3VSUA

The complex structure of xylc with xylobiose
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
total genus 240
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsuA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsuA01
4U31A 5KEZA 3K8MA 3VGEA 2NSPA 1IV8A 1MW0A 2WVVB 1D7FA 1U30A 3WNKA 2F2HA 2F61A 4WF7A 3BLPX 2EWEA 1PZ2A 2XVGA 4GIAA 5DFAA 4MR0A 3OLIA 1UD2A 3CTTA 2ZX7A 2X85A 5CXPA 1M7XA 3UCQA 4XONA 2INUA 1XH1A 1J0JA 2FH8A 1IDJA 4GINA 1O88A 1OB0A 3BSHA 1J0KA 1KTCA 3BLBA 4XOTA 2EABA 2WSKA 3UW0A 5F7UA 4X0NA 1PPIA 3EJUA 1J0IA 3VGBA 1B0IA 3DDFA 1PEZA 4AYSA 2VBEA 3LX9A 4DO4A 2OSWA 2GVYA 2WC7A 4PEEA 3GBEA 4AEEA 3FY3A 1CXLA 2ALWA 1QCXA 3OLEA 3WY4A 1O8IA 1AIRA 1GQ8A 1U33A 4OIFA 2J25A 3S5YA 4MXNA 1KTBA 4OZYA 4OGZA 1WP6A 1JF6A 4GI9A 1HG8A 4WSKA 3GXDA 4UOZA 2WVTA 3D4YA 3D51A 3KWXA 1UH4A 3LXBA 2FGZA 1PIFA 1LWHA 3A24A 2YFOA 1QWNA 1MW1A 3BAKA 2ZUWA 5C1EA 1G5AA 4GQRA 2NTBA 4Z06A 1R46A 3H55A 2YA1A 4CN6A 2YFNA 1G1YA 1PIGA 7TAAA 1CXIA 3A4AA 3EJQA 1TQUA 1HT6A 2BHUA 2WANA 4J7RA 5I5RA 3UERA 3L4WA 4HOZA 1WZKA 2D73A 2NTQA 3BSGA 1V3MA 3ZPPA 1CXHA 1OFLA 4UCFA 3VGHA 1KB3A 1PJ9A 2G3NA 1JXJA 2YKKA 2F7PA 1T0OA 2ZXQA 3L2MA 3GQ7A 1OGMX 3K8KA 3WDHA 3BAWA 3BVXA 3H53A 2Z1KA 1CGUA 3WEOA 3VX1A 3A5VA 2IQ7A 1V3LA 4YZXA 1WE5A 4OJ6A 3HG2A 4AVZA 1TQVA 4JFSA 3VO0A 1I75A 4DO5A 1O8FA 3RIKA 2PYHA 4U49A 1V3KA 4UZUA 3D4ZA 4XMYA 1R75A 1MW3A 2XWDA 4H8UA 3TV8A 1OFMA 4GO9A 2VBMA 1O7DC 3T9GA 4XOPA 2NSTA 3L4XA 4OJLA 3L4VA 4LPCA 2EQDA 4CN4A 3IK2A 1EHAA 1GJWA 1CDGA 1AQMA 2ZXAA 2EO7A 1XSJA 4E2OA 1SMAA 1ODUA 1KGXA 1MW2A 1QHOA 3VGFA 2WVUA 3VX0A 1KCLA 4FLSA 1OGSA 3A22A 1KXTA 1XCWA 2Y4SA 4XKWA 4JFUA 1R33A 1WO2A 3CV5A 2O1DA 3DX4A 4JL2A 1UD4A 3L4TA 5BRPA 2WCGA 4AIOA 1JRGA 2QX3A 4NXSA 3CLWA 2OYLA 1DHKA 3LXAA 4CVWA 2VBKA 5A2BA 4HPHA 1KWKA 1JI1A 5E6YA 2X6XA 5E70A 1L0PA 1UA7A 3BC9A 3VSUA 4JCMA 4PSRA 3ZQ9A 4UOQA 2WKGA 1XSKA 2NZMA 3VM5A 2WVVA 2C7FA 3WWGA 4EW9A 2FHBA 2Y5EA 3FW6A 4BZYA 1XH0A 2E8ZA 3EQNA 3AJ7A 3GXIA 3MI6A 3WEMA 3WY1A 1RMGA 1GCYA 2GUYA 4H8VA 1VBLA 1UKTA 6TAAA 2G3MA 4W8QA 2VRKA 4J28A 4GI8A 3WELA 4X9YA 3ZOAA 1CGWA 3WNMA 1G94A 5A2CA 1WPCA 1VIWA 3CZGA 3M07A 4M56A 4AYGA 3W37A 3KL5A 1MFUA 1PAMA 2EEXA 4W93A 1WMRA 2V3FA 2OW7A 4UQ9A 4Z05A 1GJUA 3GXFA 1UASA 2E0PA 2WVSA 3GXNA 3AMLA 4GI6A 1CGYA 4AMWA 2VR5A 3BVUA 3WNNA 2F1BA 1KBKA 1XGZA 2PWEA 3EDDA 3WY2A 5HDRA 3BMVA 1MVYA 1P6WA 2CHNA 1BVNP 1AVAA 1MWOA 3W38A 4FMVA 5A2AA 3VM7A 1XH2A 3CZNA 1HTYA 1DEDA 2PWDA 2QPUA 3B4NA 1OOCA 1PS3A 2CXGA 4W8SA 3QGVA 1JFHA 3A47A 1VFUA 1KTWA 2E4TA 3ZT5A 2D2OA 3B8YA 2BXZA 1UH2A 3HZ3A 1KXVA 1TQWA 1WZLA 4FLRA 4FNPA 5E1QA 1EE6A 4PMHA 2D3LA 1X0CA 1QX1A 2QXZA 3GXTA 1KXQA 4FNRA 3WNLA 1UD6A 1BHEA 3H54A 4HP5A 2XIIA 1PE9A 2QMKA 2X2IA 3ZSCA 3EJSA 4OZZA 1WZMA 1KCKA 3WNOA 2F7RA 1JDDA 4I84A 1UKSA 3BAIA 1C8QA 2YA0A 3L4ZA 1QPKA 4ATWA 2PECA 3DHUA 3BAYA 1JTAA 2D3NA 4PCSA 4XLFA 1W9XA 2ZUUA 1QHPA 2D0FA 3KL3A 4J3VA 3VNYA 3GQ9A 3CZEA 5I0DA 2WNWA 1WZAA 1JDCA 1E40A 2YOCA 4JCLA 1TCMA 1J0HA 2DIEA 3VMPA 3VSVA 1QJVA 5BRQA 1KXHA 4GQQA 1HVXA 2O0VA 4J3TA 1NM9A 1H3GA 1M53A 3TTYA 2Y24A 1R47A 1KGUA 1MXDA 4UNIA 1O8MA 3GXMA 4XLCA 3BUDA 1UOKA 2INVA 1OT1A 4H7VA 4LXFA 4AMXA 1G9HA 1IZJA 4M8UA 2XVLA 3EJRA 2QY1A 1SZNA 2VJIA 3DDGA 3AXHA 5AMVA 3L4UA 1GVIA 1UA3A 1UKQA 3TOPA 1QI3A 3DX0A 2AAAA 4OJYA 1XG2A 3EQOA 4YELA 1PXZA 1U2YA 4HWVA 2GJRA 3TONA 3UG4A 2NTPA 1V3JA 1XCXA 1EH9A 3BCFA 3WDIA 4UZSA 3ZSTA 4YZQA 3D52A 1RU4A 2EJ1A 2X2HA 3AMKA 1BPLB 2BSPA 2NT9A 3A6OA 4QAWA 1HNYA 2WCSA 1QI4A 2O0WA 2ZX9A 4CN1A 1VAHA 1UD5A 2OYMA 3K8LA 3IJ8A 2FHFA 3WN6A 4W8TA 4OJPA 2XN2A 4XL9A 1XD1A 3LPPA 2UVFA 3KE0A 2YIHA 5CGMA 4U4BA 1JGIA 2EADA 3BUQA 2PYGA 2X2JA 1R34A 3BAXA 1S46A 2VT0A 3L4YA 3BVTA 3HG5A 5CGTA 3EDKA 3FAXA 2XN0A 3L2LA 5TD4A 2QPSA 7CGTA 2ZX6A 3CPUA 3EDJA 4J3SA 4AW7A 1BF2A 2DH2A 4H8HA 2X6YA 1XD0A 1SMDA 1CXEA 1B2YA 4AIEA 3BH4A 2ZE0A 1IA5A 3BUPA 1JD7A 4JFWA 1Z32X 4JFTA 1PLUA 3OLDA 4U2ZA 1O8EA 5CLTA 3EDEA 3KLKA 1JF5A 1VFMA 2ODLA 1XV8A 5HPOA 2E8YA 4NX0A 3BUBA 4FLOA 3LRKA 4UQAA 4YZAA 1KCCA 2UVEA 3VGDA 3ZR6A 3EJPA 2DIJA 3IGUA 1OSEA 2VRQA 2OSYA 1HXKA 3VMOA 3A21A 9CGTA 1EA9C 2PWHA 2EAEA 1CPUA 1CYGA 2PWFA 5I24A 2O17A 1Q4NX 5C1CA 1HX0A 5E0FA 3WFZA 5A6MA 1VB9A 1JDAA 2C8NA 3BCDA 3DC0A 3GBDA 4FNSA 3UEQA 4URRA 3WY3A 4NK6A 1CXFA 1EO7A 1E3XA 2ZXBA 3LRLA 1E43A 3VMNA 1O8GA 3ZR5A 4CKQA 1CGXA 3CGTA 1JAEA 2BY0A 4PSPA 3CZLA 4UQCA 2ZUSA 3HG4A 4MB1A 2ZWYA 3UG3A 1TMQA 4WLCA 3HG3A 5CLWA 3GTNA 2BY1A 3EJTA 1BN8A 3SUCA 4NI3A 2D0HA 1DBOA 1CXKA 4U33A 1DTUA 1VFOA 1RP9A 2BHZA 1K5CA 2Y2WA 4J27A 4U2YA 1IB4A 2GJPA 4PCTA 3B90A 4YEJA 2BXYA 4B9YA 3WENA 4UQBA 4J3XA 2FHCA 3K1DA 4W8RA 3BVVA 1MFVA 4KMQA 2O04A 2YJQA 2ZX5A 4GKLA 1A47A 3RILA 3DHPA 1JXKA 1DBGA 1QWUA 4XLHA 2PWGA 3CZSA 3S5ZA 3ZT7A 1QW8A 2XVKA 1RWRA 1AQHA 1RPKA 3LXCA 4XORA 4NZJA 1H80A 1JIBA 2FYVA 4JL1A 3IJ9A 2QMJA 4HOXA 4XLEA 5E9AA 3FAWA 3JURA 3KLLA 1XSIA 2VUYA 3DX2A 2ZXDA 1PZ3A 4FNTA 3TTSA 3VSTA 4B9ZA 2F1AA 4XKVA 5A6LA 5I23A 2NT0A 4NK8A 2QLYA 3DX1A 3CC1A 1BG9A 3GQ8A 1CGVA 1QI5A 1JD9A 2XWEA 4NXKA 3BUIA 3KL0A 1ZS2A 