA 2PPAA 2EP6A 3BVNA 1L7IH 1WUZA 5AVXB 5EN2A 1ZLWH 4JFDB 1CF1A 5IQ9A 4YO0B 3LSOB 1X4ZA 4NX0A 3ZL4L 1EEZB 2H9GA 1H8LA 4M7JH 2J6EH 3KVQA 3BESR 4I0PB 3TOPA 4X7SH 1BVLA 2V5YA 5FFGA 1LO2H 3K6DA 2P44B 4I13B 3ZZSA 4W1TA 4K3EH 1KTJA 2WYTA 4NKIH 4ZW3A 5ESQB 1I9RL 1QJVA 3O3AA 3P2TA 1UZ8B 2VDMB 3CHQA 3NFPB 4ANXA 3STLB 1MZYA 2GJRA 2GABA 4FLRA 1HH6B 5I6OA 5ITBH 3DX7A 2JFCA 4X7TA 3T4AA 2Y72A 4G71B 2L7EA 3R8QA 1K9TA 2F08A 2MHAB 2X6CA 1CXKA 1MCFA 3PXLA 4R7LA 1V27A 3DYOA 5I9QB 2B9AA 4ZO9A 2E9WA 4TUUA 3ZYJA 2IAND 5J0BA 5KW9L 4CDGC 3RVTC 5I1AB 2ATAA 2IF7A 1UACL 1EJOL 2P80D 3FU7A 2BVOA 4MNGA 5K9QG 2R2HA 4MWFA 2C34A 2ROXA 1FC2D 5GSVB 2I7SA 2WB1A 4KKZA 4WJ5B 2ZJSL 1JXJA 3MJ9L 1QA1A 4KRNA 4MAYB 4JDZA 3L7EA 5DEZA 3LXUX 3BWUF 1NCBL 5ERWA 1SMDA 5D1ZI 4FTVA 3QNXA 3N06B 5K1NA 3BAWA 4FFZA 4P2QE 3MA7B 4AMWA 4UT6A 3BUTA 1MVUA 3RDTB 4EE2A 2YR3A 1O8GA 4TOYL 3VD3A 5KSBF 3SDCC 4AMKH 1E5ZA 2O6EA 1UCBL 2ATKA 3HZMB 5M7QA 3P3UA 5DGQA 1H0DB 4OJ6A 4ELMB 4QRRA 3DJRA 4HOWA 3HMXL 2OA9A 3ILPA 5ANMA 5JXED 4XKVA 4U1KA 5TPWL 4QRPD 4GAGH 2NNFA 1Z9LA 1FO0B 5F93C 5A3IC 4H20H 1S7SB 5EIQA 5FFOA 2DQJL 3WCYA 4BSJA 4DTGL 3BEVB 5DHXB 1FZMB 4M4PA 4J3XA 4H5SA 4JY5H 3A4EA 1PJWA 2D9CA 3G04B 2HRPL 3WO4B 1HCVA 5JIQA 5DZPA 5MEPB 2Y6TE 2V37A 3MNWB 4XRCA 4PRHA 2MCAA 3V7AG 4YL9A 4TULH 1F1DA 2XI9A 2P26A 5CLWA 1MREL 3Q05A 2VL5B 1W15A 4FHJA 2W07A 1WJ3A 4KRPB 3C5JA 4UV4H 1XGUB 4U1SA 3VGAB 4W68A 1T2QH 3ML8A 1AIFA 1DQIA 3PAYA 4BQBA 4F7EB 4NWTH 4RETB 1ONQB 4X4KA 4Y2DA 1J8KA 3FONA 2F54E 2BDNH 1NC2B 1PKQB 2WBWB 2Y7SA 1JN6B 5E2UH 5C9KA 4L48A 4DQAA 1DDTA 2A1WH 1MFBL 4FNUA 4ALAL 5A2KH 4J6RH 1B2WH 4MD5A 3W11C 1VIWA 1IAKA 1XF4B 2CO3A 3DO4A 2QT6A 5CZVL 