3VSUA

The complex structure of xylc with xylobiose
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
638
structure length
638
Chain Sequence
b'MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 240
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsuA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsuA01
4M56A 5I24A 1GJWA 4XKWA 1JG9A 2NT6A 3A21A 3VGEA 3ZT5A 3WDJA 1AVAA 4KMQA 3DC0A 1PLUA 3OLGA 1DTUA 3GBEA 3KWXA 1JI2A 4TVUA 3IJ7A 3EDFA 4JL1A 3WY2A 3EDDA 2X6YA 1MW1A 3L2MA 3VO0A 2OW7A 1QWNA 2FH8A 1UH4A 3BUIA 1R75A 1XCWA 3GXFA 1AIRA 4XB3A 1MWOA 3BVUA 2XN2A 1BAGA 3BAXA 3TTSA 1O8IA 4FNUA 4XLEA 1QI3A 4Z06A 4X9YA 2ZX8A 3GBDA 3HG4A 4J3XA 3ECQA 5HPOA 3VGDA 1JXJA 1V3KA 3EJPA 1R47A 3CGTA 4W8RA 3WY3A 3EDJA 1QJVA 2VNCA 1JDAA 4AYSA 3L4TA 3L2LA 1PZ3A 2Y2WA 2ZUVA 4XOTA 3BUDA 2AAAA 2GUYA 4YZQA 2VJIA 2F18A 4WSKA 1V3MA 1OGOX 2NT0A 3UERA 2PWGA 5E0FA 4JFSA 1KTCA 2ZUTA 1EO7A 2VR5A 1R34A 4XLFA 3A22A 1VIWA 1U30A 2QX3A 1WE5A 3CC1A 3CZKA 5A2CA 3L4YA 2DH3A 2D3LA 1XG2A 4NXKA 3ZO9A 4DO5A 2QY1A 4J3UA 4LXFA 3CV5A 4BA0A 1OFMA 5AMVA 1B2YA 3CZEA 4OKDA 1KCDA 2Y5EA 3A6OA 3BH4A 4X0NA 3GQ7A 2BHYA 3BVVA 1JIBA 1JFHA 3UG5A 2QPSA 1XH1A 3FW6A 3WY1A 1OGMX 3H53A 3LRLA 2CHNA 4J3WA 1ODUA 3BVWA 3ZOAA 2DH2A 1K5CA 4XORA 4YZ0A 1HTYA 3RIKA 1IB4A 2XIIA 1IZKA 2WSKA 4UQEA 4ATWA 2OW6A 1IDJA 3FY3A 5I23A 1KGWA 3A23A 1QHOA 2F7RA 5A2AA 1OGSA 1JDCA 2YOCA 3ZT6A 1CGWA 1BG9A 1WPCA 3L4ZA 1PZ2A 1MW0A 2PYHA 1XD1A 1ZS2A 3L4VA 3D4YA 4MR0A 6CGTA 2NT9A 2G3MA 3BAYA 2QLYA 3KL3A 4FLOA 1CPUA 2XVLA 2F7QA 5C1EA 4DO4A 1O8JA 1V3JA 1MFVA 1JTAA 4GI8A 4GINA 3K1DA 1EO5A 3D4ZA 1G94A 3H54A 1UA3A 1XH2A 2J25A 3VM5A 1JL8A 3LMWA 4PSPA 4CKQA 2PWEA 3H55A 2OYMA 9CGTA 1VB9A 1OT1A 4OJ5A 1HL8A 4AW7A 1J0JA 1ZJAA 2EQDA 2QV4A 1OT2A 1VAHA 2BHUA 1G9HA 5CLTA 2WANA 2NZMA 5E6YA 4HP5A 4FLQA 1CGTA 2ZXDA 1LWHA 5E9AA 1PE9A 2XN1A 3BMVA 3L4UA 1XD0A 4EW9A 1WO2A 5CGMA 2ZX9A 1RWRA 3GXMA 4AYGA 3BLKA 2G3NA 1PPIA 1WZMA 3LPOA 3HZ3A 1OFLA 2XVKA 1H80A 1HNYA 3BC9A 1IV8A 1PJ9A 4H8HA 4J7RA 1KTWA 1PEZA 1SMAA 2YJQA 3DX2A 4H8UA 1VJSA 3BUPA 2D0GA 4AEFA 1HX0A 4U49A 1D3CA 1KXHA 3WNLA 4XLCA 1NOFA 2CXGA 1RP9A 2VUYA 1UKSA 2ZWYA 3BUBA 1UOKA 3CZNA 3DX0A 1QI4A 1IZJA 4GO9A 4JFVA 1TQWA 1TQSA 3EJRA 4GI9A 4U2ZA 5CXPA 2VBMA 3IJ8A 4U2YA 4PMHA 1QW8A 1GVIA 2ZWZA 3TTYA 1RMGA 3ZR5A 4E2OA 1KWGA 1NM9A 2UVEA 1CGVA 2ZUUA 2D0HA 1OSEA 3BSGA 3HG3A 4JL2A 3VM7A 1BN8A 2BXZA 3DHPA 2X6XA 3LRKA 1VFOA 2YA1A 4GKLA 1PS3A 1XSIA 7CGTA 4PEEA 1TMQA 3ZT7A 4DO6A 5CLWA 2X2HA 1KCLA 1CXKA 2E8YA 2ZE0A 4W93A 3WNNA 1O8MA 1RP8A 4OJLA 3AMKA 1SZNA 4Z03A 1WZLA 3LRMA 2YA2A 3KE0A 3LXBA 2FHBA 1KBKA 4UQDA 3BVTA 2ZICA 3EDKA 2WPGA 3VX1A 3MI6A 3SUCA 3VMPA 2WVVB 1UA7A 3DX4A 2WVSA 3IK2A 3DHUA 4U31A 5F7UA 4Z05A 1KXVA 4MB1A 2ZUSA 1KB3A 1JF5A 2QMKA 4NZFA 2DIEA 3EJQA 5KEZA 4J3TA 1PAMA 2D73A 1G5AA 1XSKA 1TQVA 1CXIA 4JFWA 3UG4A 4YZAA 2WCGA 2QXZA 1E43A 1UD3A 4UQAA 1EA9C 3AJ7A 1KGUA 3IGUA 4JCMA 5BRQA 3WEMA 4UZSA 3KL5A 4UQCA 4J27A 1CGUA 1OOCA 1BPLB 5A2BA 3A5VA 2E8ZA 1B0IA 4B9YA 1O8EA 1E3XA 2XVGA 2VBKA 1KCCA 3S5YA 1KBBA 3ZQ9A 2BY1A 5EMYA 3WEOA 3FAXA 1E3ZA 1VFUA 4JFTA 2NT1A 2F7OA 7TAAA 2V3EA 2GJPA 2V3FA 2O1DA 4OJOA 3GXNA 3VMWA 3CZSA 1UD6A 3WNMA 2XWDA 3GQ8A 4XL9A 1TCMA 2WVTA 1Z32X 3BAJA 2EACA 3GXPA 2O0WA 1IA5A 2XN0A 2NSPA 3ZSCA 1OB0A 2FYVA 2EO7A 1QI5A 3WDIA 1HXKA 3II1A 4OJ6A 3M07A 1XSJA 2YFOA 1R33A 2WKGA 3KEHA 3ZSSA 2IGTA 1KXQA 3B8YA 2O0VA 4M8UA 4XLAA 1WMRA 1C8QA 2TAAA 3K8KA 3L4WA 3EQNA 1AQMA 4OZZA 1O8FA 4XONA 4WLCA 3VMNA 3EDEA 3DDFA 4HWVA 4U33A 1BVNP 3CLWA 4W8SA 3LXCA 2PYGA 2ZUWA 2WNWA 3BAIA 3W37A 1CIUA 8CGTA 4FLRA 1Q4NX 3WENA 4GI6A 5E1QA 3VMVA 1HT6A 1R46A 2ZX5A 4FNRA 4YELA 2VRKA 2OSYA 2YKKA 2ZX6A 5TD4A 1UH3A 3KLKA 1CYGA 2BSPA 1U2YA 4LQ1A 4NXSA 3UG3A 4U3CA 4XKVA 1UD4A 4GQRA 4XOPA 4URRA 1DEDA 1AQHA 2X2IA 2XIBA 2EAEA 2Y24A 4J3VA 4CGTA 3JURA 2Z8GA 1CDGA 1KGXA 3EQOA 2EABA 4UZUA 4XN0A 5DFAA 1CXHA 1HL9A 3VX0A 1CGXA 2Y4SA 1CXEA 1BVZA 1KXTA 3HG5A 1MXGA 2C7FA 1ZJBA 3WY4A 1O8HA 1MXDA 1CLVA 3CPUA 3ZSTA 5HXMA 4H2CA 1RU4A 1O8KA 3VGHA 4NX0A 1DBGA 1JDDA 2DIJA 1CZFA 1S46A 3QGVA 1AMYA 4FLSA 3WMSA 2OSXA 1MW3A 2AMGA 1JI1A 2BY3A 4H8VA 3RILA 3DDGA 1WP6A 3D52A 2ZX7A 1M7XA 3AXHA 4HOZA 2VT0A 3CZLA 5E6ZA 2NSXA 1GJUA 5A6LA 1QWUA 3LPPA 2CPUA 3VGFA 3WFZA 1XV8A 4AVZA 1O8GA 4XNFA 1W9XA 1GCYA 2PWFA 1UASA 1BF2A 2ZIDA 4UQBA 3UCQA 3GQ9A 4FNPA 2EWEA 4XN3A 2UVFA 3BLBA 4WF7A 2VRQA 3AXIA 3K8LA 1BSIA 1QCXA 1EH9A 1PIFA 3GXDA 2YA0A 3GTNA 3WNOA 4MAZA 4U4BA 1XH0A 3OLIA 3VMOA 4AIOA 2NTQA 1HVXA 1VFMA 4UOQA 3B4NA 4OJYA 1QW9A 4AIEA 3UW0A 1X0CA 4OIFA 1CGYA 4H7VA 1UD2A 4C2LA 2FE0A 1J0HA 4QAWA 3BCFA 4J28A 1VBLA 1BHEA 2EADA 2D0FA 3A24A 1A47A 4CN1A 4LPCA 5E70A 1DBOA 2X85A 4AMWA 2WC7A 2V3DA 4GO8A 4J3SA 3EJTA 1DHKA 1EHAA 5CGTA 2WVVA 4AMXA 2ZXQA 3B90A 2BXYA 3KL0A 3WNKA 3HG2A 4JCLA 1U33A 5BRPA 2O17A 2VBEA 1I75A 2INVA 1JF6A 4W8TA 3LX9A 1M53A 4PCTA 3WN6A 2ODLA 4OGZA 1QHPA 2FH6A 3BMWA 4OZYA 2WCSA 3A4AA 4XLHA 1UKTA 1V3LA 2WSPA 1UD8A 4FNTA 1WZAA 3CTTA 2WVUA 2D2OA 1EE6A 3BUQA 3S2CA 2X6WA 3LXAA 2X2JA 4XR6A 4FNSA 4NZJA 1JRGA 2YFNA 4HPHA 2PECA 3EJUA 