4YZ0A 2WKLA 1JG9A 3KEHA 2VJJA 4C2LA 1IZKA 3BLKA 3WDJA 3VMVA 1O8HA 2F7OA 3VMWA 2X3HA 2WPGA 3GRHA 4WSJA 3GXPA 5DO8A 1CZFA 1OGOX 3LPOA 4DO6A 4XR6A 1HL9A 2ZWZA 2NT1A 2V3DA 2D0GA 2XN1A 2X6WA 3OLGA 2TAAA 2CPUA 4XM3A 1ZJBA 4J3WA 2Z8GA 1D3CA 3IJ7A 1NHCA 6CGTA 4HOWA 8CGTA 4H2CA 2ZUTA 3CZKA 4XNFA 1OT2A 1E3ZA 1UD8A 3ECQA 3VU2A 4XN3A 4BA0A 2IGTA 2BHYA 2OW6A 4Z03A 4NZFA 1HL8A 1NOFA 1MXGA 1Y7VA 3BVWA 2F18A 1VJSA 1JL8A 2FH6A 4FLQA 3VNZA 2F7QA 3LRMA 4J3UA 4JFVA 2V3EA 2ZIDA 1JI2A 3II1A 1TQTA 4KWUA 2ZUVA 3WNPA 2DH3A 4OJOA 4HA1A 4U3CA 2ZX8A 3LMWA 1CGTA 1RP8A 5EMYA 1TQSA 2QV4A 4FNQA 2E9BA 3ZSSA 1AMYA 4AEFA 4XQFA 2OSXA 3WMSA 2AMGA 5HXMA 2VNCA 2WSPA 1KGWA 2EACA 2BY3A 4UQDA 5E6ZA 1O8DA 1O8JA 3KRGA 4OJ5A 3S2CA 1CIUA 3VGGA 4CGTA 1KWGA 2NT6A 3D50A 2YA2A 3DX3A 1BSIA 1UD3A 3EDFA 4GO8A 1LWJA 4XLAA 1KBBA 4FNUA 4LQ1A 1IDKA 3GQAA 4TVUA 1QW9A 1HWWA 1BLIA 4UQEA 1O8LA 1O8KA 2XIBA 3ZO9A 4MAZA 2FE0A 3AXIA 3BMWA 3BAJA 2NSXA 3ZT6A 2BY2A 4XB3A 2ZICA 1UH3A 3A23A 4OKDA 3UG5A 4XN0A 1ZJAA 1BVZA 2OYKA 1KCDA 3HJEA 1CLVA 1BAGA 1EO5A
chains in the Genus database with same CATH superfamily
4JO2H 2J88L 4UOW1 2HRGA 1N0LA 1G9MH 1D7FA 3IDIB 3HZMB 1F1GA 3FO2A 2Y6SD 1V7MH 3EBGA 4A6YH 4WGKA 4OLXL 3BE1L 3BIAX 1RHHB 4OJCA 3SDAA 2I07A 3LNFA 2PCFB 2EYRA 1OAYL 4FERA 5AOKA 5B4MD 4XONA 2HTLD 2MCPH 1DSYA 4KO9A 5EFIA 1OQOA 1IDJA 2B4CL 5C0AB 3N9GL 1I85A 2CJ3A 3SKMB 3WE1A 1XAUA 4H25A 2R0ZH 1KPVA 4PY7A 4Q9RH 3ABLB 3LTVA 2X44D 4KXAA 3H9HA 3VJ6A 2WLMA 4UTBH 1MCEA 3D0VB 2YBGA 4XNUL 3RIQA 3QDME 3S3PA 1A9EB 5K9QI 3H2PA 1X9QA 4IOIA 1MQKH 5I15L 4ODUA 2WOYA 2DJSA 1S9VB 4C47A 3K71A 4OGZA 1D2PA 1MG2C 1EZVY 2R15A 1JF6A 4HUCA 1T0MB 2ZWKA 4JN1L 1WF5A 2X1PA 3RUGE 4MJIA 4QWWD 5F7YC 4LRNH 2X4OB 2OR9H 1DR9A 4IBYA 3AS3A 5IV2A 3FF7A 3QWRD 1FGVH 1KLGA 2N01B 4GQRA 5D96C 4NS0A 3QIBD 4JY5L 3S4SA 4KK5D 3L9RB 4APQA 4BWTA 3ARBB 4X4KA 4C56A 4C55A 3KYKL 3TYFA 1PIGA 4LLMB 4MQTB 4TRPH 1U58B 3U6XA 2ICES 1Q1JL 1U3HA 3G6JA 2BHUA 3GRGA 3U7YH 5DGRA 3IM1A 1T1YB 3X2QB 1R3KA 1IGML 2Y06L 3QNXA 3V8CA 1Q0EA 5D4HA 1PQZA 1CXHA 5AVVB 1W0WB 2V2XA 1KNOB 4JPKH 4IHBA 1H6TA 2N1KA 1RK0B 1S3KH 2NY3C 3DYMA 2VDKH 2YKKA 3RDTA 1F3JA 3FULA 4CVZA 2VWEC 3KPPB 1S9WA 1DVQA 3BVNA 1CGUA 5D6CA 4JRYD 5EPMB 5CU5A 3MLWH 5L7XL 1PX4A 3HE6D 4LDCA 1A6UH 4HWEH 1IE5A 3WEAA 3KLHC 5DUML 3TBBA 1B6UA 3UO1H 4AQAB 3K1KC 1B2WL 3OG4B 5GGUB 4OJLA 2IAAC 3ZE1F 1HESA 5B1JA 3MLVH 1NM4A 4GT0A 2BOBB 1E2VA 4P59L 4RNRB 4WNQB 4G8AC 2ZXAA 4HZ1A 5CWSB 2VXSL 1X5KA 5G5DA 2Z91B 3NSCA 5GZND 4LLYB 4HS3A 1NWOA 4LHJB 3VGFA 2IAMB 3AM8C 3L3HB 2ZCKL 4PRNB 2CO6B 1WFNA 3T0ED 1QG3A 4W9EC 5JW4N 5EF3A 4WI3A 3L5HA 5DK2A 4P23B 2XWBA 3DIFA 5DT1H 3UYRL 5E7BA 4QNPF 4XB8A 1CTMA 3M8OL 2L3BA 5AYQA 4ZUSA 2J55A 4ONFL 3VG0L 3U48A 4YDTA 3LMJH 1I3RB 3EGSB 3W0WD 5GS0L 1N8ZB 1NAKL 4FXGC 3RWJB 3UZVA 2X4QA 1E9PA 5TQ0L 4IKLA 3WTTA 4PSRA 3JVFC 2CO1A 1RFDL 2TSBA 2C3VA 3VM5A 4AK2A 4XNAA 2QR0B 2JXMA 4Y8DC 3B2UD 2R1XB 2E8ZA 3S3SA 1J05A 2VZSA 3FH5A 3AJ7A 3QAQA 2PR4L 3LH2L 4IU2A 4ADJA 5FYKE 4HH8A 2X7LB 2X4NA 1ZMYA 1MREL 4ZFGH 3GI9H 5K9OA 4JZOB 3LKQB 4UTAH 4PJCB 2VLRE 1R5WB 4E9QA 3SE9H 2NNXA 3QZWG 3F3HA 2NR6D 4XPAH 2A6IB 3SDXB 3V2AR 2AC0A 2BS71 1VACA 5D4QA 2AI0L 3GUFA 2CJTA 1WH0A 4Z3GA 2Z9TA 5DNSA 3L95B 3M07A 2JTYA 4OF5A 1MFUA 4IGBC 5ETUA 2OPCA 4M9PA 1CE1L 5E03A 2IGFL 4U1IA 4OZIF 1UASA 2E0PA 2WVSA 4Z0XB 4WENB 4AE0A 5I0WA 4M7LH 4YBHA 4GI6A 4N26A 5CCKH 4FQIH 4AG4L 2CE6A 1BYNA 1RIUL 3EFFA 5HDRA 5J13B 3IETB 4CC4A 2WTRB 4Z76B 3TJEL 3MX0A 3UBXA 4KJWC 3KJ6H 1AKPA 4WW2A 2YBRA 2IV8A 1VFUA 2P44B 2H6OA 1HEZB 3MTRA 4WWPA 4JN2A 2Q86B 1J5OL 5IMKA 5J3HC 1C9SA 1KXVA 4G9FD 4DKEH 1MHEA 1FHGA 1QTYT 3O6MH 2ZOWA 3QDAA 2J73A 5FGCB 3F85A 4U6XB 4TNEA 4EVNA 2X9WA 1DL7L 3FO0L 3MU3A 4N1EA 2GBVA 1E4HA 1WZMA 4AJVA 4Y88A 5D1QA 2LAGB 1XB3A 4PJHE 2VLKA 4KXBA 3PUCA 4NAQA 3LKRB 2PECA 5AKVA 3ZIYA 2ID5A 2FEEI 3EYSL 3TNNB 2BSEA 2XRAL 5INDB 4HLZG 5E4IA 3N1PC 2ZUUA 3ARFC 1FNGA 3FN0H 2YKLH 4ZAKC 4L8CA 1NEZG 1R5VA 7PCYA 1DO6A 5BS0D 5KJ4A 1J0HA 4RGOL 4GUQA 2HMIC 2XXMB 4YK4C 4G9DB 1QVOA 1DDHA 2A9NL 3AQXA 2JMRA 1KY7A 1TYWA 3KM2A 4HH9A 4WO4C 2VW7A 3NCCB 4MMXA 4D94A 1KGUA 4WI7A 1KY6A 1XF5B 5MI0B 4NT6B 5DC9B 3UJJH 5EHFA 4JRXD 1T5KA 1SHMA 4ZS7L 4XT1C 3EGDA 1WGVA 2GB2A 3IXTA 4MS8C 3WS6A 3HUJE 1G6RL 2QELA 3V5DA 4CDHA 1JZ4A 4KK8C 5C08A 3II3A 5DJ2B 2D7NA 4ZW3A 5C92A 3UG4A 4NN5B 3VFTA 1V3JA 2DDQL 3GLEA 2X2HA 3E6HA 1L7TL 2PYEB 3EO0B 3EYOB 3HB3D 4OT1H 4RQQA 3RKDC 4CNIB 2D7OA 2FX9H 5AG8A 4BRVA 5IK3A 1WA2X 1F8TH 3ATDA 4HXBH 1B4TA 4ZG1A 5D9SA 3QC6X 3JXAA 1FV1B 2WW8A 1HCVA 1E90A 2DLEA 3F12B 3SDDA 5GRUL 1R34A 2IPKB 1RZIA 4XNMA 3JT0A 5HDOA 4BM7A 4WHYH 4HLEA 1NBYA 3QRGH 2Z93A 4GSQA 3WEBA 4ETYA 3GS4A 2DWDB 3MLUH 4YHNB 5T5NF 5B7FA 3NCBB 1ORSA 2DH2A 2GSGA 3UAAA 3K72B 2LTQC 3TZVB 4YAQA 4L1HA 3TX4A 5EC1B 4MS6A 1HDMA 5KSVB 1V05A 1VFMA 5FO7A 2ODLA 4MZIA 3LDBB 3KPMA 5T8IA 3LRKA 1IKOP 4A6YA 4R2GC 5AZ2H 1EIBA 4U3XA 4NP4L 2VIRA 1K2DB 4OCSH 3SBQA 4GYBA 3O2DL 1ZANL 1OALA 3VMOA 1KC5H 5E6IA 2FWOB 2J1ZA 4E36A 4OM1H 2XWTB 5CUSH 4YOKA 1CLOH 3T3PB 4YN3A 3IJSB 3ECBA 4HZLB 