3VSUA

The complex structure of xylc with xylobiose
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
638
structure length
638
Chain Sequence
b'MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
molecule tags Hydrolase
source organism Thermoanaerobacterium
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
total genus 240
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsuA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsuA01
1CGXA 5KEZA 4M8UA 1BHEA 2EABA 1QCXA 1ZJBA 1MVYA 1SMDA 4GKLA 3FAXA 2XWEA 1KCLA 1UKTA 3M07A 1JRGA 1UD4A 1TQUA 3KEHA 1OGMX 1HVXA 1VIWA 1TQWA 3GRHA 3T9GA 1DEDA 1DBGA 3A23A 1CGUA 1NOFA 4CN6A 1MFUA 3D51A 3S2CA 4JFWA 4U4BA 3VMVA 2BHZA 1CPUA 2GJPA 3WNMA 1AVAA 4Z05A 4PCSA 1LWJA 1V3KA 3W38A 1Z32X 4YELA 4JFSA 4B9YA 4XM3A 4Z06A 1SMAA 2O0VA 2ZX9A 3BCDA 3CZLA 3UG4A 1G1YA 1AIRA 3OLIA 5E6YA 1JG9A 3WNPA 4MR0A 3WWGA 1IA5A 3VGFA 1BSIA 3ZSTA 2PWEA 4H8VA 3L4XA 2EEXA 2BY3A 1D3CA 3WY1A 2WVTA 4OZZA 1BG9A 4CVWA 4FNRA 1JI2A 1DBOA 1H80A 4I84A 2Y2WA 2XN0A 1PPIA 4JFUA 4XL9A 2FYVA 5CGTA 3VNZA 3GQ7A 4NXSA 3A22A 1TCMA 1UD6A 3HG3A 3OLGA 2Y24A 2E8ZA 4GI9A 3WNOA 3WELA 5AMVA 3VMWA 1QHOA 1G9HA 2BHYA 3ZT6A 1QX1A 1J0HA 2OW7A 3B90A 2VUYA 3GXDA 3BVUA 3VNYA 2X6XA 2GJRA 1VBLA 3WDHA 4CKQA 3VSUA 3A21A 5I24A 2XIIA 1JGIA 3GXNA 2VBEA 1IV8A 1WE5A 1E43A 3VGHA 4J3UA 1PIGA 1ODUA 3K8MA 3GBEA 2D0FA 1L0PA 2QXZA 7CGTA 4J7RA 2X2HA 1JIBA 4WSJA 1U33A 2VRQA 3BCFA 3VGGA 1RP9A 5A2BA 4XLFA 3A4AA 3DDFA 2VJIA 2BHUA 2DIEA 3W37A 1CZFA 1XSKA 5BRQA 3WNNA 2ZXDA 4UQCA 4AMWA 2G3NA 1CGTA 2ALWA 5E0FA 3VMPA 3WY4A 3DDGA 2BY0A 1HX0A 4GI8A 3HG4A 1KTWA 2D2OA 1R34A 5F7UA 1HL8A 2ZUTA 4X9YA 1XCWA 2YKKA 1O88A 3WY2A 3ZT5A 2OW6A 2YJQA 3AMLA 2ZUVA 2BY1A 1S46A 3VO0A 1UA3A 4XR6A 2O1DA 3WDJA 5HDRA 3TTYA 1RP8A 2XVLA 1KGXA 3KE0A 4JL2A 4U3CA 2FHFA 2XVKA 1QI4A 4U2YA 4OZYA 4XLCA 4UQBA 1E40A 2ZX5A 1JXJA 