4W8QA 4XQFA 3BLPX 3A47A 2YIHA 1J0IA 2OYKA 1JAEA 2PWDA 4FNQA 1H3GA 1GQ8A 2FHCA 3UEQA 1UKQA 3GXIA 2NSTA 4NK6A 3EJSA 3D50A 3VNYA 4OJPA 2F2HA 3S5ZA 2QPUA 2D3NA 3IJ9A 4AEEA 3D51A 1WZKA 1RPKA 4GIAA 3ZR6A 4WSJA 4UOZA 3BSHA 1KTBA 2GVYA 1JGIA 3K8MA 1JXKA 2F61A 3FAWA 3GXTA 2BHZA 4UNIA 3VSTA 4NK8A 1CXFA 3VSVA 3VU2A 3ZPPA 1BLIA 1UH2A 4YZXA 2X3HA 2GJRA 3TOPA 3T9GA 2E9BA 1O7DC 2O04A 3GRHA 1HWWA 3BCDA 1O88A 3VGBA 1P6WA 1QX1A 5A6MA 3HJEA 4NI3A 1UD5A 4PSRA 1SMDA 2EEXA 2OYLA 2ALWA 2FHFA 3WDHA 2NTPA 2EJ1A 4BZYA 1XGZA 2C8NA 3BAWA 3CZGA 2NTBA 4B9ZA 5I0DA 3DX1A 2QMJA 1KWKA 4MXNA 4YEJA 1PIGA 2F7PA 3GQAA 2ZXBA 5I5RA 3OLDA 1E40A 1QPKA 2BY0A 2INUA 4UQ9A 1T0OA 4CN4A 5HDRA 4I84A 2XWEA 4PCSA 2F1AA 2E0PA 4HOXA 2IQ7A 2E4TA 3DX3A 5C1CA 1PXZA 3OLEA 1KCKA 4HA1A 1MVYA 2WKLA 3VSUA 3WELA 2OSWA 1IDKA 3AMLA 2ZXAA 3WNPA 4GQQA 1MW2A 1XCXA 1NHCA 1J0KA 2VJJA 1CXLA 4FMVA 2BY2A 2PWHA 4HOWA 1JD7A 4JFUA 4KWUA 3KLLA 4CN6A 1HG8A 4CVWA 1Y7VA 3KRGA 3TONA 1L0PA 1D7FA 3W38A 1G1YA 3VGGA 1JD9A 1O8DA 4XMYA 2FGZA 1LWJA 2Z1KA 1TQTA 5DO8A 3BAKA 3BVXA 3TV8A 1O8LA 6TAAA 4XM3A 3WWGA 4UCFA 1MFUA 3VNZA 3L4XA 2F1BA 1TQUA
chains in the Genus database with same CATH superfamily
1EEUA 3BWAB 4EDXB 2VWEC 5D1QE 1PFOA 4LE8A 2K7PA 3ZT5A 3GJFK 4M7ZC 4UOW1 5ES4B 1IJNA 4ZUUA 3QQDA 1BGXL 1C5DA 3D18B 3LMJH 3RUGF 3CVIL 1BW8A 1T03L 1A4KA 1E9QB 2PTUA 3BUIA 1AZUA 2YN3A 2Q8AH 2P5EB 5ISZD 2XWCA 1ULVA 2E7DA 3ZE2E 5I1DB 1MCPL 1RFDL 2FRGP 2K3HA 5T5NF 5T3XL 1O8IA 4QRFA 3A4DA 3RGVA 1HHHA 3EH5B 2VUOA 3ECQA 2YZ8A 1VDGA 3V4PB 3HN5A 1UXMA 1P6AB 1SY6A 4G43B 4Z77B 1OANA 3N44F 1A7NL 1B9KA 5L88H 5CNHA 1NMAL 1FRGH 4ODSH 4N6RB 3HNVH 4W6WB 3DETD 1CFTA 3F7VB 3DV4A 3SY0A 4X5LA 1UWGL 2PP8A 3RVVD 1U3HB 2I26N 4JANA 1R34A 1VESA 2X3BA 1F3JB 1G7JB 1NCAH 2ED9A 1EWHA 2DMKA 4XCCL 5A2CA 4F33A 1WZ1L 3SDDD 3QUXC 4WWKC 3KMDA 1TYVA 1ZLVK 2Y22A 1NC4A 2X4UB 4KKRA 2ARJB 2XWBB 1OFMA 3O6FD 3D7PA 4MZIA 4QY8A 4O51B 4X4ZA 1ZT1B 3A4EA 1KBVA 4BA8A 5JPMA 5C0GA 1I9IH 3H53A 3H9SE 4DP5X 3LRLA 1E27A 5DVPA 4HT1L 4GRLC 4D8OA 5EU6B 3D1MC 5DD3H 3ORJA 5C08E 4CU8A 1IB4A 1PDKB 1T5KA 2IFFL 2VW7A 2EE3A 4MMZB 3I6LE 5I23A 3E6FA 4JDVB 3T0WA 4NM8L 4XPBH 3CSPA 3QNZA 1T5WB 2NY3B 3TL5A 5DMKA 5GSRB 1JWUA 2FQEA 4LQFL 4OZHA 2KLTA 2HG5A 5MENE 4JM4L 3T8VA 3ZTNH 4ACTA 1U92B 4D0BA 1HINH 4ZQKB 1BM3L 4NZRL 4HX1B 4LT7A 5GRJH 4JN2A 4RWYH 2AVFA 4Z7UE 4G9FB 4LMQI 5L2KD 1DN0A 1V3JA 3ARVA 4J8RA 3WJMA 2KLRA 1BZ7A 4BFOA 3QYNA 5TDNA 4P4KA 3NCMA 3R1GL 3L9YA 3VD1A 3GGWB 2JKTM 4GKZB 4JDEA 5HGBA 2K45A 1J0JA 1E0OB 4HJSA 1ZK5A 3ZDYE 1Q9OA 4KGLA 1YNLL 1QSEA 1LMKA 4KJYB 5CEYA 1BCIA 1TYXA 1CQKA 1LWHA 3LEVH 5KVGE 4NO0B 2ZWLT 3CVHA 3FCSB 3CQQA 1NL0H 3G5ZB 1MN4A 2XSKA 4LLQB 5I1CL 5D2NA 4HWNA 1MFDL 4OI9A 3SPJA 4QLRA 2XTSA 1CYWA 3AQYA 3OGCA 3NK4A 1H6EA 2MTPA 3NEEA 5EBMB 2ZOKA 2FWSA 5ETUA 2AITA 1SOSA 2WM0A 3BUPA 3T0EE 2NXZD 4P46D 1EHKB 2D0GA 4PP1D 3LZNA 4RRPM 5HHPA 4NQEB 4MKMA 2Z3FA 1JPST 1LTXA 1ZHLB 2VLME 3NRPA 3GWJA 5DZVA 5B8CC 4ZBJA 3DX0A 4QI3A 4GS7B 5AL0A 1S7QB 4YSTA 1MLBB 4N8CL 3FCTA 1NFDA 4UU9A 3S3DB 1F6AA 3DVFA 4U3SA 5GGVH 2OZNA 3TNMB 1ETJA 1MDAA 4F8OA 4ZRGA 3Q8AA 1QD0A 2CDGB 1TTFA 2FQFA 3K2UH 3MLRL 4JZOA 1V55B 4U1SA 4ZXBB 5I30L 5KYXB 3H56A 4PR5B 4QIRA 1KB5H 2C9QA 3LH8A 2X1QA 5D6DA 1FFOB 1VERA 2ITDB 2CG9X 5JPNC 4NRXA 3AMKA 3D69A 2BVEA 5F7EL 4NN7B 1ACYH 5E4IA 3EDKA 2K1MA 4KNTA 1UQSB 1I1AC 1MNUL 1WT5A 3LKQA 4OCXH 4Z7VF 4FHBD 4EDWH 2HSIA 3BDYH 1T1ZB 2DQJH 4YH6A 3T77A 2HWZH 4U31A 4N2MA 2MKWA 5EZLB 2GTQA 1KB3A 1ES0A 2DIEA 4N20A 4HWEL 2H3XC 2XTJE 2AEPL 2V5YA 3AY4C 4JK0D 4W9FC 1IGCL 5JA8B 3U9UB 3LN9A 1DBBL 4PJAA 3I6KB 1SQ2N 1NFKA 1NDTA 3WJLC 1T66C 5AW1B 1Y6MR 3S34H 5D7IF 1E3XA 1EHNA 1FHNA 1XMEB 5TH2A 1ZGLA 3UFIA 4QWWC 5D7KD 4GB9A 2J44A 5EMYA 1TTRA 3KPQA 4NKDA 1E3ZA 4YOKA 3EYFA 4NPYA 3PWPE 4MXQD 4OJOA 1CTOA 1PKQB 2CZNA 4RZCB 1I4FA 3JZ7A 3SDXF 3MCLH 4S0HA 4FADA 4JO2L 1RIHL 2HTKC 2VMFA 2VXQH 4IMKA 3L3JB 1Q72L 3MJ8B 3TCLA 4FZ8L 3F2LA 1QA2A 4Q58C 3ULSB 1I7UB 3SQOL 2J72A 1TU2A 4Q9QH 3IMRA 5ITFB 3WAKA 4POYA 4Z7OF 1LEGB 2DQHL 4ELKA 3BRGC 5C9JA 3FT0A 3BIBX 3N43F 3DVNA 1BM7A 2IWEA 1RIUH 1FNLA 3NPSC 2IOOA 5F3HB 2O0VA 1V7NL 3MV7E 2QYUA 4JQIH 2CMRL 5JR1L 5JYLA 4XONA 3RBSA 1DJXA 4XCFL 5T3XD 2BZDA 5FGBA 1S7TA 1SEQH 4H4NA 3LNDA 4WHDA 1TVBB 5EZOL 4M8RA 1OP4A 3AREA 3S3CB 4MQXC 5A16A 1MRDH 3FMGL 3OKEA 4U0RC 4N0FA 5DC2A 2X89A 5KW9H 2PTTA 2ZX6A 2A6KA 3VB8A 1QLRA 3ARDC 4LPYA 3RPIA 4PJDF 4XMKL 5J06A 3WFDL 1H5BC 3FCBA 1VCAA 3FTWA 5DMJB 3QIUB 5EF1A 5IIEB 1KGXA 3EQOA 4G8FA 4ZMWA 1CU4H 5KVEL 1FGNH 2EIZA 3H2PA 5DJXB 2AQ2A 1TQBB 3QEQD 4J4PA 4EOWH 4R9HA 4Z7WB 2OK0H 3DOSB 1DZ0A 3QJFA 1UB5A 5SV4A 4PJ9C 3VXSA 3TT1L 3R8BB 3OPUA 1MOEA 35C8L 3RL2B 1AIZA 4NHUB 3LZLA 5T1LB 5C8JB 2DIJA 1DQJA 3F7QA 4ODTL 1VGKB 3SYQA 2WKOF 1BFVL 3GMMA 4ZYKB 4BSJA 5C2UB 4P57B 2CLRB 5KBLA 4K7PX 3GRWA 4HUUB 3TEZA 1JPGA 1P7KB 2VLRB 3AXHA 3QWOB 4KKPA 1MF2H 1A6UL 2F5AH 2N56A 1UZ8A 3C2AL 4OGYH 1MFNA 3K46A 1BZOA 3RTQD 1FN4B 4OQTA 5FKAA 3KXFA 4UQBA 3GQ9A 5B3JF 3C5JA 5DSCA 1FIGL 1G6RH 1U3JA 1A7PH 2GB2A 1IBGH 5KUKA 4Y4KB 4OUUB 4JPSA 3BGFC 4YLCA 