3MUUA 3O3DB 5EZPA 3ZL1A 1D5MA 2DYRB 2ZUYA 3H9SE 1C5DB 3IDXH 5DD0L 5C0CA 4URRA 1E6OH 1VGKA 3OZ9H 2O6DA 4E9RA 4AKQA 5CEXB 3GBMH 3O6FB 4NUGH 4Z7OB 5GRVL 1DBAL 1UZ6E 4M4RB 4N2GA 3WTXA 3OJ2C 3ABZA 1M2OA 4F27A 4XBEH 3ESPA 1WTGT 3MNZB 3QJFB 2ZUSA 4DH2A 1WEJL 4L9DA 2R27A 5E6SB 2AK4E 3CFDB 3NOIA 4I9WE 1T1ZA 5B3NA 1IIIA 1IT9H 1JHLL 2FD6L 4GW4B 5AOJA 3OAYK 1NANI 3GSOA 5FUOL 5AZEL 1IFHL 4FMFA 4X50A 4AYID 1RP9A 4XPBH 5T33L 5GGTH 2Y7SA 4HWZA 2K1MA 4P46D 2B2XH 3GMQB 5F0MB 3IE4A 1ETZB 4LDLB 1FFPA 2GW5A 2V17H 3IU3B 4Y9FA 4M61B 4YDLC 1RI8A 2VAAA 3TN0A 2UZYB 2A6KA 3MR9A 4AEHL 1P9MC 4PRID 4PR5A 5AW8B 3Q6FB 5GGSA 4ADIA 1NBVH 2CXKA 4K7PL 2XPGA 1IJNA 4JL1A 4GKSB 1EHNA 1XSIA 2YWYA 4L5FL 1PZ3A 4RGNE 3OSKA 3FB8A 3DVIA 1H3TA 2MCMA 4Q2ZB 1LD9A 1BG9A 1VGEH 1CGVA 2HFGL 3IJEA 4JE4B 4NXKA 4U7MA 4ZT1A 3RL2B 5TDOA 2FSEA 1PLCA 5DEGB 2C9UA 2HLAA 1XF2A 1YEWA 5K9JH 4PMEA 3X1NA 4IDJL 4G6KL 1M57B 1E67A 2F19L 4QF1B 2YD8A 1IGJA 2W60A 2F08A 3K4AA 5HHPB 3LPOA 3QIBB 4XVTL 4OIBA 2HB0A 3LEVL 3HMXL 2VR7A 3NEEA 2YAPA 4JQVA 2RHEA 3TA3C 1ZJBA 1DVTA 1XVSA 5H4ZA 1NPJA 2VXVH 2ARJQ 4G7YL 5AOIA 2FK9A 4HOWA 3S3CB 1MHPL 3CZKA 1DCLA 3NG5A 5E99H 1E3ZA 3FFCA 1U4EA 1UVQA 4QYOB 3VU1A 3MJ8A 3LJYA 5FKPA 1J1XH 2AP2A 4H0HB 4KAQL 4NSKA 4X8JB 2F58L 3QNYA 4DP0X 1MWAB 2FQFA 4QEGA 3GIZH 3JWNC 4BFIB 4NERA 4JRYB 2FYYA 3DV6A 5J9PB 3CFJA 3HE6B 3GRWL 2W8CA 4H5SB 2AKRA 3HZYB 2CNYA 3UYPA 5EMYA 3VFOB 4EN3A 4GMTH 5C9KA 2QKSA 3MV01 4FJYA 3TESA 5CSZB 2VNCA 1KGWA 5ADPL 1O8DA 2VL4A 3OKEB 15C8H 1P4LB 1UWYA 2J12B 2UZIH 3D2TA 4PJEE 1S7VB 3T0EB 5IIEB 1GTFA 1F6AA 3DO4A 2UX7A 4CMMB 3GQAA 3I6KB 2OS7A 2COVD 2VABB 1E2ZA 2H6UA 5CFAA 1LM1A 3FT2B 2VO8A 5ABAA 2Q8AL 1SBBA 3APCA 3PWLB 4MAZA 1KEGL 3H9ZA 3T8MA 1CT8A 1KN2H 2ZICA 4QY8A 3AGWA 2QLVB 4FFWC 1RVFH 3MMEA 2VZVA 1U4FA 4MJ6A 5AL0A 3W0WB 5KN5B 3HC4H 2VCOA 5E5MA 1KJ3L 2VMJA 4UV4L 2BP8B 1T1XB 1JZ3A 3ARFD 2QDVA 1MW0A 2X4RB 3ELQA 4MMZC 3MBXH 5SX5H 2XNAB 3N1QC 3BLPX 3I85A 4HWBA 4HJIA 2WP3O 4OM0L 4M1DL 2EWEA 4EI5C 3HG0A 1JGVL 1FH5H 3CMOH 4A04A 2IPUK 1UD2A 3EO1A 1GH7A 3VACA 1XGTA 4PJDE 4WO4D 4Y5XA 3WO4C 1EDYA 1MJUH 2YLHA 4XO8A 1NLBH 3GD1C 2Q6WB 1W72L 5CO1A 2BJML 5TGBA 4MS8D 3N55A 3G04A 3PWUB 4JHAH 2KERA 3L3GA 4JANA 3LH8A 3BH9A 1S9XB 5DEFB 1OP3K 3QI9D 3WKML 1TUPA 2OXHA 5DD6B 3NSYA 4JM2D 1HSBA 2F5BH 3C60B 2DTML 1B4LA 4UUJA 2I9TA 4NIYE 1KTBA 3RWCA 1XEDA 3VWJD 3RKDD 4J5VA 5B3JF 4K8RD 5KS9E 2DWTA 4WSKA 3ETSA 3ULVL 4NDMB 3B9KC 1V10A 4F24A 1BP3B 4L8BA 2FGZA 1SPDA 1L3NA 4D9QD 1CD0A 3EGXA 4FI7A 1YPZA 4KY2A 2J57A 3SQVA 1SJHB 5F72S 2HVKB 3OKLB 3GBNL 1A0QL 5IB2B 4OV5B 4YSSA 5SX4H 1BZ8A 1CR9H 2AJ3B 2BCKA 4FTDA 4AIZA 4DK5A 5JXEC 5DUBA 2A4EA 2DKUA 5JPMC 3BP7A 1BM3H 2QDWA 4XNBA 4G9FB 4PB9L 2WANA 3RY5A 4R0LB 5EG6C 1OTUD 4GLRI 1BJ8A 2CR3A 4GG6E 3O81A 4WFFD 3UPRB 1L3WA 3EJYC 3NIGB 2QADD 4UQ3A 3NVQA 4PLOB 3GF8A 2BSCA 5KVDE 3M88A 1JXJA 3BN9D 2ZXQA 3GQ7A 1VZIA 3RY4A 2B0RA 1FZMA 1NCWH 5C9JB 4QJ5B 1EJ6A 4Y1AA 3F04A 5FO8A 1JPGB 3T4AC 1HXMB 1F5WA 2Z35A 1G1KA 2H26B 4QOKD 4ZMQA 2WLKA 4XMYA 4TVSa 4H26A 2VSMB 1OB1B 4M5ZL 4GO9A 5EOCL 1ZLUH 4BA8A 4G6MH 3CXHK 5BS0B 5HI5D 1U8OB 2D7PA 2H8PB 3QDJD 3VFPA 4JX0A 1QHOA 3OZKA 1IBBA 1BZ9B 1OGSA 4X7DC 1B4JL 3WBDA 1HOCB 4BSVA 2BWQA 4OCXL 2PW2B 1A65A 3RNKA 3PFQA 1M3IA 4TN9A 4L9LB 4JRXB 3ZMRA 2A1WH 2R83A 2LFEA 5DVOA 1U6AL 5J6HB 5KVMC 1IAKB 2A9BA 4OI7A 2DYSB 3G5XA 1T5XB 1K4CA 3D39D 4DN3H 1NUFA 5M94B 1ZGLM 3LXAA 4FYTA 3FRPG 1NMAH 4CVWA 3OC5A 4OCNC 1JNNH 5J1AA 3DYOA 2JJTA 3ZZLA 4NQTA 4D8OA 3N85H 5AB1A 3VSUA 3JV6A 1F4WH 1ZHLB 3FMGH 3CLEL 4TULL 4KNUA 1RZGB 1YQVH 4M03A 3WU1A 1INDH 4KTGA 3HB3B 4ZSOB 3IDIA 1N19A 3HZMA 3SODB 35C8H 3UAJA 4EW9A 1OAQH 3FW6A 1QEXA 2YD3A 3SPJA 2P5EE 1RHHA 1ZIBA 3ORJA 2K0RA 1FE8H 3GSRB 4N90D 4DN4L 3ZRFC 3KGTA 1RMGA 4KOCA 4QXGH 1A4KB 5I74C 1FPTH 5E8DL 5C0AA 1OTSD 1CURA 4NQDE 1R17A 3PL6D 5BVPL 1CLZH 3SKMA 4J28A 4OZIA 2RGSA 1TVHB 1KYOK 3TT1L 5HGDA 3O3EB 3O8XD 4W4OA 43C9B 1QR1B 4UYQA 4P2RE 4OAWA 3D0VA 4DVRL 3DO7B 2KUTA 1A9EA 1OE2A 3TBTA 5LB1A 2XWZA 4N2AA 1U3ZA 1S9VA 1VDGA 2A73A 3FUFA 4ZXBA 5FEBA 3BVUA 3ARGD 1KBKA 2RA1A 3X1FA 5C0RL 1L5GB 4WU7B 4IRSC 4MZ3A 4MXWH 1M56B 1WIOA 3ARXA 3GK8H 1W2KT 3EJJX 1OP5H 3T0BA 2X4OA 3BP6B 3OR6B 1XH2A 3U1QA 4PJBE 1LEKB 3SD2A 3ZT5A 1ACZA 4RDBA 1UYWL 3CQFA 5DJYB 3L9RA 1BQHB 1L0XA 3ARBA 2CRZA 3NACL 3V6OC 3X14B 5MEQB 1U2HA 1TQWA 3BT2H 4GSDH 1SY6A 2R29H 5EBMB 4M8QB 1CLYL 1U58A 1LEGB 4DP6X 2CSPA 3ISYA 3D48R 4LOUD 2BW5A 1W80A 3BKCL 4ZOAA 3K4ZA 4RFNB 3T8XB 4KKLD 3EOTL 1TJIH 1XBDA 4OZZA 1TFHA 1OFDA 1KNOA 1JVKA 2C9QA 4BQ6A 3UACA 2ICEC 1HEHC 2ARJB 5F96L 2NY0D 3TJPA 3KPPA 5FFOA 2PCXA 3JBG7 4ATWA 5I17B 3NAAL 5FYKL 4X8GA 2X1XR 5JYMA 1J9QA 1X9RA 3WMQA 1FCGA 4WJKB 4DHLA 3FB7B 1N70A 4KTEL 3REWA 5LKNA 4NFCA 2F53D 2SODB 1OF2B 5G4MA 3QDGE 4KQ4H 3SGDI 4P46B 4AQAA 1UZ8B 4O2CA 5GGUA 3QUML 2B7DT 2XN9E 5D8JH 5CGBA 2BOBA 2BVTA 4K0OA 1JE6A 3K46A 4WNQA 5CWSA 5EWIL 2MQ3A 1FG2B 2Z91A 4UNIA 3CSFA 4LLYA 3D33A 4XPFL 4XLCA 1FYTD 4HYTB 4UTCA 2IAMA 3L3HA 2WWMC 4PRIB 4UT6H 4PRNA 2CO6A 1IBFA 3EW3B 2KLRA 4FFWD 4IMLB 4U1GB 1SVCP 4XWGH 