1O7DC 3BUPA 3CZKA 4FNSA 1O8MA 1R33A 3BVTA 4YZXA 1VFOA 1UOKA 4OGZA 2PECA 1TQTA 1VFMA 4WLCA 2C7FA 4AW7A 1UA7A 1UASA 2QX3A 4LPCA 1UKSA 3EDDA 5BRPA 3LX9A 3WNKA 2V3FA 4M56A 3WNLA 2XN1A 1HNYA 1GVIA 4FNUA 1QI3A 3WDIA 1RWRA 3BMVA 4Z03A 2NT1A 3DX4A 2QLYA 1EHAA 3DHPA 3WMSA 4AYSA 4B9ZA 3FY3A 4YEJA 4E2OA 1O8LA 2FGZA 1CGWA 1O8KA 1UD2A 3FW6A 2D0GA 1HXKA 4KMQA 2CXGA 1TQSA 4XMYA 1PIFA 1O8JA 3S5YA 1KXHA 2VR5A 2VBMA 2ZE0A 4U33A 1KTCA 3CGTA 5I5RA 1QHPA 1MXGA 2D3NA 2NTPA 3IGUA 3CZNA 3IJ8A 2ZX7A 4JL1A 4FLRA 3D50A 1JD9A 2FHCA 1MFVA 4AYGA 1O8GA 1J0KA 3UW0A 1OT2A 2QPSA 1JF5A 3IK2A 3LXCA 2O0WA 1WZLA 4NXKA 2BXZA 1MW0A 3K1DA 3EJUA 2NT0A 1UD8A 2O04A 1EA9C 5E1QA 1JF6A 3A6OA 2NZMA 1B2YA 1VJSA 3UG5A 1J0IA 5DFAA 1BLIA 1JXKA 3DX0A 3WENA 2F1BA 1OGSA 1XD0A 1XH2A 2YFNA 3KLKA 2F7OA 4HP5A 4UQEA 3EQNA 1A47A 4FNTA 4YZ0A 2F61A 4AIEA 3BLBA 2CHNA 3FAWA 3ZPPA 2ZWYA 1CXKA 4OJPA 4H8HA 5E70A 1W9XA 1TQVA 2PWFA 1UH2A 2E4TA 5CLWA 4GIAA 1P6WA 1JTAA 2Z8GA 4AVZA 2WVVA 4J3VA 4UNIA 2E9BA 3HZ3A 3BUQA 1MW1A 3D52A 3GQAA 3KWXA 2PYGA 1ZJAA 2WPGA 4UOZA 1OGOX 1PLUA 4UCFA 1X0CA 4MXNA 5CGMA 4YZQA 1GJWA 1HWWA 1T0OA 2V3EA 3IJ7A 2WVSA 2WNWA 4U2ZA 1KXVA 1E3XA 2F7QA 2VRKA 4JFVA 4NX0A 1TMQA 1OOCA 1G94A 3L4UA 3L2LA 2VJJA 1XH1A 3CTTA 2CPUA 3AXIA 2ZX8A 1QWNA 2QV4A 2OSWA 2F7PA 3BVWA 2EQDA 2OYMA 1JDDA 1VFUA 1WPCA 3EDKA 1KB3A 1Y7VA 3KL0A 2Z1KA 5E6ZA 3CV5A 1XCXA 4NZFA 3EJPA 2NSXA 2WANA 3LRMA 3GXMA 4OIFA 1IDJA 1V3MA 2GVYA 2BSPA 1O8EA 2NT6A 1BF2A 3VSTA 4J3WA 2ZX6A 2OYKA 2IQ7A 1XSIA 3H55A 2NSTA 4XLEA 4LXFA 1HL9A 2PWGA 4AEFA 4UZSA 1JDCA 2ZXBA 5HXMA 1PXZA 4OJOA 2QPUA 1ZS2A 1R47A 3BLKA 7TAAA 2PYHA 4PCTA 2AAAA 4AEEA 1BPLB 1KCKA 4HOWA 1CXLA 2YA0A 3WFZA 2GUYA 1CDGA 4OJYA 3DX3A 3A24A 2X6WA 1OSEA 2YA2A 3VU2A 3JURA 3VX0A 2XWDA 4OKDA 2OYLA 4WF7A 2VBKA 1NM9A 4W8RA 1UD3A 2BY2A 1LWHA 2DH3A 6TAAA 4FMVA 1XV8A 3L4YA 3RIKA 1O8DA 6CGTA 2WKLA 