3GTNA 1FYTA 3HZMA 3UJJL 1SOXA 1E5AA 3FTXA 3C87A 2A1WH 3D08A 1BF5A 1V7MH 1HE7A 4HCRA 3SOBH 1JUFB 2BJMH 1WAAA 4RAUB 4U6TA 3RDTA 1G7QA 2IH1B 3DI3B 3LIZH 1OGAD 1R4XA 3QC5X 3VFMB 1KOAA 1WFUA 2QELA 5A1AA 1E28A 3U0TB 4S0TD 4U3HA 2IXQB 2L7EA 1IIKA 4FJYA 4WNQA 5IHZB 3PYCA 4Y1SA 4OCRH 3KYOB 1G9NH 2GBTA 2XA8L 3KYNB 4L8DB 5T1KB 5L9DH 3JWDH 3FUHA 2XQYA 3QVAA 5CGTA 4QRUA 3WNKA 5IQOA 1E2WA 1E50A 3VAEA 5BRPA 3DRTA 2YS4A 4F7MB 2X4RA 1TTGA 4NJAH 4QTFA 4NCDA 4OFYA 4P23A 4QMEA 1RSFA 2VM9A 3A4AA 3CC5B 3ISYA 5JMRA 2V2WA 3CTTA 4KK6C 4A63A 4JFDE 2X2JA 2VN5A 2NZ9C 3KPOB 3TJEH 5JHAA 1JRGA 4KO7A 4EI5B 1A6VL 4HC1L 4IW4C 2H8PB 2DWYA 2FIKA 1TFHA 1J1OH 4ORGA 5L2JB 3UEQA 1KZYA 5EN2B 5T3ZL 3VI4A 2JELH 3C60C 3DRQB 4JM2B 3S5ZA 2V9RA 1CD1A 4GQ9H 2G3XA 5J5EA 3MGTA 4FL4B 3F64A 1LVEA 2MOVA 3PL6A 2Y6SD 1XGPA 1QFUH 1FPTL 4B6ZA 1RZIA 4IKNA 4UDTB 4YPJA 5IMLA 2YEVB 1T66D 1WBZA 2X4OB 3M17A 1JZ7A 3NCWA 3NACH 5T1JA 4P2RD 4PG9A 1VFBB 2QVKA 3BAEH 2XY1A 3GMRB 3H2QA 3MZGB 4MAYB 4ZS7L 1NKGA 3DJZA 3QFJB 4CW1B 1ZEAL 5HVHB 4GBXB 1P6WA 1OF2B 5A6MA 1S7VA 3RUGB 1PW3A 1CF1A 1LO4L 3NEXA 1XF1A 5C0CB 4B9JA 1UD5A 5CIPA 3V9FA 5IV2B 2YD8A 2D03L 4LCIL 2C1PA 2ENYA 4Z23A 5IUSA 4BZYA 3EHBB 3B5GA 2LAGB 1E4HA 2ZWKA 4FULA 4UANA 2WUBL 4A2MA 1XFPA 1O9WA 2WXPA 5DZLA 2ZKHH 4PBXA 5F9JB 2BHFA 1I1FA 1R3HB 4LHQB 4WV1A 5ELIA 3WS3A 2DAVA 3TCTA 3UBXG 3LN5A 4PS4L 3N44B 1PVHA 3A0OA 3BH9B 4AQ8A 1T0OA 3GI8H 5CZXC 3NCJH 2NX5D 2F1AA 5IB1A 5C3LD 1JZJA 5I2IB 1O9VA 1MFCL 5DURB 3GT6A 3RYMA 3ARBD 2A73B 2QEJA 3PJSB 2BVTA 3VACA 1IFHL 5LUMA 2MWCA 3RAJH 2F53E 1MW2A 3ZTJG 2ZUQC 4NJ9L 1DQIA 3REVA 1JD7A 4HOWA 1JGVL 3MV9E 4QHMB 4I5BB 3FB6B 3S7GA 2VZ3A 4CVWA 3VFVB 3ARDD 5FW7A 4RQQB 1P7QD 1FO0L 2XZAL 4L1HA 1C16B 4LGPB 3U2JA 4MBOA 2W88A 1NUGA 4XP6H 4FA8A 4L37A 4TKWA 3V6ZB 4Z8FH 3N1MC 1I7ZB 4N4YB 3BPOB 5HHNA 4L8CB 1E4XL 3ZHNA 2NXYC 2UZXA 1TENA 2RFXB 3NP3A 3QCUH 2FX8H 3TBBA 1BX2B 4JY6A 4KMQA 1PLUA 1OV8A 1FNGB 3IAQA 1F1GA 2DZEA 3KWXA 1B2WH 3BZ5A 4AT6A 3BUYA 2IO5A 3ATFA 4ONOA 1PD0A 2R0ZL 4KX7A 5D2LE 4YDLB 5IEHA 3BHBA 3N1GC 3ZZLA 1HHGA 2WLYA 2PCFB 5TPWL 1RJLA 1DEEB 2WMPA 3CIQA 4X5XA 4PJ8A 4K0OA 4R3SA 3TBYB 3ECBA 4KMLB 1JXJA 1FORH 2FEDC 3PABB 2CO4A 1P2CB 3ES6A 2AV7B 3WY3A 4BRJA 1AGFA 4JPVH 3UCRA 3IFPA 1DQKA 4P5MB 5D7JD 1FFNB 4UAHA 4F9PC 2AAAA 3O81A 4YHKL 2I25N 3SPVA 5HBBA 4WSKA 3HNTH 1GYVA 1J05B 4JFSA 4U1NB 5IWLC 1ZHNA 3IGLA 3IPBA 5TE6L 4WEBL 3ULVL 1I7TB 3LNHA 3NGBC 2YR3A 4P2OC 1XF3B 2BW4A 1U8QA 4PGBB 1GYWA 2XQBL 1CYXA 3T65A 1ILSA 4Y5YA 3NESA 3V10A 1IAMA 1KCVH 3K2MC 2WQRA 3X3GL 2AK4A 5BV7L 1AGCA 4KTDH 5E8EB 3NSJA 1MCOH 5HHMB 3P2BA 1LEKB 4OZGA 2APVA 3HE7A 3PWUB 4AVJA 2BS9A 1U42A 3RWGA 4R83A 2B5IB 2DH2A 1K5CA 4OCSL 2FO4B 2XT2A 2BM7A 4KV5E 1NIDA 5JQIB 3DKHA 1G87A 2UXGA 3KW8A 2WYIA 4XH2A 2Q10A 5FGCE 5IHWA 4J12A 1A4JB 2YWZA 1T6VN 4L0YA 1Z1WA 1EAPB 4XP9H 2VDKB 5LXGH 4ODWA 3SGEH 1L6PA 1UJ3C 1N9PA 3OSVA 1ESOA 5DZAA 5TF1H 4PLKC 5JQ6H 4ONGH 3NSCA 1IM9A 4TQPA 3O6KL 4K3DL 1KBWA 5DFTA 1LE9B 2VMJA 3ZN6A 1DO6A 3KYMA 5E6UB 2MQGA 3WHE1 1O7VA 1P5UB 2C1OB 3KM1A 3TF7C 4GI8A 5CBEA 3WN5A 3U2SA 2A77H 4Z7VB 1GTNA 5BPPA 4FQQB 2I60L 5AVYB 3ZXAC 4GKSB 1RZKL 1TR7A 2FT8A 4JFFD 4M48H 3T04D 5CP7B 5H4YA 1BQHB 1UHVA 2EQDA 2GK2A 4I0CC 4MWFB 1EFXA 4JLRA 4KK8C 1F97A 4TXVB 1YVLA 4FLQA 5DHXB 2XPGB 5TJWK 4OLVL 2XN1A 3TXAA 1EXHA 5EZJB 1S8DA 4LLWA 2ICCA 4M93B 2DQEL 4N8PA 1RWRA 1GYAA 1ZSDB 3CCHA 3N6YA 5D1XC 1EBPA 2UUDH 4JFOB 1LO3L 2EO9A 1H80A 4BCZA 3MRKA 1JWMB 2XQ0A 3KGSA 4QRQB 3E8UH 3W1ZA 1OAKH 2NSQA 5D7IB 1MCNA 1N8ZB 2DI7A 4AM0Q 3MRPA 4G8IB 5CN1A 3WIFB 4G82A 3BD3A 1WWCA 1BBDH 2CIIB 5CUSH 3CFJA 2ZZUT 4QRPB 3MRIA 5D1ZI 5IQLA 1UURA 3E6HB 4I1RA 5CZXD 1RZKC 3SDXB 3AUWB 2Q7NA 2WQWA 2VH5L 3RX7A 5SWSD 2VERN 2OLDA 4L29A 1A3LH 3FHQA 3O4LB 2HJKB 4KU1A 1KJ2A 1AACA 3CSYB 2HRPL 4Z7OB 3DIVA 2LT9A 3Q8EA 1F4YH 3N43B 2GEEA 3WTYA 4ZFOB 5JHDD 1NMBL 4IRJD 4Y4HC 3SODB 4HFWB 3BP6B 1KXQE 1KCLA 1E4JA 1EDQA 4UV7H 3UTTB 4M7ZB 5FYJH 3DO7A 3DJTA 4PG2A 2XCMC 1BEYL 1JWSB 1ID2A 4KTGA 1BXXA 1PU0A 1RUPH 5IB3B 4N22A 2F58L 1RAMA 1AZRA 1JV5B 3DIFA 3NFPA 4MJIE 3H7BB 1UA7A 2NXYD 3CHSA 1RZ8A 4QT5B 2Y23A 4WFHE 3MNZB 3I84A 2BWQA 2EUXA 1RZ7H 4HEMA 4ZMLA 4CVUA 4NNPL 4V1DB 4DAGL 4PJDB 4JR9L 4KZ0A 5IVXF 1XT5A 5T33H 1XF4A 2Y7LA 4WO4C 4JFWA 1SY6H 4XGZB 5JOPE 1QSVA 4JO4L 4X6FB 2GTWA 1KBGH 1X5YA 2FJHB 4H8QA 1Z66A 5D9SA 4FFTA 4K23H 4IBWA 3HZKB 3US9A 4HLJA 1WC7B 3ZDXE 4AMKL 2NQ3A 2OM5A 3GIVB 3PDOA 3ZBMA 1A25A 1U3ZA 2PYED 1PZUB 4OCWH 5E1GA 3L16A 4WFED 4JRXD 5F88B 4AXWA 7TAAA 2DM7A 2VL5A 3QUXB 4OH2A 3ENEA 4WWKB 2EIKB 5HHVL 3X12B 5HDLA 2XPYA 1X4XA 5JOFA 4O2FB 1Z32X 3W9DB 2JCCF 1PMYA 3OKMB 1NL0L 4N8VB 1S5HB 4L9LC 2KL6A 3F84A 1SJVA 2I5YL 4JFZH 2A7BA 2WWKT 3D39B 1YEKH 1S4IA 3QHZH 4G6JL 4GRLB 4P2OD 5L0QC 3ZSSA 3EBGA 5F6IC 1D2OA 4YFLF 3KPLB 3DXAB 3ARGC 4NENB 1F0LA 2HMID 4KJWD 4P0DA 5E2UH 2TAAA 5EOCJ 1RUAL 2RHEA 4XNZC 1Z7JA 4WDIB 5FF6B 4AEHH 5JNYB 3K71A 3OAYH 2UZYA 4WLCA 1YEDB 1RUKL 1SJMA 2KQNA 3IN2A 2Z8SA 4OD2A 4P59H 2YMXH 2PYGA 5F8RC 1J87A 3QDAA 2RQ8A 3AXLA 4K3EH 4XVSH 3AFLA 3U1SH 4PJBF 4J3OF 4AYDC 3BRFA 3LTVA 2P9RA 