1UGKA 1W16A 5E94B 5AW7B 5C8JB 4JAMA 4U6VH 2YMXL 1I3RA 4X7EC 1U8IB 3INOA 3NK4A 3EGSA 2F68X 1HYRC 1WAAA 2DQIH 5IVZA 1N8ZA 3RWJA 3UDWC 4BK8A 2A83B 2NLJA 5DJXB 5DQJB 3ASNB 1DCEA 5MP6H 4J4PC 2R8SH 2APSA 4WFGD 4XXCC 1YEJL 4GAFB 5DMKB 1RZ8B 2H2PC 2QR0A 3Q1SH 4GLRH 4XMLH 5IFAL 4W8TA 4JZJC 2R1XA 4KZ0A 4D9RD 4OJPA 1IE4A 4LL9A 1E5ZA 1KG0B 3FCSA 5CGMA 3NCYP 4HSQA 2X7LA 2GJ6E 3UZEA 1OAUH 2HWZL 4JZOA 3LKQA 4BWUA 4EMZA 4PJCA 1R5WA 1NCJA 4ZNCD 5D7IF 1S8DB 2A6IA 4IJ3C 3SDXA 4M62H 1UZGA 1B2YA 4PW9A 1P4IL 2ZE0A 3L95A 1JD7A 3V7AG 3I50L 3B1TA 5PAZA 6FABH 1XV8A 5JIKA 2VQ1B 1J1PL 4Z0XA 4OJAA 5HJ3B 5GGRB 1WXRA 3OXSB 1GS8A 4Y1SA 3F01A 4YMPA 5G4NA 3W2DH 3IETA 4UYPA 1PY4A 1HHKB 4QXUH 1KLUB 4ODHH 1FZJB 2WTRA 4Z76A 3JZ7A 2GJZB 3K3QA 1M7IB 1ZXQA 2J72A 4MXVE 3BWZA 5F7LB 5B3SB 5BO0D 1BZ7A 4OFVA 5FUCC 2MOGA 2IDFA 1IVTA 5DEZA 5DS8B 2F54D 1HEZA 1U8LB 2Q86A 3CQQA 1YEDA 3IXAB 3NDZE 1IEAB 4XP1L 2EDJA 4ZTOH 1ET5A 4F37F 1DVFC 1ED3A 7FABL 1AGCB 2XA8H 2J1WA 1XH3B 2VC2L 4OIAA 4U6XA 2BSDA 3JV4B 2VMFA 3P3YA 3SYOA 1E3XA 3QEQE 1H6FA 2R56H 3Q05A 5EC2B 2VZTA 4PS4L 4K94H 4LASH 3ARFB 3ILPB 1F0LA 5D5MF 1ICTA 1T5WA 2FUTA 3HG3A 5DRNB 4MQXC 3LKRA 4WFHE 1BBJB 4M6OH 4YK4B 1SYSB 4GRMB 3X13B 5I6XB 5AW3B 2O5ZL 1A1OB 4G6AC 4YHPB 4WO4B 1MDTA 3P2TA 1RIHL 1IKNC 2A0LC 3SQOH 3UMTA 2ITDA 4B9YA 3HNVL 2EH7H 4W8RA 3K1DA 4G9DA 4QRPE 3BVVA 1MFVA 3QHTC 1X5IA 4EOWH 3DVGB 2OMTB 4GBXA 4PJ7F 2MCAA 3UEZA 1JS4A 5TH2A 3DBXB 3PDOB 1XF5A 3LHPL 2V5YA 5F9WC 1X4YA 1UFUA 4NT6A 4J6RL 4Z7UE 4XE5B 3QAZC 3QI9B 2IO5A 4XN2A 4JM2B 3LIZH 4NQXB 1XGUB 3VWJB 4KI5F 4YFOA 4MRBA 1NCGA 1WAPA 3LZPA 3VXSA 2PW1B 2PYEA 3EO0A 3EYOA 1UUNA 4CNIA 1CZFA 2O5XL 5INCB 2G4GA 2X6WA 3FOLB 2XN1A 2E74C 2WLNA 2V0AA 4HIPA 4OD3L 2P5WE 4KDWA 2ENSA 4L3EE 3IMBA 1YEKL 5ID0B 1NC4B 1FGNH 1FV1A 4XC3H 4XOCA 6CGTA 2XXCB 3AY4A 2X6BA 3DUUB 4KFMA 4QHNB 3LN4B 1N68A 2IPKA 4O51B 1TYXA 2YQ3A 2QADB 2OZ4A 1HINH 1RV6X 3R18A 2DWDA 4U1KB 3BVWA 3V4PH 3MYJB 4YHNA 4HAGA 3K72A 3SGDH 2F7QA 2JKSA 3TZVA 3HE7C 3WHXA 3W39B 1M9WA 5EO1B 4BDVB 5EC1A 5KSVA 2NZ9D 3QG7L 4QOKB 3N06B 5CFHA 4IRJD 5EB9A 3MLTB 2X89D 4WUUD 3RI5F 1IGYB 4B5ZA 3KG5A 1G84A 4AZ8B 2G4EA 3QDJB 3QJQB 4KKNA 5I6LA 3HZKB 1K2DA 3P4NB 3ABMB 4PWJA 4XCNB 5DK3A 4W9FC 4ZOCA 4YXLH 2FWOA 1UWXK 1O9WA 5J06A 4A7SA 2XWTA 4G7SB 3AQZA 1ZIAA 2ZP0T 3FJTA 3IJSA 4HZLA 5KSAC 5JNYB 1ETB1 3O3DA 5H94A 4FQJH 1C5DA 1A9VA 4OGYL 1JV5B 4IKJA 5EV7A 2AJZA 3ZT6A 2VXQA 3D39B 4XB3A 1OKEA 4NJ9H 3BYTA 1NGPH 4LZKA 2XTJE 3SDCC 5CEXA 2V8MA 1DBJL 2Y9RT 4M4RA 4ZK8A 4PP1C 1E9QB 2CR0A 5T3ZH 1DQLL 2R9HC 2X5PA 4GJTB 3QJFA 1IKFL 2JQZA 3DVNB 2XVGA 4MR0A 3CFDA 4PGDB 3MXVH 3OBAA 1S6NA 2DZEA 4GW4A 4GW5B 4U7SA 1WWAX 4AEIL 3WIHL 4AUUA 1QFPA 2HJFB 3BSHA 2WZAA 4XOTA 1KTCA 2ZONA 3GMQA 4ZOEA 3GQFA 3WAJA 3PWNB 2AABL 5IHHA 3GMLB 3N04A 3PL6B 4P3DA 3L3OC 4JDEB 1F4XL 3IU3A 1EAPA 4OCYL 4M61A 3VGBA 3X1BA 3F6IA 2UZYA 4AYSA 3O8XB 5AB2A 2EZ0C 1THAA 2R29A 1TEYA 1XHHA 1WCQA 3Q6FA 3GJEB 3IEAA 2H32B 4OLWL 2J25A 4GKSA 4TSAL 4CBZA 1NFKA 4ODTL 3NFSH 4YBLB 3TVMD 1JOIA 5EU4B 3U4BH 3MODL 4Q2ZA 1I9JL 3ARGB 2H2PD 3RL2A 2GTZB 5ESQB 4Y19D 5DEGA 4DETA 2G30A 4UM8B 2X12A 2Y5TB 1WZ1H 3NCXA 5KZCD 2CJUL 4MKTA 1ITCA 2Y6TE 2FCBA 5LBSL 2NTBA 4QF1A 1EUTA 3QWRA 4FFZA 1QFUH 2ZKXA 4XGZB 1Z3GH 2YFNA 2KZ1B 5HHPA 3QIBA 4U1HB 3KW8A 3Q8AA 3TEYA 4PJAF 4A2MA 5I1JH 5DZOA 3QFDB 2NYYC 2OJEA 4OVVA 5EU7C 5D2NE 4UT6A 5DHVH 4ZO9A 4KVPA 4JNXA 5DCCA 4NKIH 1YVLA 4LCWB 1IC7H 3SD5A 4QYOA 1CVRA 1PZ5B 1MWAA 2DLHA 2NY0B 4JS7A 1E42A 2ZP9A 5JHBA 4BFIA 5F6IC 4JRYA 4S1DC 5MEPB 1HHHB 1O7DE 4NZ8A 3HE6A 5TDNA 1JNHB 5I1HL 5J9PA 5KUKA 2F53B 2VBMA 1E6JL 5MHSD 2JE8A 5L9DH 3UL4A 1N7ML 3HZYA 4NHUB 3VFOA 3RI5K 4YEFA 1HE8A 1JZ6A 2I69A 1U9KA 5LWYL 1QLFB 3STBA 4LSUH 5CSZA 5DMGD 5FWRA 5KAQG 2AQRA 2VLJB 4L4VD 1KCLA 3OKEA 1P4LA 5GZNA 1IC5H 2YGOA 1J8SA 1FYTB 1WFJA 3P9MB 4XKWA 4FQLH 3WKYA 4JO2L 3T0EA 4OD1H 2V7NB 1TU2B 4CMMA 5D70H 4HT1H 3I6KA 5DHMC 1UD4A 1G9ML 5KSBE 2VABA 2QT6A 4KPHH 4DQOH 2KH2B 3FT2A 4FTVD 5BQDA 1V7ML 3WHE0 1N2RB 2R4SH 3MUHL 3C5SB 3V9CA 3BDXA 4PWIA 3TA4D 1OV8A 4MQXD 5HGHB 3W0WA 4EN2A 3CDFA 2D2CC 4RX4D 4WTZA 5D93C 2X38A 4OQTL 4NBYB 3NH7H 4MX7A 2MCPL 4HKXB 1CDIA 1LE5B 2X4RA 2C7FA 3WWGA 4JHVA 1BCIA 3VA6A 2Y5EA 4M6ML 2R0ZL 2XT4A 4Q9RL 5KYWB 2YZ8A 5LBGA 2LAAA 4UTBL 5KVDL 5D7JC 1RJYB 2DQCH 2FBRA 1GCYA 4OSUH 4CRPA 5F9AC 5HHXH 4W8QA 2Q6WA 4LL4A 3NESA 4DUWA 3ZOAA 1TQBC 5IQOA 2ADIB 4FABH 3UGEA 2YPVH 3JWOC 3PWUA 2NR6A 5E5LA 3WGVB 1JZ2A 1S9XA 5DEFA 3MGOB 1XXDC 4LRNL 2OR9L 4BQBA 3NN8B 4M7LT 5DD6A 4YFLI 1G7MB 1FGVL 1YYLH 2WLYA 2XY1A 3BI9X 3MBEC 4OZ4B 1UACL 2DQTH 2OCJA 4CJ0A 2AQTA 3N5AA 3NK3A 1I8LA 1TKWB 2WNKA 3OM3B 5IVXE 1MVYA 4NDMA 1I9RL 3SKNB 5D7LE 3TIEB 1AKJD 1FQ9C 1X4ZA 3GLDA 4LKXB 1SJHA 3U7AA 3BPLC 5JIDA 4PIRF 4OF3A 1C8PA 5IB2A 4OV5A 2K3TA 2AJ3A 1FO0H 5C0EB 1S3KL 1FNSL 2VDKL 2JNZA 5E1QA 2F54B 4M00A 1MEXH 3E8UH 1J5DA 4P5SA 3BN3B 2NTSP 4FNRA 4G9FA 4U6YB 4BZ1A 1UD6A 1OM3H 4R0LA 3MCLH 4NPYB 4IU3B 2D31B 4KJPC 1PG7H 3UPRA 3V6BR 3H4HA 1A6UL 4NC0B 4HWEL 3HE7D 5A2IH 5M7QA 3GMRB 3O4OB 4KGLA 5DD3L 3BZFB 3HFML 2PO6D 