5CLTA 3WY3A 1J0JA 2G3MA 4JFTA 3VGBA 3WN6A 4XLAA 3HG2A 4W8QA 2WCGA 4XOTA 4XONA 4XLHA 1OT1A 3K8KA 3ZO9A 2WSKA 2YOCA 3EJSA 3GQ9A 5HPOA 3VM5A 2X2IA 3MI6A 4KWUA 1CGVA 1SZNA 1R75A 4GQQA 4GQRA 3UCQA 1PZ2A 2YIHA 3H54A 3ZSCA 3VMOA 2WKGA 3TOPA 3BVVA 2J25A 3S5ZA 4DO5A 1RPKA 2Y5EA 3EJQA 1IDKA 4CN4A 2NT9A 3LPOA 1KBKA 2XN2A 3L2MA 1O8IA 2NTBA 1D7FA 3A47A 1OB0A 2QMJA 2WVUA 3D4YA 2F18A 3EDFA 3GXIA 2NTQA 1CXFA 1JL8A 2EAEA 2DH2A 2ZUWA 3TONA 1IZJA 4PSRA 3AXHA 5I0DA 3GQ8A 4XN3A 4EW9A 2AMGA 1MW3A 1PS3A 2EACA 1XG2A 3HJEA 1E3ZA 1WZAA 1WP6A 2X85A 2FH8A 3HG5A 3KL3A 1KWKA 1CLVA 3H53A 1BN8A 1OFLA 1RU4A 1CXIA 3GBDA 1VAHA 1Q4NX 3CC1A 3AMKA 3AJ7A 3EDJA 1AQMA 1I75A 1PJ9A 2D3LA 2FH6A 2F7RA 2WCSA 4QAWA 4UQAA 4WSKA 4NK8A 1K5CA 5A6LA 1UD5A 4XORA 3CPUA 4XNFA 2O17A 3DHUA 2V3DA 4XKWA 1QWUA 3K8LA 4PEEA 1BVNP 1VB9A 1KBBA 1PZ3A 1WO2A 3BMWA 1B0IA 3DX2A 4HA1A 2UVEA 3GXTA 1EH9A 4J3TA 5EMYA 1RMGA 4HPHA 3RILA 4URRA 1QW9A 3LMWA 1QI5A 2PWHA 3CZGA 1CIUA 3BSHA 3CZSA 3GTNA 5TD4A 1O8HA 1EO7A 4GINA 3BUDA 1XH0A 5E9AA 5A6MA 4XKVA 4GO9A 3A5VA 4FLOA 3UEQA 1C8QA 3UG3A 3BAYA 3UERA 3WEMA 1M7XA 2NSPA 4HOZA 1WZKA 2VT0A 1KXQA 2ZIDA 3LRKA 2F1AA 3WEOA 2BXYA 1O8FA 1UKQA 4YZAA 1JD7A 4FLQA 2ZXQA 1UH4A 2OSYA 4UQ9A 3ZR5A 3CZEA 1WZMA 4DO6A 1BVZA 1R46A 3DX1A 1UH3A 1U2YA 2D0HA 1XD1A 3BH4A 1MWOA 2D73A 1OFMA 2IGTA 3IJ9A 2INVA 4W8SA 1KGWA 3KRGA 1GJUA 1HT6A 2INUA 3II1A 4H7VA 1KWGA 4BZYA 3ECQA 2PWDA 4U31A 1KXTA 3BVXA 4HWVA 2C8NA 2ZWZA 4MB1A 1KCCA 3BC9A 4CGTA 1PE9A 1MXDA 2WC7A 2UVFA 3EJRA 2TAAA 4FLSA 5A2CA 2XVGA 8CGTA 2X6YA 1BAGA 1G5AA 2ODLA 2EJ1A 2OSXA 5A2AA 1QPKA 1QW8A 2ZUUA 2XIBA 3DC0A 1PAMA 3VMNA 4J3SA 4AMXA 2QY1A 1GCYA 4AIOA 5DO8A 1WMRA 3BAXA 1CXEA 2Y4SA 4NZJA 1KCDA 2X2JA 4HOXA 4PMHA 1AQHA 3EQOA 3ZR6A 4UQDA 4W93A 4TVUA 4PSPA 3CLWA 3GXPA 2DIJA 4FNPA 4DO4A 4NK6A 4W8TA 1V3LA 4GI6A 4H8UA 4X0NA 1DHKA 3B8YA 3BUBA 3LPPA 3VM7A 4CN1A 