3VD5A 3PWLA 2VRKA 1I1YB 1NPNA 2H6OA 3NCFB 3SIKA 1GMEA 3DV6A 4NXSA 5AYQA 4BGDA 1BREA 1UD4A 3P9LB 3ULVD 3GZOA 4HWBL 4U6HA 4PVMA 2X6CA 2DQIL 1FC1A 1W8OA 1CURA 4M7LT 2QZQA 3BDXA 4N87A 1FVCA 4XPFL 4L1TA 1F90H 3JWNH 3IJEB 3C5SA 5EOTA 2MCPL 4AGMA 4OCXL 4GH7B 4QDGA 3IMBA 2HT3C 2KT6A 5MERA 1AHMA 3CVHH 4QCIA 1TF4A 3K1KC 2FUTA 4G8GD 1DQLL 2MPAH 5C0BB 3SE8L 4E41B 2VFOA 5F96L 1W6LA 1NAMH 2ZYIA 1KUMA 2WJ5A 3DDGA 4QPEA 3QDGE 4WFGE 1KCSL 4F15B 2WLIB 5A6LA 4X6DF 5A2LH 3RTLA 4ZTPH 5ILTL 1XV8A 2X09A 4N0CC 3BP5B 5HHXH 4X80L 1ZHKB 3INUH 2YGOA 4KZDH 1IVLA 2UVFA 5B8CB 3SKJH 2YAFA 3KPPA 4HIEA 2AJSH 4NIKB 2ICEC 1FGVL 3NQIA 4X8GA 1JMZA 2NNAB 2CR0A 1IAIH 2RCSH 4X6CE 5DJAA 2D4FA 4AIOA 3BGMA 3GJFA 4D9RD 2OA9A 3NRFA 3L9RB 4KX9A 1QW9A 1ZLSH 2PR9A 2ADGB 4OLZH 3WFCH 4W4OA 3F58H 3PGDB 2VXQL 3LKSA 3Q8BA 3L1FA 3WHXA 1IBDA 4AGLA 5DU7A 1HYSD 1QAWA 1ZIBA 4UIMB 3CX5J 5JPNB 3X1NA 2OMZB 5I28A 2YGQA 5IW1A 4CC4A 4TN9A 3F01A 3MQIA 4XN4A 4BSVB 1I1AB 3EJTA 4QLWA 3NJMA 1R5IB 2ZXQA 3KJ4C 4X4MA 4JQIL 2FDBP 1SPDA 3ZZQA 4HULB 1UWYA 4C47A 3QNFA 4GKOA 3F00A 3EJZD 3WXWH 4PCTA 1WGVA 4MCYA 2CRYA 2FH6A 4G8EB 3CSTA 4EZLA 2AQQA 2LAAA 3OSKA 3ARZA 3H3PH 4L8BB 1E8YA 1H6UA 1U8CB 1WICA 3BUQA 3IU3B 3LKRA 5AVQB 1DFBH 5TF0A 4XR6A 3HE6A 1VEMA 3KBEA 3ML8A 2P47B 3NIGE 4NGHL 3FHAA 2PECA 3EJUA 2EEAA 3VFWB 3MLSH 4B9KC 3AS0A 1VGEH 1WTLA 4IIQA 3HRZC 3OD3A 2F2HA 4X4YA 4DSYA 3CH1A 2ODIA 4BK5C 3LD8C 4P5TA 1CDUA 3RWCA 1NDGA 1BQSA 3OHXA 3UZEC 4UINL 3I6SA 3NRQA 5D5MF 5BNXD 5CD3A 2ED8A 3QEHB 5D7LB 5FV1L 3RI5F 4DPRA 2QSTA 5BRZB 4QYOB 3O45A 1ZT7A 4H25A 4LDOB 4XI5D 4BIKA 4MA8H 3RHWF 1E5CA 4G7YH 3TOPA 3WIIL 2PUQT 1NGYA 1RK7A 2EIMB 2H6UA 2E7CA 5T5FL 2J7LA 3O4OC 1JNNH 2FSDA 2OX5A 3NPSB 1QX1A 1UUNA 1EZLA 4JJ5A 4LFHG 3VDBA 3P69A 4ES9A 1I9EA 1H9DA 1CI5A 3U6RB 5AVSB 4X6BB 2QGBA 1BJ1J 4NKOB 3QEGL 3QUZC 1AXSB 5I82A 1TXKA 4Y2DC 4KRNA 4O02A 4BWUA 4JY5H 1ODAA 5FECA 3KYKL 2B3IA 4U0RB 4XBGB 4OLXH 1SFDA 1XGQA 3QZWG 4XCEB 5EBWA 1YJDH 2A1WL 4TULL 2Z31D 3JT2A 1PYWB 2J43A 2MRYA 2E0PA 4HPYL 4MD4B 4NWTL 3L3OB 3KPRD 1H5BB 2QHLA 2XIDA 4KI5E 2Q8BL 3WELA 3DJSA 5BXFA 3D87B 5E8NB 4JDTH 1I82A 3SCMD 1G84A 2DBLH 4HV8B 1Q0XL 4YDKH 3NTCL 3TS8A 1CIDA 4HDIA 5CLYA 2WIIB 1G9NL 3CHQA 5EBGA 4ZPVA 4GG6A 3LXUX 4PJ9B 4L48A 4OB5H 3WAJA 1JFQH 2BOBA 5JLZA 5JMCB 1A6WL 2YD9A 5L8LB 2UWEA 3FQUB 1ZS8A 2OMXB 2Q20A 1NGWB 4R96A 4N2DA 4B27A 1MJUL 2FWOB 3GRWH 3L4XA 4J6IA 3GB7A 3V6OE 2QQLL 4ILDA 2DQUH 1D9KA 1DSFL 3PGCA 4PRNB 3P4MA 4TPRL 1H3PH 1ZK9A 1Y1UA 3TJEL 4C56A 4D94A 4XKWA 2HT3D 3MRCA 3CDZA 3GBEA 3JYBA 5TDOA 3PRZA 3UTSD 4OQTH 3W39A 1IKFL 3C9NB 3MJ6A 4GUPB 4K7PL 1EZGA 4AZ8A 1MW1A 5TGBB 4D9LH 1NFIB 4KKAC 2I7OA 3BGFB 4PIBA 4GQ9L 3ZE1E 4EZMA 3FTYA 4XB3A 1MJ7L 3DX8B 4D0CB 2VISA 2WNKA 1ZA3A 4MMYA 4XLEA 1X5KA 3P73A 4MVBD 4HCRH 5AOIA 3FONA 3MV11 2FZ3B 3MTXA 4KQ4L 4BD4A 4LRIA 5DJYB 3RBGA 2HLFD 5D4JA 4I3RL 4NN5C 4A7QA 3V8OA 4XN2A 4ONHA 2DM2A 3ZL4L 4PRHA 4JAMB 4Y16C 3GUTB 4M6MH 4YZQA 2NDGA 3SQBB 2R59A 1KTCA 1FFPB 2AJUH 2X0VA 5IMMA 3BQUB 5FHAH 3MHZA 4DIXA 3ABZA 5K9OA 3FHEA 4XVUD 1LK2B 1SYVA 4XP1L 3U30C 1UCBL 4AQAA 4F7PB 3KH4A 1U8PA 4PGZA 4L3CB 4GUOA 2VJ8A 3NA4A 2R2HA 3G04B 3SN6N 1KCDA 4F8NA 4L8SA 5EUKB 1KJVB 1YQ2A 3OB0K 4IGBA 4NQCB 3VFNB 4TUKL 2G30A 1UM5H 4K5OA 1MHPH 4ZD3H 4JGNA 4NZTL 3QA3B 3GHPA 4IYKA 4HMEA 3C60B 5H94B 3BVWA 2P5WA 5CKGA 3STZB 2FX9H 1A7QH 2EDNA 1DO5A 2XI9A 2G2RA 3IFOB 4HVBA 3RIKA 5DHYB 2WB1A 2WSKA 2ZNXA 1HILB 2OW6A 4G3YH 4Z78A 2V2TB 5C0AE 1DQQA 2J3SA 4UBDC 1JTTA 3EFOB 4PMEA 1YNKH 3M1BB 2W81C 2P8LA 3RA7L 1F1AA 4A6YA 1K2DA 2PCYA 3NAWA 2B1HH 2NY2C 2P42B 3BKYH 3EJCA 3JWOH 4WW1B 2XN9E 3NAAH 3KEDA 4YSRA 5LCVH 3OG4B 3VWKC 2GJ6A 1CD8A 4XMPH 4DO4A 4Z8FL 4CILA 3KG5A 1NAKH 1F4HA 3OKOB 5E2WH 1JTAA 2DWSA 2OTUA 3SE3C 3FYEB 3SZ6A 2C3VB 5C07B 2ZOLB 1KN2H 3V6FA 3A67H 3LMWA 4GSDL 1VZIA 5CIPH 1Q0YL 2OYMA 4OJ5A 5AW5B 4AW7A 2YD5A 3MRLA 5E95B 3TWYA 2BHUA 2R2BB 2J4WL 5ALBL 5DRNB 2WUCH 5A2IH 2CDEB 3LEYL 3BN3B 3BP7A 1XDTT 4OD1L 1KXTB 5LWYL 5FA3A 5IVXB 2VFQA 3WFEL 2R1WA 4HXBL 1RZQA 4LSDA 1YMME 1JZHA 3V7AG 2R4RL 3ZMNA 2XKUA 3MYJB 4EUPB 3QUYA 3QR1A 3L5WB 2CKNA 3QUZD 1FORL 4Z7IA 1XTMA 4HH9B 1CDBA 2VLJA 4MB4A 5F1NB 2ZKYA 4WI3A 4MCNA 4CNIA 3K4AA 3PNWB 2J8UF 3FBKA 4B3VA 4L3ED 4PFEA 5KVGL 2ZUQB 1YLBB 1S9YA 1X6LA 2NYKA 3EOBB 2WBJA 2ZF9A 5L7XH 1WRFA 3RU8L 3HKZA 3U1QA 1FLRL 4S11A 3FN0H 2JCCB 3VXUA 3AQDA 4WW2A 4PTUA 4ZSOE 1MEXH 5KSUA 3BT2L 1N6UA 1D5XA 4E2OA 1Z9SA 1N10A 4PPTA 5CP3H 4OZFA 1EHXA 1SHXA 3DHPA 3IDXH 1EXUA 1U8IA 4JKWA 4PV8B 1YN7B 4IOIA 5F9OL 2K6ZA 2XXMB 5AW0B 5I17B 4P49A 4BWTA 5IM7A 5BVJB 4RAHA 1RULL 3UMTA 4YSDA 3FZUD 2YAOA 1N0XH 1BOGB 1LDPH 1YEFL 2EE0A 5EF0A 4JFEE 1O8MA 5T5NG 3ATEA 1KV3A 3OXSB 3MOQA 5B1KA 3VX1A 4F2EA 4QJ3B 1GGIL 3MI6A 1BD2D 4JHBA 3C08H 2WVVB 4OLYL 3FFCD 4PJBB 1O7DE 4ZUWA 1ZVYA 5DVLA 5SX5K 5HI3C 3FUIA 4XP9L 4BM7A 3UJIL 2NTFB 4XNAA 5CSZB 1FO0B 2HX9A 4JJOA 5JQ6L 1G5AA 1AYOA 1T0PB 4ONGL 5T1MB 4Z76A 4UQ2B 4A2GA 4OT1L 3LKNA 4PY7A 3DMMC 4JFHE 3T0EC 3QHTC 5D6CB 2N3JA 2YUZA 1I8AA 1DBML 2X4NB 1ADQA 1PLGH 3IJHA 2MKLC 5A2BA 5F9WC 4BZ2A 2XUWA 1CFSA 1X5ZA 