2F7IA 3R1GH 3B3BA 5EZPA 2WP3O 5E0FA 3FU0A 4L18A 1U4EA 1TJXA 4N5EC 3KWWA 1EHNA 2BH0A 1F4WL 2FX7H 3P9MB 1SYSA 3QFDB 4GOSA 3FBKA 2F53D 4J3OC 3B5HA 5CBEB 3LD8C 4UOJA 3F01A 4RISL 3FUDA 5I6KA 1CL7L 2Z9TA 1T21A 2AGJL 2DMHA 1IC0A 3O3UN 2EYRA 4LLMB 3ATAA 1HNGA 3C6SB 4WJKB 4QT5B 1IC4L 4NFBA 4OIAA 1K4CB 4PJEE 1ADWA 1ZIBA 4DGYH 3GUTB 2XN9D 1H6UA 3PQYE 4HCIA 4Z7QB 1UM6L 5GGTL 5IFJA 1AZUA 2DQUH 3BX7C 4P9HH 3U9WA 2VDQB 2C4FT 2HG5B 4LAQL 3V4LA 5DDHA 2EDBA 2UXGA 4LSVL 4EUPA 4RX4A 2Z35B 2Z1PA 4M3KB 4C4KO 3ERXA 4ZX3A 2H6OA 1IFGA 3X14A 1YQ2A 3I85A 1PBYA 3B7SA 4CKVX 5FEBA 1TVHB 3EO9L 3F7PC 3KPNA 4C83B 2DKUA 4APQA 3HMWL 4F37K 4NZRH 1HCFX 3APDA 3L1EA 4K55A 5CS7A 1T1YA 3R8BB 3QIBB 1AOHA 4NJ9H 4YZXA 2PYGA 2AEQL 2GBAA 3P11L 5GHWH 1NLBH 4FL4C 1A3LL 1M6OA 2W88A 1CLYL 2YMXL 3US1A 3GSQA 1DCEA 2WBJD 4YO0A 5ICZA 3LSOA 1I3VA 3LCYA 2XWTA 1C1EH 3UAAA 2IJ0C 3ILQC 4HHAA 1TETL 1OP9A 3JVGA 2AF2A 4K3DL 3VDAA 1U8LA 4UILH 2FBJL 4U1MA 2Z64C 1F90L 4PJ8A 1CE1H 5BRZD 4GIAA 3D33A 1P1VA 2VXQA 3GIVB 4M5YL 1OAZH 2EH7H 4HALA 3MRIB 2CRIA 1J11A 3UTOA 3WKQA 1KV3A 4QRQB 4TUKH 4EVNA 3UBXA 3DX9A 3D0LB 3MRDB 3NCMA 5JMRA 1RUAH 1H8OA 4PTUA 5LNGA 1AR1C 1Q9OA 3BXNA 5CD5C 3N40F 3DX7B 4FFYA 4X7TB 4BBWA 3MCG1 5FCSH 3UTSD 1P7QA 3WIIH 3LKPB 4JO1H 1BJMA 2WCGA 2Q86B 1DSWA 5C92A 5DRXA 5B1JC 4XN9A 2FJFB 5F9JA 1JPGB 1FZOB 4N1CA 2EXYD 4V2BA 4I84A 1MNUH 3NJFA 1HEHC 1SOQA 4OZIB 3K4ZA 4OCYH 4LGPB 3T65A 4GW1B 2FQDA 3BUBA 2BWDA 2GAZA 1ADQH 2GK2A 4Y2DD 3N42F 1F8TL 3ZLQC 4CU8A 1KXVC 1GJIA 1QW8A 4NI3A 4YXKH 5IMLA 3ULUL 3P0VL 4OZHA 4MXVF 3QUGA 4NQSA 4DP9X 1I9RH 2BHZA 4JY6B 3N04A 3EJYD 4PJGE 5HYEA 1T0OA 5IV2B 3V0AC 4WU7A 3GXPA 3MA7A 3BIBX 5B21A 1PMYA 