3EJTA 3VSVA 5C1CA 2VNCA 4GO8A 1JAEA 4NI3A 3GXFA 3ZT7A 5C1EA 1V3JA 3B4NA 4J3XA 3VX1A 3BLPX 4OJ5A 3BAIA 1EE6A 4H2CA 2EADA 3D4ZA 1MW2A 3LRLA 1KGUA 2F2HA 3BAJA 1QJVA 2EWEA 1U30A 2FHBA 4LQ1A 1CXHA 2WSPA 2FE0A 2E8YA 3QGVA 4XN0A 1PEZA 1JFHA 3TTSA 4OJ6A 1CYGA 4FNQA 3L4ZA 4MAZA 1JDAA 1HTYA 2ZUSA 9CGTA 3BUIA 3TV8A 2ZICA 2X3HA 4XQFA 1JI1A 3OLDA 5I23A 1GQ8A 4U49A 4OJLA 2E0PA 3LXBA 4J27A 3SUCA 3KL5A 1XSJA 1M53A 3BSGA 1HG8A 3KLLA 3ZQ9A 3VGEA 3BAWA 4JCMA 1H3GA 2WVVB 1IB4A 2ZXAA 3L4WA 2QMKA 3VGDA 4XOPA 1IZKA 3L4VA 1DTUA 3LXAA 2EO7A 4XB3A 5CXPA 1KTBA 3BAKA 4BA0A 3ZOAA 2YA1A 4C2LA 4J28A 1CGYA 3OLEA 3ZSSA 1XGZA 3EDEA 4ATWA 3L4TA 2YFOA 1AMYA 1NHCA 4JCLA 4UOQA 4UZUA 1EO5A
chains in the Genus database with same CATH superfamily
3BAEH 4Z78A 1KCVH 4G8EB 4M8UA 3E6FA 5IM7A 3BKYH 2WLIB 1BHEA 1QPXA 3B6SA 1SJEA 4I2XA 1UKTA 3D39A 1MH5A 1X5GA 1DFBL 4EVNA 1BX2B 4ZXBD 2AXFA 5GRYA 5EOTB 1U93B 3ZMNA 4CSPA 2XWJB 1TTGA 1UXWA 1X6LA 1AE6L 1BJ8A 5JXAH 3LEVH 2OR9H 4P46B 2XZZA 3SY6A 2LE9A 1Y0LA 3WBDA 1BQHG 1DQIA 3UYOD 3ZDWA 4MMZA 2DQDH 3GWJA 5DD3H 3HTLX 4Z9KB 1KTDA 4ONGH 4BUGA 2QGEA 3PDOA 3APFA 2CIKA 3ESUF 3QUYC 4M6OL 4NQDB 1XGQA 4XOAA 4A7GA 1XQ4A 2J2ZA 4OCSH 2O0VA 4X99A 1F1GA 3BCDA 2QGDA 3UTQA 2YUWA 4EUPH 5J6GB 3VCLB 4N28A 4HGKC 5FKPA 4NUGH 1OF2A 3S34L 1UJ3C 1GSMA 4K07A 3QG7H 3SYOA 1T04A 3DX6B 1NCWL 3QDME 4P05A 4EKXA 2NUPA 3LQAL 4BZ1H 2O6FA 2DBJA 1OTSC 3EYVB 4N5EC 1IM3A 2H8PA 4L2LA 4FG6D 2GBUA 4QGTA 4U1MA 3ZLQC 2WTRB 3VNZA 3F64A 1IIIA 5E2TL 1HZHL 4Z7WB 3GMPA 5DHYA 4UV7L 1QHOA 4AG4L 2PYEA 5E8OB 3GQFA 4M5ZL 4PB0L 1PDKA 3U4BH 3DYPA 3FUHA 3NJKA 4NRXA 4X4YB 1SQ2N 5B4MD 3BWAA 2MOGA 4GRWB 2EWEA 1JIBA 4G9FE 3ROLB 2GJ6B 3VDCA 4KKLD 4AL8L 1RP9A 1NPNA 5F7LB 4IRSB 5CILH 2DV6A 4PVBA 3KPRB 1RZJC 4ODWA 5SX4H 3NAAL 2DMCA 3VXRD 4U6VL 2J57A 3I3BA 5CEZL 4DZBA 1H3XA 4XTRD 2F5BH 2YQBA 4CNIA 5AAPA 1A6WH 2FIRT 