3VH8B 3NGBB 1CFQB 1CQYA 1H15A 2H32B 2VC2L 4P2OB 3UZVB 4HBCH 4NUGL 1ZOXA 3WUWB 1OK0A 4W9ZA 1TNNA 5KSBE 1TYEB 1CE1H 2XT1B 3EJJX 4WK2B 1ECZA 3LNIA 4QXGL 1MCWW 4N2CA 4Y16D 5C7XL 4NKMA 4X6DB 3R06B 3QI9C 4KY2A 1VACA 1QR1A 3H0TB 5PCYA 4GXUM 3QUHA 4NLHA 1UZ6E 3BKMH 4Y2OB 1S5IH 4DP9X 2XYBA 3QFDA 1JK9B 1NM4A 1KJMB 1XB3A 4AWJC 1DUZB 3GNML 3I3EA 1QEXA 4I18C 3LZQA 3A6CH 1C8QA 1FI8C 3RVUD 1XH3B 2X6UA 3EQNA 4QRBA 2IDCA 1WHOA 2Y1ZA 4MJ2A 2I07B 1BQLH 1GOHA 2BSEA 4MB3A 5D1QD 2ADFL 5HJDA 3N40F 3H4HA 1IL1B 1UJ3B 1A4CA 3KPMB 2XTJC 3Q3GA 3MV01 3P11L 1YY8B 1V8HA 3MKKA 4FLRA 1AR1C 1Q4NX 3ZW3A 3WENA 4LLAA 5EO9A 3RIFF 3FTVA 4PJEE 2A6IA 3HI5L 2Z7WA 3MRFB 4GAJH 2J8OA 1SXZA 3NA9L 4GW4B 2G3ZA 1SXCA 3CXHK 3ROOB 1WFTA 2X2IA 2CD0A 2NY2D 4MJ4A 4CGTA 3MN8A 2PETA 2YC1A 3U7WH 4P2AA 3QPXH 4XXDA 5C0EB 3VWKD 5HGDA 3RWHA 5AAPA 4FXGA 3QDJE 3S35L 3SDAA 4IHOB 4R26L 4ZTOH 2X4TB 5FM8A 3RNQB 1MY5A 2ZKXA 1IBFA 3B9KD 1MZZA 4M8QB 5D1XB 5DO2C 1GGYA 2DQCL 1LP9A 4B95C 2BNQE 1O8KA 1S46A 3JQOB 4YXKL 4NAJA 4D8PA 4FXLA 1MW3A 1EK3A 1J8RA 2BY3A 5H35A 1HCYA 3P30H 5I18H 3IEAA 3BZEB 2ZX7A 3MYZA 5AOJA 4BZ1H 4YSUA 1X7SA 2NSXA 4Y7MA 4YLBA 3AWGA 3HC3H 1I53A 1TYRA 3VGFA 5E6IC 4XVOA 4F37K 3O41A 2Z7ZA 4CSPA 5FFOA 2AJ3B 4FNPA 5D5MB 2OQJB 4NQSB 1KY7A 2WWOA 1BSIA 2TRYA 3N9GL 5CEXB 2VOTA 3PS6A 2DF3A 2Y07H 3H9SD 3WNOA 5DJZB 1AZBA 4R7NA 4NO5A 3IKKA 5ANMB 1OPGH 4HIHB 4WRLA 2BSDA 1M7DA 2E6QA 4UQ3A 3WLWC 5C08D 2DEYX 2BCKB 3I6LD 2R15A 4PRAB 4S1DD 5F97E 2AEWA 4X7FC 5C0FA 5IR1B 1BVNT 4Y4HB 2K3TA 5HP5A 4XTRC 4K94L 2V7HB 1IARB 1RY7B 4N6QA 2FATL 1KELH 4XN9A 4JHWL 5MEND 1BQHG 2BNUB 1YEKL 3KCPA 5A2JH 4N2NA 43CAB 1K3ZA 5IF0A 5E2UL 2X9XA 2E5EA 5BMFH 2VBEA 1TT6A 3GQFA 4ENEC 1LLZA 4KXDA 5DS8A 3KPNB 3UO1H 3IBOA 4YX2L 1UKTA 1MHEB 1V3LA 4P59L 4B9PA 3PQYA 5J0BA 2PPAA 3OKLB 4MD5B 1MIEH 4ZPTA 5JORA 4WO4B 3O8XC 3B7RL 3VXRA 4GG8A 4ZUVA 2PWDA 3CUPB 2B59B 2IPKB 4Y9FA 2VN7A 4I7ZC 4K94C 4WI0B 3B34A 5HI3D 1PZAA 4NWUL 2X42A 3PWNA 2MCMA 1NSNH 2G9KA 3JYCA 3I6GB 4G72B 3ESUF 2IEPA 2VDQB 3APFA 3B7YA 4MGXA 3DMMD 4AM0B 5KVFE 3T0ED 2QZAA 2YBGA 4MXVF 5HYJE 5BW7C 1NBZA 5DF0A 4ABQA 5BZDA 1KZQA 2J6EA 1JXKA 3CH8A 5B3SB 3EH4B 3KR3H 3NN8B 1AZVA 2VLMD 4F7CA 2R0WL 4QRTB 2BC4B 4YZXA 4UILL 1AYRA 2W91A 3NJJA 2W0LA 3MBED 1PQZB 5IFJA 5FM4A 1NAML 3CFCL 1DLFL 5KN5A 3V52L 2QADB 3BW9B 1M71A 5F6IB 3ARGB 3TPUB 2VDPL 2W9EL 1JRHH 3IMVA 4DQOL 4FTVE 4XNZB 2JMRA 3VFPB 5C0RH 1BFSA 4KZCA 3WEXA 5DR5L 3KPRB 2EINB 2EDJA 1IAKB 3I75A 5T8IA 2H1PH 2OMUA 1IAIL 2RD0A 3TZVC 5EDXA 3RWDB 5GJSH 4TLSA 3Q13A 3E8VA 3IDJA 1DSWA 1ZLSL 3MRMA 3HS0C 2GY5A 5CJ8A 5BS0E 2HRHA 4TTDD 2FR4B 4HK3J 4NM4L 4DP7X 2OMWA 1FYHB 1IGYB 3CHRA 5ENWB 4HJGB 2GITA 2OMTA 2M2DA 3DVIA 1KPUB 3AMLA 4OKVA 4PUBL 5HVGB 1IC4L 4FMVA 4JEGB 3TH2T 3TO4A 4YBLC 2GTZB 4IRZL 5KANI 4QOKA 3HG1A 5GJTL 4AH2A 1J5HA 2B2XL 2CO1A 5CJXA 3MJ9L 2VXUH 1UWXK 1EJFA 1K8IB 4J2QA 2DBJA 4N8VG 3ME0A 2NY5H 5E1AA 4RGOH 3VFSA 1BQUA 1LO0L 5G4MA 1FDLH 4RAVA 1V5JA 3PWPD 3GSNB 3Q9PA 5DUJA 4PTTA 2C34A 5J3HC 1OQXA 5HGHA 3T2LA 1TVDA 1BWWA 2NT6A 2AQNA 3OKNB 1H8NA 4YIQA 4GKNA 3UIZA 2AV1A 5DO2D 4Y4FA 3G08B 1UT9A 1UM6L 1Q94A 4YGVA 1YHPA 5I1IH 4MD0A 2WXKA 1BVLB 2ICEB 2X1XR 2Z7UA 2A5UA 5DD5L 4Z7QF 1FH2A 4KKLC 3HJ0A 3L1EA 3NH7H 5JOEA 5ADOH 2Y69B 2C9RA 2D3JA 3Q5YA 4HIIB 4QRSB 1XHHA 1QYGH 3REWA 3MV7D 5E4AA 4JG1H 2ZX8A 1Q9KA 3KM2A 4BFJA 2X88A 4X5WA 1YPZF 1GSKA 4YDTA 4GW1A 2KZBA 4QNPE 4AYSA 1EGJL 4K3HA 1JNNL 3D0AA 2ZUVA 1KJ3L 3QZWA 3ZE0F 2R8SL 2GW5A 1FL6A 2DLGA 2FJFB 1W6WA 2W7ZA 2A9MH 4GIOA 4TM9A 3UERA 3QXAB 2CPCA 4JCWA 3T6VA 3KJ4B 2ZXCA 4K3JL 2VDMH 1P1ZB 3L08A 5D55A 3RIQA 3H9ZA 1A2YB 5GGUB 1BYNA 2H3NA 2VFNA 1TJHL 2VDRH 3CC1A 3FU7A 3KDMB 1N5YL 1RJZA 2R9HC 1ACZA 2CHDA 1AO7B 1FZMB 1OAQL 2GI7A 3T8MA 2GBVA 4HQQH 3CZEA 3A6OA 1NGXB 1DANT 2BHYA 1AJ7H 2X4QB 3PGFH 3GSRB 2J8UB 3ZGIA 4FG4A 3Q01A 2R2EA 2NCMA 4YWGL 1KLFA 2XLLA 3V5DA 3HRZB 4TNWK 1VENA 3AGVA 1SLWA 5HJ3B 1N64H 3LD8B 4RFEB 1IGTB 5GRUH 4QRRA 4AC2A 2G60L 3OJDA 2DBLL 2R27A 3RJDA 4YDKL 3P0VH 3O8XD 5DMYA 4L4TA 4UT9L 1TEFA 3B6SA 4X98A 1XD1A 4XBEH 1A8JH 2IPTL 4B0MM 3O0LA 2UZIH 4MDIA 5KVDE 1KT2A 4KDTA 3TFKD 1UXSA 3DX6B 5IK3A 2PP9A 1GIGH 3KL3A 4X99B 3HHSB 4GW5B 2EH8H 4Y0GA 3PIQA 2Z93B 2GBAA 1O8JA 1TETL 4YDNA 5F7WC 2QQKL 3KWWA 4GFTB 4MTMA 1M7UA 3X3FL 3ULUE 4C4BA 1JL8A 3L7FB 2JTYA 2ZT9C 5GGQH 2BVPB 2AQPA 4PHXA 1WSST 3BO8A 1G9HA 1K3IA 2OL3A 4D9LL 4XMLL 1HIML 4Y2DB 2YXMA 3UJTH 2VZSA 3PHQB 5AKSA 2EXWD 5I76A 4O02H 3B9EA 3KLAB 1FQ9C 3UC0L 2G3NA 2WTOA 3CZFB 3OPZL 3MRRA 3BYYA 4ATTA 2VQ1B 4BFNA 4QEGA 3X14A 2BRRL 5KWYC 3MNVB 1NCCH 1QTYT 3F83A 2AW2A 1CB4A 3TT3L 4GAYA 4JFPA 4XN1A 3LS4H 1SVZA 4HFUL 3J8F7 3WKMH 3QDMA 1K4CB 3QXWA 1DVXA 1HL5A 3O2VH 3P0YL 4JG9A 4P5KA 1E30A 4APQA 4Q2ZB 5AVZB 1CG9B 4QXVA 1R9FA 1CLOL 4KX8A 1XIWC 3LJYA 1SF5A 4JQXA 4JFDD 3MFFB 5AZ2L 4P5SA 4GRWH 4WVRA 4JO3L 3PAZA 3MX0A 4WHTB 1TQWA 1KGYE 4U2YA 2JB5L 1GR7A 1C5BL 1BVKA 3KPSB 2UVEA 5E5RB 4EIBA 4MNGB 3ML3A 3AQXA 2BP0B 3LEXA 3J2PA 4PB9L 3UTPE 5IB2A 2GSGA 1F5WA 4P3CL 2Y5TA 2WTRB 1WHPA 5EU6E 5M95B 1N3NB 3UTOA 2A4CA 4PEEA 2NY1C 3HC2A 3QS2A 2QSQA 