1ZJAA 3ETBF 3FQXB 5J3HC 5DK2B 4ZX6A 5GGQH 1MCKA 4WO4A 3RWHB 3LPPA 3MOBH 2XG4B 1ZMYA 5JW5B 2DLTA 2DJSA 4KZ0A 2H1LM 2VKWA 3T3ME 4DKEL 2QQQA 3HUJE 1P69B 3O6FA 1Y1UA 5DK3A 2VFQA 5L4IA 4XCCL 5A16A 4XNMA 5D1XC 2XZQH 3O6KH 1A4AA 4UU9B 5FUOL 4W4OC 1HCZA 1H6EA 2BP8B 3NJLA 3ZIYA 4URKA 5JHLL 5D8JL 2H1PH 1U92A 4GJTB 4OLZL 3SD2A 3WE6A 4XLEA 3QIWB 1WISA 2EDKA 1DVSA 2Q20A 5CU5A 3L9EA 3EO0A 5KEZA 1O7DC 3DI2B 4MFHA 3PWJA 5AVTB 4HJ0D 4U1LB 4EIBA 4MXNA 3LS5L 5JIHA 2XZAL 5DD0H 1WA2X 2Q76B 3GSNB 3TNMB 1NCBH 3OJMB 3QUMA 1J5HA 4XRCB 1OF2A 1HQ4A 1B4LA 5EU6D 1XR9B 2V5IA 4HH8A 2BNRA 1AQKH 3KLAA 1MCPL 4GMSH 4MMZC 4GRMB 2DN7A 4NLHA 1KLGB 4J1UB 4PS4H 4X8CA 1H6FA 4RMWA 1N2RB 1DVYA 3I9GH 4ZSOE 1OTUC 3ZHNA 3DV4B 4HLZG 1W0VB 5DXWA 3D52A 2X5PA 2CLRB 5HHVH 5KBMA 5I15H 4M9OA 2DKSA 5I5MA 1FV1B 3PF2A 4RBPK 3WSQH 1YJDC 3SKNB 2CGRH 5KVEL 2KLRA 3LQZA 4PS3A 4DHLA 2XQYK 1PIFA 4NNXB 3DRTB 4Z7VB 3BPOB 5L8LB 3TCXA 2QVTA 2ZXBA 3THML 4HFWB 4QHKI 4EZKA 1OGSA 4Y16B 4P5TD 4KTEH 4PJBB 4TPRH 1JIBA 3QEGL 4TULL 1YO4A 3CPLB 3VFSA 4HUVB 3SGDI 2CAKA 5HGDB 3EF7A 4MSWA 3MI6A 4IHOB 5DJ0B 5K5YA 2YKLL 5I0ZA 1KYFA 1S46A 4P99A 4XCYA 1CXEA 4H25B 1JZ8A 5HHXL 2GY5A 3QDAA 1OV8A 3VXSB 4RFEA 2BDNL 4YE4H 5IFJB 5INCB 4Z23A 3VXRA 1TTCA 4PHXA 5T1KB 1QZ1A 4OUOA 5DDHB 4JM2D 4YN3A 2CR6A 3GHBH 1D6VL 2XXMB 2ZAHA 4AC4A 1NANH 2PKDA 4IRJD 4XNQB 1WZAA 2I60L 3LAFA 2BM6A 2VM9A 5BV7L 4KKCC 5HGHB 4F7PB 4K9JA 1GPOL 1KN2H 2YD2A 5EBLA 3QC5X 3KPNB 1HHIB 2H3NB 2QR0A 3OPZH 4ZOBA 2WXMA 1HHHA 2DTSA 2W0KA 3U25A 3BFWA 5FO9B 1DQML 1HEZB 2HG0A 2VXSL 2XZZA 4D0DB 2G4GA 1O6SA 3ORJA 1YEJL 4J3BA 1D2PA 2WZPA 1HXYA 4D3CH 2F5BL 1CL7H 3FRUB 4OFYD 4QRPE 4NP4H 5FS5A 3ZE2E 4OBSA 