2XZZA 4Z7OE 3ZL4L 2WN3A 1ZHKB 3FTWA 5C9JA 2VDNL 4K8RH 5I82A 2MOVA 5BCAA 2K4AA 1HXMA 5C3IA 1EJ8A 4G5ZH 3QYNA 4RMTA 4Y9BA 5IBTL 1G7LB 3VFSB 1MY7A 2ZCZA 3NUKA 2BERA 5DT1L 2F0CA 2XBZA 4Q0XH 5BS0A 1XCTB 1CMOA 1I8MA 3BFOA 1U8OA 1NM9A 1G9EA 2H8PA 3TTYA 2VR9A 3LQAC 3RDJA 1SYVB 5MEOB 1UATA 1BZ9A 3ZPDA 5IQNA 4LAQL 1IZJA 4IRZH 2AQPA 2PW2A 1CICC 4JRXA 5CEZD 4JQIH 3ZDZF 4PP1D 5J6HA 4LP5A 3U1SL 2WLZA 3PABB 3F6JA 3SKJH 1KLFB 1T5XA 5HYIA 1R3HB 4G6FD 4I3RH 3DBSA 5FM8A 4EDWH 5CD5D 3BZ4B 2CAKA 2BK8A 1EH9A 4TS6A 2WZPD 4MA7H 1NZRA 1RZGA 5ICYA 1TNNA 4PJXF 3TEUA 3PS6A 5GZOC 4ZSOA 1CFVH 4UTAL 3M45A 1OGTB 3K8LA 3SE9L 4O02B 5DQ9B 1QRCA 4ZFQA 3WGUB 1UJ3C 5G2NA 5L6YL 3KZ8A 4M5SA 1A4AA 3C2AH 4XR8C 1A3RH 4N24A 3X12A 1J8HE 2YPKB 3PP4H 1A4KA 4LOFA 1I1FB 4AJ0A 4XP5H 1WQVT 2DD8L 1ZGLB 3MRKA 1YAZA 4L48A 5DA4A 3FAXA 3ZKXB 3IN0A 2WWOA 4XAWH 4M7LL 4DNLA 1G7PB 4MXQC 5CCKL 1BG1A 3O3EA 43C9A 5IT2H 1S5IH 1QR1A 3BISA 1JP5A 3DETC 3PPEA 4WFED 3VCLB 4Z7WF 1CXEA 3NFPB 4AIEA 1QAWA 1A7OH 5F0JB 3SY6A 1RY7B 5CLYA 3QRBA 5KBDA 1TSHA 2GG1A 3KJ6L 4KITB 3FKUS 2E8YA 2P48B 4NBZB 5ISZD 1TJGL 4IRJB 4WUUB 3KM1A 4D8PB 4XAKD 2CWRA 4TF4A 5F9DC 4JUSA 3O6ML 3POHA 2YPLD 5C6PB 4XN1A 3N1MC 3OF6D 3OR6A 2X4PA 3QXTA 4N0RA 2O26U 1LEKA 1ZEAL 3HAEG 5DJYA 1VB9A 2BMKB 3BDYH 1BQHA 4TNGA 1UADC 3X14A 4FNSA 1QQDB 3QPQD 5D5MA 2ZWNA 4K4KA 4LP8A 5EBMA 4M8QA 1LEGA 1YQ2A 3D30A 5F7EH 3KYNB 5JHMA 2AQ2A 3T8XA 2YKLL 1AO7D 2K8QA 4CVXA 4S1DD 3CFQA 3S3DB 2AJYL 3HG4A 1OSYA 4XI5D 3WEXB 2YAFA 2ARJA 1I7RB 3MRBB 5HYQB 4NAJA 4HEMA 4JJHA 5I17A 3PF2A 3UCRA 5I6KA 2K9FB 1ROWA 5DEJA 3FUHA 1CXKA 1M42A 4RRPM 3UTTD 3FB7A 2Y2WA 1CQYA 1OF2A 3CE1A 3H3PH 5B38B 4P46A 1HF2A 1YECH 1UZ8A 5J7CC 3AXLB 3OJVC 4JUTA 4KNTA 3RILA 1DBGA 4X7SH 1ZLWK 1M2VB 1TTUA 2Z8RA 5EUOB 1FG2A 1TOXA 2I5YH 5F7BA 1RWRA 2Z0BA 2WMPB 4PRIA 3QEHA 3QZOA 2CH8A 1YYMH 2WGNB 1RUMH 2QFRA 3JWNH 1NUDA 1QATA 5CF3A 4OT1L 1IGFH 5DVNA 5E94A 2FX9L 2IQ9H 2HXAA 3BQVA 4PB0H 1JD9A 3TVMB 2G9KA 4ZBJA 1F8TL 5C8JA 1U8IA 4XRCB 2BPBA 2JCCF 4Y19B 3WDJA 2A83A 4X4YA 4JZJB 4F20A 4AYFB 5DQJA 5KZCB 3BH6B 3LKOA 3HR5B 1C12B 5ES4B 2GQHA 3Q2CA 5DMKA 3QRGL 5I1GH 1RZ8A 3QPXH 4ZMZA 4P2QD 3P11L 2BNQD 2Z8GA 2FWUA 3ZVVA 5I1EH 3ZE2B 1M7DB 3IJ7A 4ICXA 1QFHA 4QHKJ 5FHAL 5AEAA 4IJ3B 4KI5C 3PRZA 2UZXB 3CN2A 1EJOH 2R2HB 2ZOLB 3MJ9H 2A2QT 3RTLA 3UX9B 5F21B 2E7HA 1MXGA 2EEDA 3U25A 3NIGE 3LZFH 4X80L 1S8DA 3RRQA 4JFDD 2KLSA 5AZ2L 4WWOA 1EEZA 3AADB 2VDRB 1RIVH 1JI2A 4OCSL 4TVPH 2XZAH 2A9MH 2JQMA 1KC5L 4YWGH 4LSDA 4OM1L 5CUSL 1ZE3C 1CLOL 5HJ3A 4FNQA 4I9XA 2Z65C 3SCMC 3MRRA 3INUH 3OXSA 1JGEB 5GGRA 5T5FA 1WS7A 3IJHB 3TCXA 3TO4D 4K5NA 3IDXL 1FSKB 2HG0A 1HHKA 1KLUA 2H45A 1FZJA 1NTDA 2IMMA 1E6OL 3OZ9L 4MMYB 2GJZA 1XF3B 4L4VB 3GBML 3Q6GL 3EAKA 4FG6C 1HL4A 5DA0B 4GMSH 2OMUB 1CFMA 2G2RB 1E8YA 3NIDB 5DS8A 4JPVL 2VDMB 5CS7A 1U8LA 2DLGA 2VKWA 3IXAA 1IEAA 3Q7JA 4JRXE 4FTVB 4I3SH 4Q6YA 1AGCA 2DWSA 2QJDA 3CFBB 3MRHB 1XH3A 1ZJAA 1A6AB 1MUJB 1BAGA 1WWWX 2CRYA 5C0DA 1ZVYA 2HSIA 2EXTA 5GGTL 3AG4B 3VI3E 1XZ0B 3MRQB 3VA2C 5EC2A 2B2XL 3UO8B 2HN7A 2QQKH 4KNQA 3ARFA 3ILPA 2JKJA 5DRNA 3C87A 2V17L 1MI5D 5D1XD 4K07A 3B1UA 4WDIB 4MDRA 2IH1B 1BBJA 3OLIA 4MYWB 4LLUB 1SYSA 3RA7H 4GRMA 4MB5A 3SEPA 5CXPA 3UCQA 3X13A 2P43B 3VI4E 3APDA 3QIUD 1NBVL 1D5IH 3E3QC 1A1OA 1I3GL 2FB4L 4YHPA 1O88A 2HVBA 3EOBA 4DK6A 1FA4A 3E1F1 2K6ZA 3V4LA 5JPNC 3WTSA 1BPVA 4J3OD 1O5PA 5KVFH 1MCBA 2CHXA 3LNGA 3DVGA 2OMTA 4AW4A 3CSTA 1VGEL 5B22A 3D85D 3DBXA 3QYMA 1I31A 3PDOA 4Q14A 3NQKA 4CL7A 1JVLA 1HJCA 2GVYA 2J1KA 4WI4A 4U1LB 4LIQH 3U2IA 2ADFH 3QI9A 4YS4A 4URKA 2ICWJ 5M95B 4OZYA 3FN9A 4JM2A 5K33A 3ZKMC 4H13C 3ULUD 4FXKA 2VZUA 5FX3A 2GK0B 1XGUA 1LGVA 3VWJA 4FMKA 2H0FA 4F9PA 5T3ZE 3LXBA 4FL4C 4GIPD 3OGCB 2Q7NA 3CU7A 4KKCC 4LBAA 4M1GH 1I4FB 1N26A 1RUAH 1YEGH 3MRFB 5FC9A 2EVGA 3JTTA 1G7HA 4BSWB 3K81A 2PW1A 3QIWC 3HOGA 4JPSA 5E99L 3SPCA 5CKAA 2FEEL 4A2GA 1MPAH 4PJIF 5INCA 5H2BB 1G1YA 3FOLA 3CXHJ 1J1XL 3MHZA 5EEVA 1A3ZA 2BOCB 1N5AB 1OPGH 5BV7L 1C5CH 3GIZL 1S7WB 3OHXC 4XNQB 4I89A 1HIMH 3MFFB 3NJJA 5EBGA 1OCZB 4O51A 3T77B 2VWEE 3HE7B 3CDZB 1JZDC 3IS0X 2E5EA 4JQIA 2AQQA 4X6CE 1BFVL 2PO6B 4R4NC 1C1EH 4X5RA 4ERSH 5I19L 1HWGB 1F90H 3MYJA 2NCEA 1V3LA 4JKPH 1CD9B 4OZFG 1I75A 3HHRB 3I2CH 3W39A 2UZIL 3DX7A 1KEML 1KXQE 3CDGB 5EO1A 3WJLA 3LXUX 4BDVA 4JY6B 2HCZX 1GAFH 4QOKA 4WWID 2F5AH 3NFNB 4UT9A 2WQWA 3MLTA 3BKMH 4O02H 2AJXL 2R1WB 2BSSB 1IGYA 2X1QA 1NIEA 3RWEB 5JHDD 2BM4A 2O6WA 3CVBA 5GQBA 4AZ8A 4AQEB 4DP7X 2EECA 3P3TA 2P4AB 3HZKA 5HYSB 1RVFL 3P4NA 3W5MA 3HC4L 3RVXC 1NAMB 1OCOB 2APFA 3CZUB 1HKFA 1F3DJ 2KKQA 3ARRA 3WJMB 4A38A 3GT6A 2BIQA 3MBXL 4PRIE 2MJWA 4UBDC 4DKDC 3IF1B 5JNYA 1OAJA 3EYUH 1X3DA 3ZYIA 1JV5A 3SE6A 4HPHA 3D39A 4G6FB 1N6VA 5IM7A 1FH5L 3CMOL 3MGTB 3NPZB 4LHQB 4X83A 2OP4H 3ECUA 4QLRA 1MJUL 1Y0LA 5GS2H 3V0IA 1E9QA 1LP9F 4GO6B 1NLBL 4PU2A 1A2YB 4L1DA 4AJYV 5KWYC 4PGJA 2EDQA 3B9AA 5F1NB 1SHXA 3DVNA 3D87B 3S88H 2Q2EB 3QVAA 4PGDA 3PXHA 1GPOH 3QNFA 3L3OB 4GW5A 3RPBA 1P2CB 4NQQA 1VBLA 2HJFA 2HPTA 2EE2A 4ENEC 1P9MA 2QTVA 2QGDA 4A7UA 2F5BL 2IOMA 4EUPH 2R2BB 1QUPA 