2VZUA 2X2HA 4FI7A 3HI1A 2DKMA 1Z3GL 5F8QC 3ULAB 3VFMA 3QXDA 4YZFF 4KUCF 1ZANL 3FUMA 3ESMA 3PV6A 1R1CA 1KEMH 2VXTH 1A4AA 2WWNA 5AB9A 2RJMA 1S3KH 4HF5H 3TYFB 1KXVA 2CR6A 1JP5A 3ZRFC 2E86A 2QMKA 3TBSA 1S9XA 1QLFA 3IJYB 5GS2D 4UM9B 5FWRA 4PWIA 4C83B 2R29A 4YHPB 5DD6A 4NN5B 4E5XB 4PRDB 1JV2B 5ID1B 2WCGA 3ARRA 2F54B 3IPEA 2AJVH 5DJCA 3IGUA 4PCYA 4Y16B 1R24A 1EIBA 1YYMH 3CFDA 3KL5A 3U82B 2BVQA 1T2XA 5IVZA 3ZKNC 1S7WA 1O8EA 1KN2L 1I8LA 5DUPH 4FHKA 4I48B 3B7TA 4Z95H 1MHCB 1MWAA 4OAWA 2BY1A 3ZQ9A 2OCFD 2VITB 3O6MH 4CSTA 2VLKA 3U30B 3BOVA 4BFBD 3D25A 2EDEA 3V55A 1N59B 2PW2A 2QJDA 2EYRA 4YSPA 1T6BX 2BVYA 2F53D 1K6QL 2F74A 4RFOL 4JRFA 5GIRA 2NR6C 2YD6A 3GXPA 3FTGA 2X0WA 5IQ7L 3ZTJH 3OB8A 1A6TA 2NY4C 3MV9D 3FQRB 3AG2B 5ACLA 1Y1DA 2IAMC 4UQIM 3V4LA 2W5PA 3D5OF 3T0VA 1Q9WA 1IM3A 2VDOH 2XTLA 3BFQG 3MLVH 5HHOB 4O2EB 5IREA 2IV8A 3RY4A 2YPVL 3BSZH 3EFFB 3RE0A 5EU3A 1PSKH 5EB9A 4C4KO 5AOLA 4PRBB 2NY2B 2Y7QA 3BD5A 3HC0B 3S3BB 1P0SE 1MUJB 1RZFH 4M5YH 3P77A 5IBLC 4PIRF 1T83C 1QSFA 3K72B 1QFWI 3PUUA 4QYAA 4WKZB 4F2MA 4U1JB 2DMBA 3GIZL 3QRFM 3K80A 5FCUH 1EEZB 4YSSA 1WF5A 1T0MA 4XCYB 1TQCC 2WYZA 2B0RA 2QHRH 1TITA 3O3AB 2QDVA 4H88L 1V05A 5FYKH 5EIVA 4M9OA 3TN0A 3ZPDA 2Q7AA 3WXVH 5C09B 1BVZA 2D7TH 2HH0L 4PRPA 1SJXA 3WNJA 5IW6A 5KSAC 3OMNB 4OR1A 4OFIA 4ETQA 1MRCH 2GPZA 2XHNA 4ZX4A 2O72A 3D12B 4ZW3A 5IEKA 5LGJB 5DK0B 2B20A 3TESA 2X53A 4EI6A 2XETA 2FB4H 5CZVL 2YRLA 5GS0H 4XAWH 1LEIA 3WGVB 1G1CA 4AKOA 3DPBB 3QC6X 3LPPA 3TEXA 1CL7H 1Q9LA 3VYNA 2BM5A 3V6ZA 3X2QB 1JYVA 4P04A 1T22A 5IFAL 4HS6B 1MHHA 2C7UA 4NP4H 5ISZA 2G9HA 5JW4Q 3K2KA 1VPOL 5LO7A 5I1KH 2EWEA 1PKQE 4IRSB 4MYWB 4UTBA 3MRHB 3Q2NA 1KQ5A 2JB6B 4GT0A 3TIDA 1L7TL 4OGXH 4WO0A 1J12A 1XH0A 1RZGA 2CK0L 1S9VB 4WNJA 2AJXL 1OD9A 3TIEB 4H7VA 4HLZG 4DPCX 5K9JL 4JY4A 4PN6A 3IMTA 2J8IA 3RVTC 3QIBC 3C6LB 5EOQH 1IJ9A 3A24A 1MAJA 1S5IL 3L5XL 4AMWA 1XZ0A 1E4KA 3DTDA 3SDDA 4U1LB 5LQBH 4JVUA 2CBQA 5MI0C 1ZPLA 4AMXA 4LLUB 1MKFA 3HG2A 3O6FA 1I8KA 4LEBA 4KXZH 4ZAKD 4QHNA 2JV6A 4EI0A 5HI5C 1M53A 1CLZL 1HHIB 2XV2A 3APMA 4C58B 2ZCKH 4OTXL 4QXUL 3NFNB 1T0NB 2F1EA 1WZAA 2UY6A 1EE6A 3NZSA 1O0VA 2ATKB 3VXSE 1FSKC 5F21B 3EYOA 4W8QA 4HGWB 2WN3A 3MA7A 4TSBH 5D1ZC 3ABMB 4UI2A 3WEBA 1H3GA 3P9MB 2IGFL 3GXIA 1ADQH 5EBLB 3ZL2A 3PXLA 4M43H 1ACCA 4Z5RA 2ADIA 5IESL 3ILEA 4Z7WE 3RWJB 1DQML 4QHKJ 1U2HA 4M00A 4BZ2H 4KV5F 2I85A 4UNVA 5FA4B 3N6ZA 3LRGA 2WYHA 4NT6A 3Q2VA 4ZQTA 3KXFE 5HVFB 3V2AR 3BSHA 1NC2B 2BNRB 1OT4A 4ZNEE 4JO5A 4LOEA 2VLRE 1EEQA 3EO9H 5L2KA 3QWQB 3P4OB 1A1NB 2W0FB 3R0MA 3QI9B 4K2UH 4XP5H 2VN4A 4LKCA 3ZKND 4Z3JA 4MXWH 1EV2E 2H26B 3LKPB 4TQEH 1W72L 3GBNH 3QJRB 2O04A 3GRHA 2PABA 4ZZKA 3P30L 4XWOD 5IP4A 3IDNA 4OFQA 4PB0L 3U0PA 1D7CA 8FABB 3QQ3A 5JW3H 5INDA 4RA0C 4Z7QB 5DHVH 4FG6C 1XF5B 5IB5A 4DJMA 3U4AA 3IGAA 3FT4B 2E27H 4HUVB 1DR9A 4I13B 4PGDA 3RX5A 2AFNA 3OKKA 1LO2H 3I9AA 3UGEA 5I0DA 4MXNA 1HXMB 2MCG1 1TUPA 2XTJB 4R4ND 5AB0A 1F8TH 1YPZB 2ZXBA 4PJCF 4YSQA 1ONQB 4APXB 1AR1B 2EXSA 4TNGA 5HYEA 1TLKA 1OSPL 1JCKA 1JXGA 3O11A 4P46A 4PVLA 4MJID 5ADPH 2XWEA 4WFHD 4JO8A 5FIEA 4H1LA 1IEHA 1PL3A 2ZYSA 3D85D 4HKZA 1B9ZA 5B39B 1RCYA 4G6FD 1USZA 4LSTH 5J8OA 2F5BL 1E6OH 5IBLD 4GQQA 4Y8DC 2JLPA 4Q74A 1WG3A 3WUWG 1T2QL 2A38A 4NNYA 3VI4E 5JOPD 4Y5XC 1U8KA 3N0PB 1FAIH 2FD6H 3HZVA 4LOVA 1QFOA 2BWIA 2DOCA 3TONA 3RKPA 1UTDA 3BKJH 5J1AB 5EO0B 1FP5A 3UYRH 4KDWA 3V7AE 5IUCA 1J9QA 1TQTA 3SYPA 4R0LC 1NBYB 3NJVA 4N86A 1U58A 4YO0B 5L4MA 5DJDA 3WWGA 2VW4A 5D70L 5JXAL 1KIQA 2BMKA 5K5YA 2O6CA 1DCLA 1JK8A 3VXTA 2AABH 5DTFB 3VG9C 2HKHL 5E6IB 5FKPA 4XWGH 1MREH 2R83A 3MV7B 1S7RB 3DC0A 3ZUNC 4AQ1A 4ELMF 3JV5A 2DM4A 3FSOA 4X4XA 5EC2A 3C8KB 4K9JA 4MAUH 1LILA 2JWYA 3K6NA 4UIKL 2H47C 2Q9OA 1LD9A 3KNBB 4UUJB 3HUJA 1R75A 32C2A 5BZWB 3FQTB 5ABZA 1AIRA 1FV1B 4QJ4B 4P2YA 1X3DA 3BAXA 4V33A 5ICXB 1DFXA 4LRNH 5HDQL 5HYIA 4TOYH 4C54A 1N4XL 3AM8A 1FUNA 3QFJE 1IQWH 4KH9A 1YECH 4OY9A 3RUGE 4DKEL 1S9WA 4HK0A 5C0CE 4MZ2A 1HQ4A 4G1EB 3Q48A 2GCYB 1JGEB 4LSPH 3SBRA 5CZRA 4LF3B 3V4PH 4JPWL 3UC2A 3GMOA 1V3MA 3ZDXF 4QHLA 5L4FA 2PWGA 3VFGL 1KFAH 4JKPH 3VRIB 4DP6X 2H2SD 3E9TA 4WEUD 2V4LA 2GC7C 5F7LB 3GLEA 4AY0A 2XZCL 5IHUL 4X7SH 4ZT1A 4Z3IA 5ALCH 5LB1A 1U6AL 4HD5A 4BA0A 2H1PL 2O5NA 3MV8B 2P49B 2ZSWA 3V0AC 2QTVA 1SBSH 2K4WA 2UY7A 4R4BB 3JXAA 2R56L 1F42A 3VE0A 1I8IA 4LLYA 5HI5D 2HKFL 2Y25A 2FBJH 2PO6D 5E2JA 1QO3A 3CDFA 5AKTA 3ZTDC 1JHTB 3DGGA 5MP6L 1FL3A 3Q44A 4Y19B 3QDGD 1K72A 4WFGD 4CMHC 1M42A 4F9LC 1D5BB 3LZPA 5ICYA 1I85C 1HSAA 4F7TA 5FK9B 1P9MC 3LNFA 2HFFA 1WVZA 2JXMA 3NIDF 1R0AL 3L4VA 1B4LA 2J6EH 2FL5A 3DVGB 3OAUH 1QRNB 2DB8A 3LV3A 5I6OA 4L4JA 4CC0A 2F68X 1OWWA 5EIQA 4U1MB 2NY5L 3TNNA 5E4OA 1CD9B 2Q6WB 3FUKA 2K70A 2P80A 3ROLB 2AKRA 2NY0C 3MODL 3MUGA 3PFQA 5GZNC 3QEQA 4MSWB 1KIUA 4BKLB 4CGUB 1YEIH 5I0ZA 1IO4C 1OTSC 2AJYH 2WANA 3QG7H 1L9TA 1T7VA 2A99A 2LLGA 2ODHA 2Z92A 2VJXA 1MPAH 1XD0A 1CE6A 4LCYB 3ILPA 4FRWA 4LLMB 4U1GC 3TZVB 2Q3ZA 3ZKMC 4KPHH 3QQ4B 1A3QA 1FCCA 2JQMA 3FSAA 3HR5A 3HZ3A 1QYGL 5ID0B 3FJTA 3HS0B 2OMNA 1OFLA 3MRNA 3D34A 3IETB 3RTQA 4O9HH 5EUOF 2DLTA 3TA3A 