5FK9B 4OFQA 3B8YA 3BFQG 1NGZA 4AK2A 3FMGL 3TYFA 3MN8A 3DNKA 1UH2A 2IBZX 3FQRB 3LNHA 4K7PX 5C0AE 1KCLA 4GSDL 3N55A 3ARBA 2B39A 3QC6X 3QCUL 5D7KE 4NAQA 2HTKC 3P4NB 4JEGB 2PCPB 1G6RB 3P77A 3WU1A 3CDFA 2YAPA 5EZLB 2O0VA 3MR9B 3UO1L 2I9TB 4OF5A 2OZ4H 2WSKA 2QYUA 5CAYB 4HJEA 4ILDA 3JWNH 5CIPH 4QRSB 2CG9X 4HS8L 1XFPA 2OMWA 2HZHA 4R9HA 4ZAKC 4AGLA 2R8SL 4A2EA 3HMWH 5E4EC 5E6UB 4DP1X 4EIZC 5K9OA 3MLVL 3G5YB 5DS2A 1EXUA 1MFDL 1XIWB 4XPGH 4ANVA 2VW6A 4GIPD 2AEQH 3AREB 1CXIA 3C60C 4S11A 1K3IA 1NIEA 3U0TB 2VXUH 5IUCA 1DDHB 3NCJH 4QTHA 3RTQD 2GUOB 3S8FB 5A3ID 2UXFA 3IK2A 4L3EA 4L3ED 1OAXH 3BRFA 4WGVB 2IMNA 1KCUL 2MQ0A 1XGQA 4LHUG 3X13B 1REIA 4OJLA 1C08B 5F6IB 3T04D 3O6MH 3GO1H 4YDIH 1QFOA 3QUYB 2YPLE 1PKOA 1YC8A 4DP2X 5IVXF 4U1NB 1NGWA 3OAUH 4CBZA 2WWKO 1T22B 1QA9A 4HPOH 3T0VA 2C7UB 3BIKB 2D2CC 4XP1L 4ZO8A 2X40A 3QUXD 1Z9SB 2OTPA 3L3OA 3UPCA 1EGJH 1AD9A 1ZVNA 2RMNA 2XQBL 1BLIA 3L3GA 2BRQA 1Z3GH 4PY7A 4O2EA 1VFBA 1A1NB 1ACYL 1NC4D 1GMIA 3ZRCC 4M5SA 2DQIH 2AZUA 1S7XA 2B2XH 3QDMD 3T0BA 3VGGA 2R0LH 3P02A 2Y6SC 3KWUA 4P23C 1BN8A 3KCWA 2NX5E 4TVPH 3L2NA 1MDTA 1MNUL 3QDJE 3P4MA 4GT0A 3MJGX 1KENL 5DR5H 4HG4K 2APTA 2EJ1A 1JV5B 1GZHC 3DX6A 1P84J 4LPUA 5F96L 4MASA 5HBBA 3ULUH 2IG2L 2JNZA 2P24B 4FQXB 4S1RL 2D7OA 2C9UA 2GTZB 4RZKA 3X3GL 2DLFH 4DOHE 1AXSB 4S1SL 2X1WL 4WO0A 3KBHE 4M7ZB 1A1OB 3HVDA 2XA3A 1P5VA 4DVBB 1LGVA 5D7JD 3SDDA 4KO6A 4DKAA 3RVXD 4WFFE 3ARWA 4M8UA 1QUNA 4GAYA 5DMIL 4ZOEA 3SDXA 1ZK5A 3L2LA 4HS6B 5C0AB 2OZNA 4KZCA 4I7ZC 1UVQA 4RGNB 4D9LH 3EGDA 4ELKA 4KJWD 4ATTA 5C97A 1AZCA 5IESL 3HFML 4N22A 1QBAA 2H0PA 3F85A 1R3KB 2X6YA 3FJTA 3HZYB 3J2PA 3D07A 2PN5A 3WD5L 1CTMA 1NCCL 1R4XA 4OLEA 