3A67H 3GMLA 1S2EA 3PL6A 1ONQB 3MAWA 5GS0D 1DFXA 5MERB 5KG9B 1EJFA 4BQ9A 1QKZH 3O8XA 4ZFZB 2WXOA 3FTYA 3NCEB 4RMVA 4ZYKA 1P4BH 4UQ9A 2EXWD 2H32A 2FT7A 1AGFB 5ANME 4R7VA 1CR9L 3DX9B 4WI5A 4M1CD 1K4ZA 5EU4A 4KQ3L 3BMVA 4HCFA 5CJ5A 4PWKA 4C57C 5ISZB 4NUMA 2VN6A 3ARGA 4NPJA 2OMYB 3L9EA 2GTZA 3DGGB 3LN5B 2DL9A 4OJFH 4UM8A 5DC2A 2Y5TA 4K71B 2YPLB 1FZOB 4KDTA 1GHFH 3AITA 1T1WB 2J5WA 2ESVD 2ICWI 4X9HA 2EXYD 4YHMH 4XGZA 4XMXA 4I0CC 3OAYH 2J20A 4YHLH 4XZUB 1NCWL 3DTDA 4LARH 1PKQB 3WI9A 3SBWA 1IX2A 5JA8B 3AW5A 4QDGA 3WIIL 4BFBD 3LHAA 3KBPA 2I60H 1LMKA 4JFHE 4K3JL 3L7FA 2L7QA 3CVHL 1KJMB 1DQIA 2A6DB 4XTRC 4GS7C 3KVQA 1IQDA 5F6IB 1AO7B 3IDYC 3BAIA 3TP4A 3FYIB 1OT4A 1PZ5A 4IS6B 3BSZL 1XZWA 4D7BA 1U95B 4LVOC 3LQZA 2NPLX 4IIZA 1OL0A 3D5OF 3KPQB 3UTTB 5MEPA 2N59A 1HHHA 2F53A 3PJLA 2WWKT 3T1FB 3IGFA 5C7XH 5KBLA 2W1NA 1A3LH 1SXBA 3R7QA 4YHOH 1QLFA 3FT3B 1NMAL 1UOKA 1JNNL 3OJMB 2RJMA 3P9MA 5HJBA 1FYTA 4P9HC 3N85L 1MNNA 2NX5D 2CKBB 1F4WL 3IDNA 5LDUA 3FMGL 3CSGA 5CJXA 2V7NA 1TU2A 3MJ9A 3FFDB 2ZKHL 4PRPD 35C8L 3DX0A 2VXTH 4R90L 1BMZA 2G2NA 1N2RA 3EFDH 4POZC 4A7TA 2GJRA 1FE8L 3BO8B 4XPGH 5HGHA 1P7KB 3S4SG 5ENWB 4DEUA 1N9PA 1RERA 4HKXA 4QXGL 4X4ME 1FPTL 2ZCHL 2JB5H 5J6GB 1CLZL 4S1QH 2C26A 1AZCA 2OYMA 1TYJA 3D08A 3RX5A 2Y7MA 5JXAH 4BUGA 5KYWA 3CXDH 3EG9A 2E9GA 4XN5A 2BNQB 2EYTB 2CBOA 2D7MA 2GHZA 3BP5B 1RJYA 1FIEA 4U4BA 1K6QH 1JHTB 1E2WA 1ODAA 3QUXC 5GGVH 5IJBC 3SGJC 2VDMH 1QP1A 4LF3B 4NQEE 1COBA 3EUDA 5T1DH 3UGXA 3W81A 5CIPB 3ZKMD 2ADIA 1CI5A 2XQYK 3KPRD 3C75A 4Q4IA 1IA5A 1A7NH 5HJDA 4Z7NE 4A55A 4JFDB 3GK8L 3MGOA 5IHWA 5BW7A 1EGJH 3BUTA 3NN8A 1T0PB 2VR8A 4KKCD 1KGCD 2VZOA 3RURA 1KTLB 4M7KL 1G7MA 5DURD 2VJ0A 4OZ4A 2QVMA 4NX0A 3CX2A 3J7HA 3BPLB 1G43A 1UOLA 5EIIA 1TKWA 4JFZL 2FX7H 3MV7D 3TO4B 2NSMA 3BT2L 3N43F 4GSDL 3CZJA 1XL6A 4BSJA 1SUHA 1LVEA 3SKNA 3O6LH 5JIPA 4PQXA 3TIEA 2X2UA 4ETQB 4LKXA 5F7WC 2B0SH 3LZQA 3NCJH 3QDJE 4CVUA 1FDLH 1CYGA 1R4XA 2PWFA 3LZOA 1TJIL 4KK9C 4ELMF 3WFZA 4JDVB 4L8SB 5FK9A 2R1YB 5C0EA 1GGTA 5IHUH 3BCDA 1TETL 1OIOA 2F54A 4LCIH 4Y2DC 1E5CA 1A3QA 4R4ND 4U6YA 3GDCA 5JMRA 1RURH 4NPYA 4IU3A 4KZDH 3RU8H 2CHZA 3ZR5A 3EJZC 4HJTA 4JVPA 3GMRA 5TPWL 3BZFA 3GZPA 1MVUB 4R4BB 5FECB 1XB6A 3MRLB 1ZHKA 2CLRB 1OP3H 1ZVHA 2WXIA 2YUVA 2GJJA 5D1XB 1MI5B 5LNEA 4NRZA 3HG1D 5AB9A 4YC2C 4F1SA 4MTMA 3MOBH 2P8PB 5C97A 2QZ5A 1TYVA 4J27A 3QIUB 1G7LA 3TO2B 3VFSA 5ADOL 4FE9A 1D5RA 2J8UE 4NUJB 4XWGL 4WK4B 2Q1EA 3AG3B 4PY8I 1XCTA 4J2QA 3WFBH 2VSDA 4P4KD 2EILB 3A3YB 1JXKA 1WA1X 1A7QH 5GPRA 1SYVA 2WXFA 4ZI8A 3D85B 5I8KH 3F7RA 4RAVB 5FW6A 4F9LA 5MEOA 2DQIL 3BRDA 2WHVA 2YAMA 3BQUD 3QUGA 3IRPX 5DVMA 2DQFB 3TTSA 1Z7JA 2R8SL 4YZWA 4Y4FD 3PABA 1QI5A 3Q1SL 1KLFA 4XMLL 3UBXG 1R3HA 4G8IB 4I1RA 3BUIA 2EE3A 4YZ0A 3VTMA 3BZ4A 1JHKH 1UWEH 4WI0B 4JZNB 1LDPH 1YA5A 1NGWA 4G8EB 2V3DA 3OLGA 4OZGF 4X7TB 4TV3A 3EHBC 5DQ9A 4X99B 4PJ5D 4OH2A 1VCBC 2WD0A 4GPVA 4M62L 4HJUA 1GKOA 1NHCA 2XETA 4ODSH 5E8NB 1FVEB 5JHLA 5LG6A 3OJDB 2YPKA 2RD0A 1I1FA 6FABL 5C71A 1ZGLA 4K5MA 5HHVH 4GOSA 5CEZH 3SO3B 3UBGA 2XQBL 4FHJA 4NZFA 3NTCH 4PLKC 1SHWA 1T2JA 2NW2B 1G7PA 4QRBA 4ODXB 3JWNE 4LCWE 2JTDA 2P7TA 3MV8E 4EQ3A 3VCLA 4QXUL 2X0WA 4ANVA 4B3VA 3TFKD 3PG2A 4MD0B 3QJVB 2ZUVA 4KWUA 4HA1A 1KJ2H 1OSZB 1GY1A 5LCVA 1J11A 1URZA 4JG1L 4U0QB 5DHYB 4MZRA 5J56B 4IRJA 1I7ZB 2YARA 4A37A 3O6KL 3RVUC 5J1SC 2X89A 3BWAB 2OSXA 4WUUA 1GGCH 4D8PA 5JHDB 5CP7B 2LLNA 2YSTA 1CIUA 2XA8L 4B53A 4KJYB 2ITFA 2KC0A 3HLKA 5C1MB 2IDSA 4IYKA 1BQ5A 4XLAA 1PSKL 3GKWH 4LQ1A 3VFRB 2VLJE 2R56L 4XB7A 1BLIA 5GSVB 5TDPB 4LASL 5FF6A 2BMKA 5IREA 4JGNA 3MACH 4ZUTB 1QQDA 5AAWA 3T2OA 3NIFB 4FX5A 4M6OL 5HJGA 3JTSB 3KYNA 5KEZA 1GGUA 3KS0J 5AW6B 3SGKA 1PZCA 2FNBA 2H3NB 2O5NA 2PXYC 2NY4D 3MLYH 1IRAY 2D4FA 3C08H 2EH7L 3WEXA 3MRBA 1I7RA 4TVPE 5DFAA 5HYQA 1CFSA 1MFDH 4EOWL 4LU5H 3C8KB 3B9VA 3R19A 4R26L 5FYJH 3GB7B 4GRWF 3BP4B 5GJTL 4OLVH 1A8ZA 4ZMLA 1DQVA 4WFGE 2INUA 1AC6A 2FH8A 4RMBA 3NRPA 4N5EC 4NUQA 2VKXA 3UTPE 3QEUB 1J0KA 3U9UB 4X6DF 4N0YL 5EU6D 2WSKA 1O5DT 4PJFF 2F6AA 4Z7VB 5B38A 4BGDA 1QSFE 3B2DC 2R59A 1JF1B 1PPIA 3K4DA 3AXLA 3LIZL 3P54A 1J7VR 3WD5H 2DQGL 3N1GC 2BO0A 4FD0A 1M2VA 1ZT1B 5EUOA 4N8UA 2H3XC 4Y5YC 2ZYSA 4OGQC 4D0BB 3UZQB 1IM9B 3FB5A 4XVJH 1AIRA 1UGNA 1KYAA 1ES0B 1YY8A 4FRWA 5DRZB 5CINL 5I71C 4B5EA 4J1UB 3WOVA 3ZDXF 5I0VA 3TVMA 4B6ZA 2FSDA 1S7RB 4GUCA 4XXCA 4PG9B 4XRCA 2KT6A 2EC8A 4Y19A 3RFZB 1FGNL 4XC3L 5DZNA 3EZJB 2F8XC 5D7KD 1EZVX 4MHHG 4AYFA 2UWEB 3HR5A 1C12A 2ESVB 3T2QA 1T03H 4D9LH 1J5IA 5DFVD 1AOHA 1PAZA 4ANWA 3V4PL 2WQAA 4J7RA 1S7UB 4IJTA 2ED7A 5ILTH 1WCBB 1BQRA 1M7DA 4M3KB 2WXLA 2EDEA 2NY7H 3FTUA 5KVFE 2BNRD 5F0LB 4AGPA 2CKBH 4UINH 2VDOH 1M05B 2UZXA 4R7DA 2R2HA 2ZOLA 2CGYA 3PV7A 3S35X 4YXKH 4HPOH 3VTTA 3ZTNH 3ULVD 2GBAA 5DJ8B 4LIQE 2Z1KA 4BHUI 3RWIB 4LGSB 5JOPE 4PYGA 3TFBA 3RIKA 3LB6C 4L3FA 4Q6KA 3GJFB 1W0YT 2AVGA 5FPIA 2DM3A 3LJ3A 1REIA 3G9VA 4G8GA 1J5CA 4U1SB 4TTDC 2PF6A 1JGEA 3U0WL 3IJHA 4FQJL 5JR1H 2K70A 2WBJC 1KYDA 2HT4D 2FJHB 4NJ9L 3Q06A 5HY9B 1X5HA 4L4VA 3TS8A 2CA4A 1E8XA 3MCG1 3CV5A 1GS6X 2NX5B 