1OAZL 1GXEA 4M5SA 1KTWA 2ZCHL 4BELD 3F12A 4KRPC 2CU9A 1F3DJ 5DYOA 1DYZA 4QD2E 3UXFA 1TYUA 2KQMA 2Q76B 3NVQA 1J1XH 4OZGE 4RIRB 5GGRY 1GHFL 4OQ1A 4FA7B 2VDPB 1ORQB 4DH2A 1JXDA 1PG7X 2GK0A 2JSFA 3HTLX 3UPAA 4YBLB 1OLLA 1T20A 2KHAA 4F7EA 1GAFH 1TQSA 1OGAA 1NCBL 3QO0B 5C92A 1MIMH 2JI2A 3VCLA 2VBMA 2W60A 2VDRL 4FFYH 4CBZA 2MNWA 1ECYA 5HHME 2HZHA 1WQVT 3P3UA 5FO2A 2RIKA 3HG3A 3E3QE 5JUEH 4ZUSA 4F5CA 2E7LC 1UCTA 5H2BB 3O9WC 2ZAIA 1ZTXH 5HD8C 2R4SL 3ZUCA 1KG0B 1EAQA 2VAAA 5EC1B 4DO6A 4XX1G 5CLWA 1AJ7L 2HT4C 3D6GA 3BH6B 1BECA 1G9ML 3T6ZA 4HEPG 5HDBF 4ZOBA 3WL9B 3RFRA 5F93C 3B5TA 3TVMA 5CBAB 3LXBA 2FHBA 4OVUA 4Y89A 5GGTH 1E5ZA 2DQFB 2F8XC 3QUML 1A7OH 2WCPA 1MI5A 3RKDC 4PGCB 2WLLB 3FO1A 3IK2A 3VB9A 5F7UA 4K73A 2BIPA 4HJIA 5GGRA 5DLML 2KBGA 3IRCA 4PQXA 1U95A 2YEZB 5KEZA 1KLUA 2FSEA 3II3A 5IBUG 2AXWA 3KZ8A 4DWHA 3QEUA 3VXMB 4DNLA 1LE5B 2AK1L 3QG6B 4Z7VE 5K39B 5IOKA 3F7YA 4ALAH 3E2HC 1OGTA 4BQBA 2OSLA 1LYQA 2NW3A 2F53B 3D33A 4JO1H 1MJ8L 2A74A 4WTZG 1ZWIB 1U8HA 1XVSA 2HT2C 1G9MC 3MV9B 3VFWA 5IJKC 1JOIA 4NQDB 1J5IA 3VSQA 1HCFX 3WJLA 2ZUYA 5AG8A 4X0KA 4EN3C 5F3BA 4E42B 5IG7A 1Z5LA 4KI5D 1U8LB 3V0WL 1G7IA 1BYOA 1X7TA 4ZUTB 4RGNE 1PG7H 3PJLA 3QQNA 4P2RA 3PP4H 2W9DL 1QATA 4DETA 3GEWB 5I8EA 4M8VA 3X13B 4A37A 5D7IE 5IOPA 4UMGA 2XC1A 2O5ZH 4U7MA 3NCXA 4G7RB 2FYVA 4DGYH 4F8QA 1WEJL 4IK6A 3SY6A 2J20A 2Z35B 4QRPE 2ED7A 1MJJA 4CADB 4XNQA 3SDXE 5SX4H 4MMXA 2Z4QA 4M8UA 4TV3A 5DA0B 2BVOA 25C8L 3BP4B 1AKJD 5MEOA 4MA7H 4G11A 4OZZA 1E8ZA 5CJBA 4MQTB 4F24A 4OJCA 1IFRA 3RNKB 3MRGB 3O4LE 3GSWB 3ZYZA 3B83A 2WLZA 4NYLA 3R7QA 2NX5A 4EBQL 4XHQA 4RSYA 2CCLA 1CIUA 2EDXA 1QKZH 4XCNA 3UTTE 4CAGA 3ARBA 4L1BA 1KENH 3CN2A 2XWRA 2C9AA 3GMLA 5TD4A 2ICWA 3W5MA 4IU2B 2EXYD 3FQYA 3SD5A 2MNJB 2OPCA 1WBXA 4XOPA 1H3XA 3CXHJ 2EAEA 2Y24A 3ARDA 3ZK0A 4EKJA 4GIPD 4RGMC 1HSBB 1P7QA 3AU1A 4DGVL 2V8LA 5ESVA 1T4KA 2OL3H 1ZJBA 3FUEA 4PJDE 4E9RA 5J6GB 4N2FA 2ZG3A 4UV4H 3ZSTA 1E8XA 1W80A 1RU4A 15C8H 4JRYD 4XNBA 5GZND 3VGHA 2F3LA 3D0VB 4HCIA 4ICXA 1E4WL 4MLSA 3W0WB 3MR9A 3KBFA 1ITBB 4V02C 4DZBA 4A38A 4JRLA 3NEOA 3O3DB 1SYSA 2DWDB 2ZP0T 4O5LL 1SLVA 5DJ0A 3BEWA 1W0WB 2J21A 4MJHA 3BH8A 1WBYA 3SKNA 3ATBA 1E90A 4UT7L 1XIWB 5IMOA 3OR6B 4WUKH 1H6TA 3DUUA 5E8OB 3GBML 3U46A 5AUMA 1JGDB 2FTAA 2FLRT 3JWDC 4S1RH 1WCBA 2CO7A 1A5FH 3JV4B 4KKCC 4Z95L 5DMIH 3V5HB 1AGEA 4ODXB 4KROC 3FO9A 1EZUA 5JHLL 1XR8B 2CJTA 3FQNB 3MNWA 4MHHG 4LSRH 4AENA 1KBPA 1BXVA 3SJVB 1XL6A 4IS6A 5SWZE 5MEPB 5B3JE 5D7JA 3V0GA 3A4FA 1H3TA 3D2UD 3I9IA 3QJHA 4FXTA 5C0AD 1I7RB 3DXAE 2NY1B 3IDIB 4E0RA 2YGVA 2EADA 1SF3A 2XNAA 3K7UA 3UH8A 1KPVB 1AXIB 1L9SA 3H09A 1GS6X 3STLB 3NCBB 5HD8D 4FCHA 2DYSB 3CNKA 1PG7W 3GJEA 4PJCB 2MMXA 2ZXWB 4J1UB 3MGOB 5TE4H 3UAFA 2TSBA 4AYFA 1HEJC 3PP3H 4Q0XL 5DCCA 1G7MA 5DJ8B 5JLVC 3U4BH 4NO3A 5I1JH 2EYSB 2YRBA 1UXWB 3BWSA 4BUGA 1LO5A 2PCXA 5C3TA 2YFNA 4M1CC 3VG0L 4N0YH 5DDHA 2PKDA 4OLUH 3FPXA 4P4RA 2WO4A 3MROB 3UAAA 1SJHA 3MRBA 4M5ZH 1IAOB 2OJEB 4NC2B 1M1SA 1AXTL 1H0DA 2Z1PA 4HHAA 2QHRL 4FYQA 3LDBC 5GHWL 3SKMA 1X9RA 4WFFE 3PSSA 1BZ9B 1CICC 4WSJA 2L7QA 2EZ0C 4Q6YA 5HYSG 4HS3A 5E8PB 4E41E 5IROA 4CVZA 3IB4A 3B7UX 1IKNC 5DMGC 3GMNB 2JE8A 3EJYC 2UXTA 4UNIA 4NQUA 3VSTA 4NK8A 1JCVA 3VSVA 1IEAB 4HUMB 2NY4B 1A1OB 1KC5L 4QXTB 4MA3B 4G42A 5KYYB 2IAMB 4H5SB 2WXLA 2XY2A 2FB4L 1U8JB 3FT3B 4JFFA 4ELMB 1ED3A 1N7ML 4N2BA 4R5XA 3C6SA 2HKAA 4XRCB 5KVFL 3X1GA 2EEXA 4LSQH 2DDQL 1FWXA 1HEHC 1WXRA 4HZLA 2QVMA 3UADA 1G7LA 4BUHA 4GP5B 1G0XA 1AP2B 2ORBL 3P2DA 2ICWJ 3FOLB 3QAZC 1XGUA 4YEEA 5FO9B 5I5RA 1ZD6A 3IT8D 4E5XG 4I1PA 2CNYA 1TVHB 1BQ5A 4ZO7A 1K85A 5L4JA 3FUDA 4HKJB 2WXFA 2UUDK 3CPLA 4MLIA 5CILH 4XZ4A 4AE1A 1KN4H 2G2PA 2DWTA 2WXHA 1KPRB 3WNIA 3ETBF 2BM3A 3UP1A 3IFNH 3ZDXB 1CFNA 1TQCB 2BSTB 2YXFA 3PPSA 3G6JF 2BLFA 4LHUB 1NIFA 4P3DA 3ZHFA 2HVJB 1J0KA 3D9AL 1IC7H 5SWSA 2BY2A 1IEBA 4NKIL 2WQVA 4YE4L 1NIEA 4JFHD 5EZIL 1X5GA 4PWJA 4ZFZB 4TUOB 3RWEA 1Y7VA 2HYMA 5KSAB 5JHDA 2VDNL 4IRJA 1BFOA 5CM1A 1GC1H 3QRGH 2YLKA 2D7MA 3APDA 2VCOA 1LNUB 2W65B 1D5MA 4L4VB 5I6XC 2H9GA 2X38A 1BIHA 5TQ2H 3DYMA 5BJTB 5E00A 3HPLA 3VGEA 1K5WA 1DTUA 1URLA 4DZ8B 5D7LE 4RNRA 3WY2A 5BRZE 3CU1A 2X6YA 1QA9B 3NIDB 4LIQH 1MFEH 1SHWA 3VO0A 1YYLL 1H3WM 1XCWA 3BVUA 5D7SL 1BAGA 1D5IL 3OXSA 4ISVB 5IMKA 5ERWB 4Z06A 1CT8A 1DVFD 4XC1H 4YDVA 4PJ7A 5L8JB 4MNHB 2AQSA 1FNSL 1TO4A 4FQJL 2FIRT 5IB4A 1QHQA 1R47A 3QIBB 2CKBL 4G6AD 1QJVA 4Y1AB 2XX1A 2PYEA 4UM8A 4KROD 1PCXA 1NLDH 4YBQC 5DQ9B 1UGNA 4JRXA 4N5EC 4JPIB 4YHZH 5MI0B 4GSRA 3B3IB 4N28A 3ARFD 2GAZA 3MCKA 4NB7A 4TUJA 2H0FA 4NUJB 3VU1A 4MX7A 2NSMA 1RXLA 1WFOA 1WE5A 5BO0D 1H8SA 1ZXQA 4N68A 5EUOB 2QY1A 4WI9A 3HLAA 2DTML 4E9QA 2B9BA 3MBWA 5DQJB 3QSKB 1FSKB 1QEWA 3MLZH 4FQCH 3RZCD 2LFGA 3QDJD 1HDMB 5D1ZB 2QPSA 3PHSA 4FE9A 1PBYA 4YE0A 3QQ9D 3VRJA 1GZQB 1J48A 3HAEG 4TQIA 2CGYA 2IG2H 3CSBA 3IWUA 3FN9A 3ZOAA 2BNQD 5AD0B 5DT1H 2LGNA 2XACC 5DRXA 1KCUL 1MFBH 2XIIA 3Q2CA 3CFBB 2GSMB 1E42A 3MRQB 4C56E 4W9HC 1AH1A 2YHGA 5AAMC 2VIRB 3CBRA 1YEJH 4YXLH 4PWHA 3LKOB 4OV5A 5CCHE 1SEBA 3OAYK 1TZIA 3G5WA 3GLZA 4MR0A 1QBLL 4KJPD 3BKJL 