4B27A 1J9QA 1D5IL 1HU8A 1T5XA 3CFEA 3NABH 5ERWB 4ZO6A 4R8WH 3FY3A 3FQUA 4R97C 4IU3B 4ODVL 3T0EB 2BNQD 5CSBA 1JGUL 1MVUB 3ARDB 3DVNA 4ONOA 2BK8A 3E3QE 3OR6B 5FYKH 1N6QH 5T5NF 2SEBB 4DUWA 1VERA 2EO7A 5DD6A 3RKPA 4U1IA 2OXGA 4AT6A 4AIEA 1MIML 1WVZA 2EO9A 1CI5A 1CVRA 4X6CF 3QNYA 1UXWA 3IJSB 1RZJH 5E23A 4Y19A 1V3KA 3HR6A 2AJ3B 1KIPA 5CLTA 1SN2A 4H25A 2NR6A 2F53E 2HTLD 2EUVA 4PTTB 1E3FA 3PAVA 5K59E 2INVA 4GKSA 4PRPB 5KSAD 4YPJA 3RHWK 4OF3A 3CSTA 1FZMA 4FQIH 5JIKA 2CPCA 4FQCH 1SF5A 5KG9A 1YN6B 2G60L 4ZMAT 3BCDA 1QACA 3AXIA 4XNZC 3SDAA 2N0KA 5K9JH 1QYGH 4NN5B 5HYSG 2G5BB 1HHIA 2H3NA 3L1OH 4AH2A 3D6GA 4OLWL 2ZIDA 3RGVB 4HEPG 5A2LH 2AEPL 2VLJB 5FO8B 4TPRL 3II3A 3QJOA 5I66A 1F18A 4H7VA 3LVEA 2Q8AL 3VG9C 5AB2A 3AGVA 1ZY9A 1N59B 3MGOB 4A37A 3PSZA 1GL4B 3MFGB 5AOIA 1BQHB 2WIIB 3NMEA 3BRGC 1I3UA 3L9YA 1FLRL 5HHXH 3GZKA 1TYXA 3B2VH 4U05A 1G9MH 1DJGA 3RVTD 4UM9A 1TJIL 3CTTA 4MYWB 1PJ9A 1R5WA 1KBPA 1RHHA 2FGWH 3TJHC 4CVXB 4F8NA 3GQ9A 5T5NG 1PXZA 4ADGA 3MUZ1 1TTAA 1EFXB 2ZUVA 5E5RB 2X38A 5LQBH 3O4LB 5HI4D 1URLA 3K8MA 1KTDB 4LCUB 4ORZC 3LN5B 4AVHA 2FJGA 2AQRA 3FHEA 5EBWA 2Z34A 4C56B 3II1A 5GJSH 3UTZA 3FT4A 3UJTH 1YEEL 3WN5B 1I9IL 2NXZC 1BJ1H 1XIWA 4J3OF 1J1XH 4OQTL 3FO0L 1U93B 5KS9A 1GW0A 5D1XB 4G5ZH 1CURA 3PJSA 4K7FB 3K6SB 1A66A 4W8RA 2GUOA 5C6TH 1EMTH 1PFCA 3QRBA 3AG2B 2PTTA 3WIHH 2OMTB 4I77L 4FC3E 1QWUA 2A74A 2CO6A 1FFQA 4FGMA 1XTMA 1TIUA 4EUPB 3TBSA 4GAJL 1PIGA 4NEHB 3BZFB 3TP4A 4M8QA 1PL3A 5DWUH 3DUSB 1F2XK 3H9SB 2FD6H 4JBSA 2R59A 1RERA 1G9MC 1TVHA 2VLKA 5KYNA 5EEWA 3IJ7A 1QA9B 1MHHA 4OIIL 4F57L 3HBZA 3ZKND 3NBNA 2V9QA 4PD4J 4NQTA 1XB3A 3BIKA 3ABZA 3X1BA 4AEIL 1L6ZA 1JVLA 1T1WB 3ZTDC 2BC4A 