5T3ZL 2G2RA 3QUZD 2OI9C 1ET8A 4P5MB 3QCTH 3PXJA 5CHNB 4PRPB 4OZHB 4XO9A 4FTVA 3ZE1E 2H9GB 1MFBL 2DW5A 1RLBA 3CFBA 2V5MA 3MRHA 4HWNA 3WJJC 1JJUA 1A6AA 4WJG3 1MUJA 2PYFB 4UOQA 2WKGA 3B7RL 4RX4A 3FF8A 4LCUB 4CAGA 1XZ0A 3QDMD 3VYNA 5EORL 3L1OL 3K74B 3HRZA 4N0CC 5EN2B 4QNPE 5LG1A 3MA9H 4K3DH 3FTZA 4WDIA 2IH1A 4LLUA 1QPXA 2DICA 4FKKA 1XT5A 2X42A 1T7VA 5IHZB 2EEFA 5HI3D 2DQUH 3CDYA 4N2EA 3TT3L 1ACYH 1J9TA 4HBCL 4ZUUA 4CA4A 1RPQA 3MC0A 1DO5A 1EDQA 1G6RB 3WSQL 3NFSL 1JPSH 3FQNB 1G94A 3FDWA 2HP4A 4ZZKA 2QGEA 4O58H 3BWUC 3U30B 3FPYA 2E7MA 5A7BA 3RJQB 3W37A 5HVHC 3WFEH 1ZV2A 2FGWH 3D9AH 1HHIB 1WZ1L 4U1LA 4FL4B 3QE5A 1EZGA 5D2LF 3VDBA 4YVNA 4BZ2H 2NZIA 4AMWA 2PN5A 1QFUL 3OKMB 1KIUA 5DURB 2CBTA 1Z3GL 2A74C 4LO9A 3TH0A 1GYUA 4JRWA 5IBLC 3S5LA 1JK9B 1TITA 3QUYD 1JCVA 1T20B 5C70A 5F71A 3BGFB 1AVAA 4PS7A 3ZQXA 5I1JL 3MV7B 4E9XA 3OGCA 2XACC 1I4FA 3LQAH 3F00A 3MRFA 4BSWA 1BVOA 4LMQI 1AKJA 5EZJB 5LGJA 4UNTA 3B8YA 1PEWA 3V6OE 5I75B 2NY1D 1IC7L 4TNWF 4URTB 5H2BA 2GC7C 2Q5BA 3CFTA 1BVNT 1N5AA 3WNLA 2X10A 1S7WA 4ZMVA 1DJYA 4ORGB 4OFIA 2H6PB 4XNQA 4L0YA 4WHTB 2CGRL 5GJSL 3EJSA 3MFFA 1WDAA 2NUPB 1MZYA 1OAZL 3HE7A 3AROA 3T77A 3CDZA 4XBPB 5F1SA 3NB2A 4RETB 3C6LC 4PHZA 2PO6A 2Z31C 2Z6FA 4HETA 3TPUA 2OJZL 3OV6A 1KF9B 4D7PA 1URIA 3KL3A 1FRGL 4CW1B 4AGMA 1GSMA 3N9GH 1IC5L 3CDGA 4OFKA 1E40A 4S0SD 5DSCB 4JY6A 5DZJA 3IVKB 4FQLL 2QVIA 2ODIA 3X1GA 2CM6A 3NFNA 1RUKL 5HVFB 1PZDA 5E08L 3RAJH 2X4UB 1SJEB 2BSSA 2R1WA 3I75B 3RWEA 4DQOL 3H0TB 4WW1B 2R4SL 4P4KB 4XNUH 3LKSB 3L54A 4AQEA 3FB6B 5HYSA 4DVBB 5KAQF 3SYJA 1HXYB 1HNGA 1NAMA 3RYMA 3BQUB 3BXNB 3VG9C 1W91A 1QA1A 3DDGA 4QRQB 3WJMA 4I0PD 4MD5B 1E65A 4HJ1A 2NUTB 2XSKA 1FLRL 2PXYD 5FYKD 3IF1A 4JN1H 3V6FB 3BW9B 4Y4FB 5E9NA 3EQOA 1FN4A 1Z6JT 2OA9A 4CU6A 1L9OA 2VLRD 3RG1C 3MGTA 3ZKNC 3VSQA 4YGAB 2NT9A 2WZPA 1P7BA 3R0NA 1BECA 4Z7QF 5EO0B 2O0WA 4KUCF 4OSUL 1A2YA 5HHXL 4ZUWA 3KYKH 2DQDH 4M43L 3PCYA 1UD5A 3GXUB 1D9KA 3ISWA 1Q1JH 5I1LB 1OK8A 3ATAA 3KVDD 4PJ5B 4IOSD 2YIHA 2Z1PA 3L3OA 4JQXA 1LMIA 4JFOA 1MCHA 1NOAA 1GZQB 4K5OA 1U8PB 3FQ4A 4JLRB 3OMZA 3AZUA 3TYGH 1AZVA 2OXGB 2R2BA 4KDVA 4XBGB 1AJ7L 1ONQA 1G7QB 1ZLSL 4Q52A 5MERA 1RXLA 5HD8C 1OZTG 5KG9A 5BRZA 3HVNA 5CP3H 5IW1B 1LILA 4ZFZA 4HKZB 1TO4A 1UWXH 3WIFB 4U2ZA 3T3MF 3T0DA 4BKLB 1LXMA 5DUMH 3EDEA 1P5VA 2VDLH 1EBPA 2AV7B 4ELDA 1B2WH 1DVXA 1AGFA 1WFIA 4Y5VC 3F84A 3DX9A 3GM0A 1FO0L 1YNKH 5ID1B 1AZBA 4P59H 4JVWA 4PMFA 2VXSH 5ISZA 2C9RA 1MEXL 3E8UL 2OMYA 1TTBA 2DIJA 3DGGA 3IGUA 3LN5A 4PM1A 5FUCE 4AYEC 1OM3L 3MCLL 3TWYA 1PG7L 1T1WA 1GTNA 3OF6A 4N5UA 3I6GB 3M8OH 4HIIA 4OCMC 1IO4C 1KV3A 3UPCA 2BP5M 4ONFH 2KLTA 1JDAA 4TNWK 3DC0A 2G0KA 4XZUA 2DRUA 5L8JB 3B6SB 3KD4A 4Z23A 3DNKA 4LCVA 4W9LC 5TQ0H 4RMUA 4NZRH 3DUHA 3LRLA 4G3YH 1O8GA 2WXQA 3QZMA 4G5ZL 2ICCA 3SSGA 1KJMA 2A6DA 1X5JA 4HJGB 2BX5A 3STLB 4WSGA 4BH7B 2DMBA 1AO7A 1SOQA 4F2MB 2NY4B 3LZRA 4BQ8A 4Q0XL 1BN8A 4IS6A 1U95A 2JK5B 1YDPB 1X6LA 2VFMA 4NWTH 4BCYA 1VFOA 2ZCLL 2CR6A 2WBJD 3KPQA 3UTTA 5I8OH 4IRZL 4XMKH 4EIGB 4XNZB 4PTTB 1KN4H 4QRRD 4MAYC 3RWHA 5EU6B 3T1FA 4Q6IB 3T1WA 3PYCA 2ZX5A 4HUUB 4WWKC 1UQSB 3DHPA 3KLSA 5E2VH 2E7LC 4DKTA 2DWEB 4MNGE 4I3RL 1YNTF 3FT3A 4RVBA 1AQHA 4EDWL 4X8CA 3QZNA 2JLPA 3FRUB 5BVJB 5B1BB 3VSTA 3IBEA 3T2LA 3AREC 3QFJE 2YEZB 5IP4A 1M9SA 3FFDA 2O6CA 2XWEA 4P4RB 3AAZB 1ZE3H 3HPLB 5A7EA 1E9OB 4YDKH 1WA0X 4L3AA 2FEJA 1P7KA 1TPXB 3C2AL 5ENWA 1A3RL 1FORL 2MNWA 5I73B 5CJBA 3ZDYB 3PP4L 4DIXA 4NQSB 1W72B 4HV8A 5GS1C 4XP5L 1J5OH 5J6GA 2ZWZA 2D0GA 3UAFA 4XAWL 4XO3A 5HSFA 1OEZW 1PKOA 4PJ6A 3ZGHA 4F33A 1OK0A 1OW0C 1S5IL 1XO8A 5IT2L 4P2QA 3QR0A 2EYTA 4AY0A 1D6EB 1T7YA 1ZDSA 3BP5A 3OPUA 4ZX6A 1A7OL 3FO0H 4FQ1H 2R0WH 4HJJH 4ENZA 5IJKC 4XNFA 1N64L 2BNRB 4PJXB 3JVGA 3ZJAA 1P7QD 2O6FA 3MNWA 4NN6C 32C2A 4FCHA 2X70B 4LF3A 3EYSH 5EOCJ 5CIPA 2CNZA 4RSVA 4UDUB 4MDJB 3ZUCA 1EHLH 2N7BA 3DK2A 4OFPA 2W95A 4ZMPA 1H5BB 1K5NA 4JFDA 2V5IA 3H9SD 2DWXA 3RVVD 1AZZC 2WTOA 1BD2E 4OJOA 4GRLD 3SGEI 4RGOH 2QV2A 1KTLA 5DZ9A 5IW6B 1RP8A 2A9NH 2QV4A 5DZLA 1BJ1J 5E2UH 5KOVC 2B14A 1HQ4B 3TO4A 1OTTD 1BF8A 2IGLA 3ZLQC 3Q48A 1KXTB 4WHDA 4JKNA 3VGGA 2LVEA 4EIBA 2O61B 3D50A 2VJ8A 5F7EL 1AHWA 1BSIA 2AK4D 2CUIA 2Q0ZX 2YMOA 4IOFD 4ZS7H 1KBBA 1EXUB 4ETQA 5B8CC 3FHEA 4QRUB 1RLWA 1G6RH 2UUDK 1FG9C 1BJMA 5LGHH 2O6PA 4JDVA 4L8SA 2R1YA 1N67A 2CD0A 2D4DA 3QUZB 4RWYH 3VGAC 5JA9A 1ETA1 3UG5A 4HD9A 2B5IB 3MVSA 4YSEA 3B9EA 3TM6A 4PN6A 3GDBA 4MKMA 2ZZUT 5C7ZA 2WLLB 4H2AA 4A63A 5T5NG 2F2HA 2F61A 4YC2B 3H3PL 4F7PB 1MVUA 5FECA 1YECL 3QDMB 2Q7AA 3MRLA 1CDCA 4Y4KC 4BFJA 2CLRA 2ZKWA 1AG6A 2IWGA 4KTDL 4X7SL 3T2PA 5D1XA 1MI5A 3H2WA 3H9YA 1B4RA 2P8PA 1RMFL 3QIUA 1YYML 1UM5L 3QW9A 3PAVA 1RUML 3RUGB 5AVRB 3TO2A 3V10A 4DGIL 1T89C 5H37H 4OF0A 4HHGA 4NP9A 4PG2A 1QRKA 1IGFL 5IMMB 4MCZB 4I4WB 4Q7DA 4PB0L 4YHZL 4KXZI 1I3UA 5SWQB 4LSTL 4MAUL 4F8LA 2IMNA 1CC3A 2OSWA 3D85A 2ZYIA 5CN2A 3GBEA 4RAVA 3IMTA 2WAHA 1QCXA 3WY4A 1EV2E 3UBFA 2DQFA 5E9DE 3GYRA 2ATKB 4KFZC 2EDWA 5I1GL 5ALBH 4DP2X 3QPXL 2HRPH 4G8IA 5LQBH 3FTGB 3AQYA 4R7NB 3QUYB 5L88H 1DLHB 3U2SA 3VD3A 4BKSC 