4KZEH 5DEFA 4W81A 2YPKB 4OD3H 5AALA 3QZPA 2VDKH 1NH6A 4IK7A 4JN1L 5HDBB 3RWIB 1E9OB 5AW2B 1U91B 3K2IA 5DD0H 4M3KB 1GPOH 4KXZI 3QIWB 2HFGL 1JF1B 1EEYA 1GZHA 5C0JB 5FDWA 3OMIB 5DMGD 2PWEA 2RA1A 1F13A 2XV3A 3F04A 4M62H 1JYXA 4PJFA 1OT1A 5AW3B 2OJ1A 2QV4A 4OIAA 1JPTH 5KVDL 3C5ZC 4G8GA 2O6PA 5J9PB 1T3FA 2X28A 1J5DA 2DYPB 3APNA 4I85A 1IQDB 3DECA 3DSFH 1GKEA 1BMWA 4H20L 4KTEH 4PRIB 3CFIC 1IGJB 3UGUA 1PPIA 5FLVA 2FLBT 3ULUL 3QORC 1HQRA 1KCRH 1G4MA 1M6OB 1ZV5A 1QLEB 2OMVB 4AL8C 5SWQB 1YEEL 2FECI 4KMTH 2VLLA 4WCYH 3H9HA 4L2LA 1AFVH 4LKXB 4OM1L 3V4VA 5FB8B 5FYKD 2R7EA 3QNYB 1P4IH 3V4PL 4NOBA 2HVKB 2FYYA 4I0PC 4R6UA 1JZ2A 3DTXB 1NGZB 4N9GA 2J88L 2OZ4L 1F3DH 1X7QB 1QW8A 1GVIA 2V8MA 1UJTA 2MHAA 4AKPA 4KO6A 1KEGH 4PJ5B 4R0LB 1RLWA 2P26A 3HG0A 5BQ7A 5GS0D 2J8HA 3MA9L 3NG5A 1LK3L 2IPUG 2YKLL 1OSZA 3UAJC 3RGVC 3IKCA 1I3RB 3ULUC 4HUWB 5ESQB 3T8XA 3VG9B 5CMAA 4DN3H 5HYJD 5CU9A 5I19H 3D48R 2Y36H 3QHFH 4EMZA 5EU4B 2JJTA 4LO9A 3HVDA 4M61B 4YDJA 1UG9A 4M1GH 2FBJL 4OFKA 1PNCA 1RJYA 3CFMA 4PGEB 2GIMA 4NSKB 2F08A 3VMPA 4NCC1 2CLZA 1Q1JH 3FKUS 1DQDL 5LN4A 3CLFH 3UTZB 4Z05A 2NY6C 3WJJC 2L4OA 5LG1A 3SGJA 5DI8A 4FTVD 1ETA1 3L9BA 5DZOA 1B0GA 3RP1A 4J23A 1B4JH 3TJHC 2WGNB 3HLKA 1PAMA 3IBEA 5C07E 1XSKA 1WIPA 4NZDA 4UDUB 4YZAA 1UB6B 1TKWA 1U3HC 4DTGH 2D7NA 4NUMA 5SX5H 5JPMC 4LOUC 1WLHA 5KJ7E 4B9YA 1PD1A 5BS0D 1XXFC 2X2YA 4H8PA 1SM3L 5IVXE 4XZUB 3BEVB 3RPKA 1ETZA 3PJNA 4IEFB 2AJYL 2L3BA 2PR4L 1F3RB 4YBQD 1JMXA 4X50A 2XV0A 3IF1A 1AKJB 3BAJA 1BGXH 4CVXA 1IA5A 3CVIH 3IE4A 4QTHB 4UF7C 1T03H 2WQ8A 5JDSA 1GGUA 4AOFA 1NINA 2P7TB 2SEBB 1HZHL 3L3GA 4L5FE 3II1A 4NI6A 2E47A 4H0GA 2HFEA 1U93B 1MCPH 1RFDH 3KEHA 3TBTA 5BUAA 1ORSA 3S3PA 4MDJA 4L9LA 2UZPA 3EBHA 2JCCE 4P4KC 3B9AA 2YD2A 5BO1L 4CMHB 1M05B 4UT6L 1EFQA 1NCDL 5ACZB 4Z3FA 1A7NH 4YHOL 3FTZA 5C0DA 2MQ0A 3CLWA 2Z31A 3JWNC 5AWNL 1JN6A 3BAIA 2ZG1A 5CU5A 3ZX1A 3BWZA 4U6XA 1UWGH 2VXVL 1OAUL 4GI6A 1YQVL 1SHMA 3CIAA 3SCMA 4ZFGL 4XCCH 5D2NC 1WZ1H 4LCWB 4LQ1A 2NY0B 5HPMA 2DN7A 4UTAL 1U0QA 1R3KA 5EIIB 1ZSHA 1THAA 2XWJA 4HJ0D 4XOAA 3B2VL 4RISL 4NDMB 4PJBE 3DA0A 4N90E 1FIEA 4JHAL 1AQDA 1CXEA 3DSNB 2ZOUA 1CWVA 2VGLM 4EIGB 5CEZE 2UYLA 2AI0L 4HT1H 1G7PB 1SJEB 2IQ9L 4HPOL 4U1GB 1WUZA 4WTZA 4OGAD 3NSFA 2XZQL 2IFFH 1U8OB 5INCA 2Z0UA 4AW4A 4NM8H 4AGNA 3UTSA 4HG4K 3C5ZD 1QWUA 4KRPB 3FPYA 5B7MA 4LQFH 2VZ1A 2E76C 3WFZA 4FQXB 2OYPA 4XNFA 1T5XB 4HIJA 1KB5B 1N0LB 2EYTA 4JM4H 5EU5B 2P43B 5E6RB 3MLXL 1BM3H 4NZRH 4R2GD 4BSWA 3UYPB 3O3BB 4NBYB 3GUFA 1G5GA 1N5AB 2HLEB 2YA0A 3IFLL 4FABL 1FJ1A 3RGHA 1L9QA 1WT5C 3RGBA 4HWBA 2KERA 2XN9B 3JTTB 1VFMA 3R1GH 3EYVA 4XX5A 1DBKL 2XWTA 2YD0A 4HJTA 3UW0A 4N0UA 3O9WB 3WD5L 4BQCA 3FQWB 1ZVHA 1MCIA 1YNLH 2FE0A 4HKXA 2EEBA 1T21A 4HSQA 4I0PD 3FT2B 3BIKA 5EPMB 4A7GF 4NN7C 4E9XA 3G5XB 3UTQB 3BCFA 3OWRA 4KK5C 3U7YL 1ZXKA 2V17H 3EFDL 4GLRI 1ZVSB 1AD0A 1COBA 2RTTA 2XFGB 5DRWA 4L3FA 5I1CH 3EGDB 3MRDA 4FQHA 1TJMA 43C9B 2V3DA 4GO8A 2H0PA 2XTXA 3GSUB 5KYUB 1R5VA 4ZMXA 5ICZA 3UAJD 5JIQA 3ULUD 1XF2A 4F3FA 4NRZB 3VWJB 5B38G 1YMMB 2P5ED 5E9DB 2ADJA 2NLJA 3MLUH 3L3HB 1L5GB 2HVBA 3GHEL 1PX8A 3NZ8A 4IMKC 3E2HB 4HPHA 2D9CA 1LP9E 5BUPA 3G6JB 1WGOA 1F00I 2Y0SA 2XG4B 5LBSL 3DI2B 4EXKA 5FO8A 1DCEA 2O30A 4I2XB 4N8CH 4NQXA 2BOCB 1OAYL 4BQ6A 4KKZA 4W1TA 3RRQA 5DXWA 4WJKB 2VXQA 4JKKA 3TJHD 3I3BA 2WK2A 3EUDA 5D1XE 3MLRH 4EN3B 3DLQR 3EZ8A 2BPBA 1R19A 4ZSOB 5I30H 1X5IA 2EVIA 2DYRB 1S7XA 1U3HD 3R4RA 3RWFA 4BK5A 4M7JL 1MCBA 1MFAL 5H8DA 3UPRA 5FGBC 3UZEA 4QF1B 3U6XA 2PPDA 3VTMA 4UV4L 5F7EH 1DZBA 3K6SB 3WTXA 3CQFA 4JG5A 1K5NA 1MNUH 3ZKXB 4JQIA 5F1SA 1I3GL 2IWFA 2O6DA 4BDVB 2NW2B 5D5ME 4JFEB 4YNYA 3KS0J 4HWEH 1Z9OA 2BZCA 3BXNA 4PSRA 4XNUL 2AEPH 1IRAY 3UTPD 4LOFA 3JTSB 1IGCH 4DCQB 1VADA 3WDHA 5EU6D 1CZ8L 2GJZB 3OF6D 3OL2A 1DBBH 3QXTA 5I0WA 4S1RL 2ADYA 5F7FA 2R1XB 4F80A 3TU6A 3UBGA 3WE6A 4J4PC 4NRYB 5FWQA 1JHKL 3JX8A 3N41F 5IKCA 2W80C 2NY3D 3NJLA 2WZ5A 3QUZA 1CBVL 1JVKA 1AOZA 3RL1A 2BY0A 3IDMB 1HH9B 1H8LA 4A2EA 2X05A 1BAWA 1YCSA 4L3EA 3S96B 2FJUB 3PQYE 4PJIA 4MKTA 4X7TB 4G9FD 3PWVA 4JO2H 1RIHH 4RGMB 1Q72H 2HJFB 4GOSA 1QFWL 1MCKA 4FZ8H 3NABL 3SQOH 1AGDB 2ZKWA 1G6RB 3HBQA 3J07A 5EF3A 2DI8A 3CSFA 5E24E 3JT0A 3LRHA 4YAQB 1O8DA 1V7NH 5SX4I 3VJ6B 3U4BL 2CMRH 5JR1H 4NO0D 4KKNA 1MFUA 5HYSA 1SN0A 4X8JB 5DFWH 3RDTC 4OZHF 2XRAL 4JFYB 3B43A 4XE5B 1MNNA 3LH2L 1UWXH 5EZOH 5I9QB 2OMYA 3WLBA 3FMGH 1BD2A 3OQ3B 3G9AB 4AITA 3FFCA 4G9DB 3F5WB 2DWEB 3ASWA 1VKXA 4K7PY 3EDDA 3RZWA 4NQED 4F92B 3DO3A 5I6KA 2OBGA 1DVQA 1N6VA 3FB5A 4FI8A 1YDPB 3FS9A 4KROB 4XMKH 3WFDH 1FE8L 4AI7A 1KLGA 3MJ7B 4HJ1A 5EHFA 3P4NA 1TCRB 1G7HB 2P24A 1I8MA 2VQ4A 1EDHA 3L3IA 3QJZA 3ZJAA 3GBDA 3HG4A 4J3XA 4P23C 5KVEH 1U4EA 3R4DA 2R0KL 2DJUA 3K6DA 4N2EA 3WFBH 1YN6B 3ALXA 4W8RA 2X4PB 2IF7A 4PBDA 2VNCA 5F89A 4N2GA 3TT1H 3ZYIA 3RFZA 1DUYB 35C8H 3S36X 4OZIA 1BZ8A 3ESOA 3BUDA 4ZXBD 3EO0A 4ODTH 2VJIA 4FYSA 4ZJ9A 1BFVH 2B16A 4RBPH 4HWZA 4PVNA 5GRVL 4X9BA 1ZLUK 4BQ9A 4LNRA 1TZHB 5F7YC 4LFHD 1OP5K 1A6UH 4U1IA 3C2AH 3L4YA 4MS6A 2GUOB 4G6ML 1SDDB 2D7OA 5AB1A 1GZPB 1N2RA 1U9KA 2A83A 3CN1A 4J3UA 1J9S