3GMQA 4QLWA 1EQWA 5EEUA 4CMMB 4P2OD 1XD1A 4G6JL 2ZG1A 2CO7A 3AROA 3FB8A 3EFDH 4AOFA 2BFGA 2WN2A 1FNEA 3QZLA 3ZHDA 1IKNA 3C75A 3O3BA 3P9LA 5DEFA 3O6LH 3SPJA 5ACZB 1F11A 2EIDA 4MMXA 4NQXA 2IDQA 3IGUA 1DVQA 4LQFH 1TR7A 1KEMH 2AJZB 2DYPA 2ZPKH 3RA7L 1JZHA 5KOVC 4ODWB 1QI3A 3RX8A 2F19L 4N28A 5TDNB 2GC4C 2Y9RT 3C8HA 7CGTA 1J5CA 1DQDH 2C4XA 3NFSH 3QPQD 1IEAB 3HNSL 2CXKA 4J8RA 2OAAA 1R17A 1JGVL 4Q2ZB 1KIUB 4PJCB 1IGIH 4CVWA 4XNXH 4R90L 5IG7B 5K9QI 2WYHA 1DO6A 4K2UL 2CK0H 4HKBB 2IADA 2ZKWA 4N5ED 3WUWA 2PYFB 3DARA 1NBZB 1KPVA 4PWJA 4EAEA 3HAEH 3EFOB 3GK8L 1AYOA 2ICCA 1T1XB 4XWGL 5JHAA 2DQIL 3RQ3A 4PHZA 1AGBB 2DJ4A 4KVCL 4XXDB 2M8XA 5IGXH 2VLJD 3ARGC 4B60A 4BKTC 3RFZC 1NBCA 1PDKA 3RNQB 4FQQA 4DP6X 2BSEA 4KKNA 3RU8L 3AGWA 3HLAA 4C2LA 1VRSA 4NQSB 3X1NA 1NFDE 1YEIH 3F7VA 3JYCA 4ODXA 4PRIB 1SXZA 1UWGL 4H8VA 2YAEA 1JJUA 4KKAD 2C1OA 4N2NA 3V0HA 5CM1A 2J73A 4S1SH 4PWFA 1B9ZA 3N9GL 5DD6B 4AYBA 1A7OH 4U1IB 3SKOB 5E94A 1JRGA 3IETB 4NDMA 5JW5A 2LAAA 5GGSB 3VX0A 3ARRA 3MRCA 2J6EA 3WDJA 5ABZA 4J6IA 4JN2B 2R83A 3G6JA 2EC8A 2OMVB 4URTB 1AANA 2Q2LA 5A16B 3EJZD 1IC1A 1SXNA 2Y2TA 4D9LL 2OMNA 1Q94A 1I4FB 2VDOH 3TCLA 1WV7T 4JCMA 5H94B 4PRPA 1U95B 1S9VB 1E6OL 4LARL 4M7JL 2Q87A 2K9UA 4N0RA 3PNWB 2JB5L 2IGFH 4XX1G 1ETZA 4PFEA 5EB9A 2KPNA 3GBDA 3Q2VA 3ARBD 2XV2A 4PWKA 4L23A 4NKIL 4QJ5B 2KPWA 3SE9L 2PLTA 1ETB1 1S9XB 1ZTMA 3U0WH 3QHZH 1UD8A 4PV8A 3OQ3B 4ZFFB 2H32A 2G5BA 1XH2A 2NMSA 2I07A 2I26N 1TYRA 2VDRH 1YMHB 4MJIA 3QDGE 4GRMA 3MX0B 4AUJA 3G5XA 4DK3A 5KBNC 2Y2YA 2Q7YA 4KH2A 2DQHH 3U82B 3WIHA 2LLLA 4PPTA 4F7TB 3WFEH 5IUSA 3FQWA 1AGDB 3BQUD 3QJQB 3FUEA 4TLUA 2AQ1A 1B4TA 2NT1A 2YWYA 2PW2B 4WO4C 3JWOH 3M46A