2YFOA 5I1EL 1INQB 2H1XA 1IM3D 5BPPA 5EBWB 4WI0A 3R7RA 4HCRA 4GT7A 4FYRA 1UB5B 3DIVA 5FYJE 2WO2B 2YPLE 4G8EA 1IBHA 3REVB 4NWUL 2NY1B 4X7TA 4MSWA 4PJGF 4OUUA 2BINA 4ZFOL 4JREC 3LZFL 4LNRA 4X99A 3OWRA 5E8OB 3UERA 5B3JE 3T08A 5EU7E 4JDTH 1OGPA 5EU5B 4U4IA 2Y2TA 3PNRB 1LLWA 1PKQE 2GTQA 1FVEA 1X6NA 4HISA 5JLVC 1G7JA 4TVPL 3OJDA 2XZAL 5CGYC 1WEJH 2F7PA 4EEEA 4TYUA 4YWGL 4AYDC 5D1ZC 2V5TA 4PW4A 3WDHA 2YZ1A 3BAWA 2NW2A 3INUL 1RULH 3CUPB 4ODXA 1GGYA 1G7IB 5FUOH 3QQ4B 4OJ6A 2AQSA 1TQVA 5T33H 5FR3A 2PYHA 3DI3B 3C5ZC 1JYNA 3GRBA 4H8UA 1VA9A 4MD0A 4HEPA 4RIRB 5L8KB 3I3BA 1OSZA 3G5VA 1TXKA 3H6AA 4R9HA 5DHYA 1OF0A 3S3JA 3H7BB 1MCIA 3BWAA 5JHDA 2Z8WC 2LOEA 1P5UC 5CP7A 5ACLA 1NUGA 4I3SL 2GIMA 2JJSC 4FDWA 4KJYA 1AMXA 2AVFA 4OI9A 4MQSB 5EULV 2GFBB 2ZXCA 4L5FH 4KV5F 3VFRA 1TQCC 3PREA 5GGSY 4Y9CA 1QNIA 2OULB 2HA1A 5GSVA 2CUMA 2QQKL 3BPNB 3G5ZB 4I0PB 1FLTX 2H0JA 1NDGB 4QXWA 3LEXB 1IGIL 4W4NA 4ZUTA 3J27A 2PXYB 1NUNB 5ELIA 4AE1A 1WHPA 3APFA 4R84A 2W88A 3KLQA 3RA7L 1HCYA 5CP3A 2VLRB 5I0ZA 3JTSA 4B9GA 3GBLA 1A9BB 4C4KT 1QYGH 2H3NA 1BFTA 5I9QC 4YDVB 3QUMB 3LEVH 3SHSA 2JKNA 1O6VA 2VFPA 1XH0A 3QJXA 5KVFL 4C4BA 4MAYD 4XP6L 1CI3M 3VD1A 1D5XB 3C8KA 2ERJC 3IMUA 2FUQA 2YMTA 4WWKD 3GB7A 5T1JA 3BP4A 1OAXL 3AU1B 3WEMA 2GUYA 4H8VA 3HMWH 4LIQL 3QEUA 4WVRA 4KGJA 2BNQE 1Q9OB 1ZK9A 2ADFL 3OMAB 4N2DA 4Y5YB 4Z7VA 4GP4B 4B41A 2VSKB 3KWWB 2C4FU 5HDBF 2KZBA 1BVKB 4OD2B 1OFEA 1HOEA 3KHOA 4G72B 3NP3A 2OW7A 4D0BA 3UZQA 3GRWH 1YEGL 4WTXA 4Z05A 4EXPX 3V0JA 3OKYA 4GXFA 1DANT 2B59B 4FKEA 1ES0A 3WNNA 4KC3B 5DRZA 2ZNWA 2O30A 2NW3B 1TJMA 4J1UA 3ZE0F 1BVNP 3A6CL 2MTPA 1OPGL 1CTNA 3N40P 4NO2A 4NQVB 1SDAB 2NXZD 1MJJB 4PJHB 3RFZA 3EIFA 3CH1A 4KZEL 1JFHA 2UWEA 2OBGA 4P9HH 4E41E 1DJZA 4S1SH 4G42B 2AV1A 1WT5C 5CBAB 1RQ5A 2NY6D 4PJ8D 1B88A 4YDNA 1F90L 1KTDB 1S7UA 1H9VA 4JKPL 1WCBA 1KJ3H 4UM9D 3I2CL 5DHEA 3LD8C 2ZUQC 1M05A 2JQAA 3BDBA 2N0KA 4AC2A 4JFXB 1U0QA 1GAFL 3IS1X 1ZLWH 3VFVA 3ARQA 4ANXA 3BKML 1BAFH 4O02L 1JGVH 3PE9A 4EKXA 3RWIA 4N4YB 3HUJB 2YD6A 3QEGL 4BEIA 4ZMTA 1H8NA 1TVDA 5HVWA 2WBJB 3GJFA 1W72H 3QARA 2BJMH 5BRQA 3NJGA 4XX1E 5CU9A 4QRRB 3ZQWA 1A7PL 1NFDA 2FWSA 1XSOA 4U1SA 2MEJB 5IB3B 4EIZC 3EYUL 3RX9A 2GYSA 4N22A 2X9YA 1TZ8A 2VC2B 2QBWA 4XXWC 4AQ1B 2OI9B 3WKMH 2JSFA 2FJHA 3L3JB 4LXFA 5HY9A 3MJGX 5JIQA 2P5ED 4BBWA 2IBGA 3JYBA 2OP4L 4B0MM 1CD1B 2NX5A 4TNVF 5HDQH 1B3IA 2AJSH 2FR4B 4OM9A 4P5MA 2E86A 2XZQH 1XG2A 3B5HA 4PRPA 4OZHA 3O3BB 4NQDD 3DIDA 5CHNA 1PXZA 5CMAB 4YZFE 2WXHA 1I1AD 2OK0L 1GPOL 4UZSA 1N59B 4YZQA 2WZ5A 2ZXWB 2NNRA 4XMZA 4ZTEA 2PYFA 3GBNH 4MLSA 5DYOB 4PIBA 1JXFA 4P2RD 3V55A 2ILLA 1KIQB 2JKXA 4LCUA 3MFGB 4FKHA 2TSAA 2Z3FA 5AW5B 2EE0A 3A67L 3IGAB 5EN2A 2UX6A 4EZKA 1NCDH 5F1IB 1R3LB 2X1OA 3V4VH 5BQ7B 3KE0A 1GW0A 3FO1B 5IHZA 2PPEA 3C09B 3MOAH 3GO1H 4FG2A 4W6WB 3HN3A 1P4BL 1ZTMA 1CE6B 5HVHB 5CGTA 4UWQB 2EC9U 1XBRA 3U6XS 2TRYA 4P8QA 1G6RA 1HEJC 1P7QB 4YGVB 1KJVB 3TH4T 3FQNA 2EVFA 1EZLA 2DEYX 4H8HA 4PUBL 2BCMA 2IDCA 2A74B 3KPRA 3MV9D 4LKCB 3QO1B 1HHIA 3H9SB 3OWEA 3MNVA 4IIQC 4GRLB 2YR3A 3CN1A 4FFVC 4YHML 2RFXB 2Q3AA 4WHCA 4YHLL 5DXWA 3ZR6A 1JK9A 3T0XA 1T20A 1E5YA 4RSYA 4WJ5B 5IQLA 3MV7A 2BVPB 4L1SA 5D7IE 1F2XK 1BJ1H 1N3NB 5E8EB 1EA9C 2I60L 3DPDA 5DJ6B 1QA2A 1Q4NX 4DEPC 5BV7C 3D4CA 3I9GL 4WTZG 3GBDA 5CGYD 5D1ZD 3QDGD 4NK6A 3OG6B 2J6EH 1S7XA 2B1AH 2WUBL 5DWUL 3HFFA 2XN9D 4ORGA 4HLZH 4TULH 3RGBA 2H6PA 1Q8MA 1QASA 4PSPA 2NUPA 4L29B 4FI8A 4XBPA 2A3TA 4DAGH 5CLWA 5JIMA 1IBGH 4B9KC 2QQNH 1F13A 2OL3H 3WUWB 1DBOA 1QPPA 4DN4H 2ADYA 1RJZB 2I27N 3SZ6A 4DKAA 5IR1B 1YNTA 3O2DA 4CW1A 1BMWA 2JKWA 5LHDA 2OQJB 3HG1A 1FIGL 1IB4A 2AQ1A 1MHHB 4NC1C 1DJSA 1RZJC 3FQWA 4PJ9C 3WN5B 1OLZA 2I24N 2V5SA 2X4UA 1A47A 1SJEA 3C12A 3I75A 4GB9A 2VXTL 2J5LC 4P4KA 5GIRB 3CVCA 3EFDL 2EDNA 3LKSA 1HL5A 3OR7B 4L2YA 4NO5B 1RPKA 3MLRL 3B5GA 3MA7A 5JZ7C 3FB6A 2QHRH 3QUHA 5HDLA 3TBWB 5AKRA 4RZKA 3BPOB 3BQUA 3BXNA 5EU3B 4AGNA 1TTCA 3GHPA 4XWOD 4QRQA 4TNVK 5C0RH 2JI2A 2NUTA 3GQ8A 2ZG1A 3V6FA 2GJ6D 3BW9A 1YEIL 3K6IA 4Y4FA 4DCQA 5JXAL 3CXDL 1UXSA 1IL1A 4U1MB 4E9YA 4CMHC 3VMWA 4GAJH 1K6QL 5ANHA 5EO0A 1UYWH 3HI1B 1IUZA 3NACH 3J2PA 2AQNA 5F6HI 1CLYH 3G6JF 4G80B 3VXMA 5I1LA 2ESVE 1OM9A 4FG4A 2LHAA 4PJ5A 1A7NL 4KI5E 1K8FA 2ZUTA 4BH8B 1EGJL 1KB5L 1GZQA 4HUWB 2IALB 3ECQA 1AP2B 4Z03A 1U8CB 4JLRA 1L0YA 5F96H 1FFNB 5F7HA 2OXGA 3D8MA 2V33A 1QLRB 5E0QA 5FYKH 5AOZA 5JW3L 1G7QA 1AR1C 4PJEB 1BQLH 2YS4A 2FX7L 4Y5VB 4MYPA 4J3UA 5IW1A 4R96B 4HKZA 2F9BT 2XC8A 3WIFA 3O6LL 4IKIA 4BKLA 1BOGB 4XCYA 2AV7A 4LMQE 3NCJL 4ATTA 1FDLL 1SXNA 1TQSA 2P28B 2Y7OA 4AMKL 4NUPA 3V8OA 5ID1A 5EWIH 3QEQD 4ZPVB 4AEFA 3HMXA 4A2EA 5FUZH 3WMSA 5B39B 5IHUL 1T83C 4LCIL 3KRGA 4XPFH 4OJ5A 3GSUA 3L7EA 1CDUA 2NT6A 4O4YH 4L1TA 3ZGIA 1RURL 1QOKA 2NNAB 1TTRA 3KPOA 3OAZK 1IC1A 4WFHD 3RU8L 2DJMA 4H8WC 1Q9LB 3I6GA 2AAVA 3CCHB 4EZMA 2F74B 4PJDB 3AXIA 3LRGA 3NRQA 1DBMH 4BCXA 1LYQA 1CL7I 4JGMA 2BS8A 1WD8A 2L0DA 3AWGA 4KKAD 4QRPD 1JTPA 3TF7C 2YK1L 3EYVB 3MOBL 3W9DB 4ELMB 3GRWA 3AU0A 3STLA 5AKTA 3ARZA 4BH7A 1NJ9B 2ZP8A 3Q44A 3SPIA 4F2MA 3PV6B 1DBBL 2IADB 1IAII