4O4YH 1ET8A 2IMNA 4RLDA 3Q6FA 5ICXB 1LTXA 1NOAA 3LPWA 4KY1L 2BSRB 4P3DB 4Z3IA 8FABB 4KVNL 4PG2C 1D9KB 2R2EB 4CC4C 2YPLE 3GSXA 1JGLL 3EUDA 4ELDA 3FYEB 5F7MC 2CHZA 3M17B 2EIMB 3DV6A 4GQPH 4PGDA 3GK8H 1HKLL 3Q5TA 3C6SA 2HVJA 4QNPF 2XVKA 4XNUH 1QI4A 3KEDA 4PRAB 1H5BB 2J55A 2X87A 5B3SB 4PG9B 4U6YB 1VF5C 4MJ5B 3QPQD 4GIPD 4ENED 3FCSB 1K4CB 4QRTA 3QNZB 4JUTA 1M71B 1QATA 2IALA 3E3QE 2LU3A 3HS0B 5KVDH 4DFIA 1RZFH 1XMWA 4H20L 3GJEA 2C4FT 2NDFA 1M56B 4AE0A 1XF4B 3TNMB 1TZOA 1RHHA 4G5AA 4AIZA 5DMKB 2Y1ZA 1UC6A 4IIQC 3UZVA 1RUPH 3NGBB 5F7HA 1J7VR 4WFGD 3TA3A 4MYWB 5CEYA 4KJPD 4E0RB 2BOLA 3FU7B 3O4OB 1EAPB 3T6ZA 1BD2B 1HHJA 2XQYK 5D93B 1CLZH 1KPRB 1ZVYA 4FFTA 4K5PA 2UWEB 4B7LA 3S5LB 4NQVB 1CDYA 4OUUB 1XHHA 3S5YA 2Q7NA 4CVZA 1OW0A 4R2GB 2H6PA 2JI3A 2Z0BA 2IO5A 3NIDB 1CL7L 1MEXL 2BX5A 3IGUA 5D1ZB 3D50A 1KLFA 2GAZB 3FTYA 1O8GA 4L5FE 1GZPB 4JHWH 2ZYHA 3PNRB 4JO5A 4D0CB 5FO2A 4R3SB 5FEBA 1KN4H 1XF3A 3SQRA 4JAMB 3WEXA 5DFVC 2FJHB 2A9MH 2GK0B 5I9QB 3HJ0A 3M8OH 3UG5A 5D1XC 5EO1A 3LIUA 4ATTA 1PLGL 1HOCB 4QYAA 2YXMA 4A38A 2IWGA 3MA7B 2F7OA 4P5MB 1BAFL 4XCEB 5A2LH 4OF7A 3S7GA 3M86A 3T0EE 1KFGA 1W9XA 3RFZA 1P7BA 4XWGL 1UWXK 4XPHL 3S88L 1D7DA 5FK9A 1YEJH 4X6DA 2EVHA 2DQHH 4JY6B 3REVA 4DT2A 4PJ8C 3HKZA 4IGBB 3RZCD 2BVOA 1JTTA 1G0DA 3GPSA 2V7NA 5DRZA 5B7EA 3F3HA 4I0PD 1CLYH 4I3SH 1HEHC 4UTAH 3TO4B 1NEZG 3QUMH 1FNEA 4JKPL 5JORA 4NRYB 2BSSB 4P5KA 5KYUB 2CBOA 5J1AA 5K1JA 3L4UA 2R9HD 5I8OH 1H8OA 5I1IL 3NRPA 4W9JC 3KPNA 4FTVB 3X1FA 3AXIA 1RSFA 3HLKA 3M7OA 1RJLB 3O11B 5EHFA 2VR7A 4Y1AA 4PI2A 2R8SH 5AOJA 1RK0A 1TETH 4DGYH 2Q1EA 2IG2H 2G60L 4I5BA 4UM8A 1AGBB 1HSBB 5L9DH 3GXMA 2NY6C 2Z35A 4MJIB 4P2CG 5EPMA 4M43L 4ZSOE 3NZUA 2MJWA 1F8TL 2NY5H 2OMWA 4OLVL 2XT2A 4IW4C 5FDWA 2NSTA 1M7DA 2HVKB 3KVDD 4M1DL 4HLEA 1XAUA 2Y7MA 3OZKA 3PWPB 1RUQL 1KUMA 3DXAA 1EFXD 4IHOA 4YLCA 4PRHE 2J1KA 2H6UA 4FXGB 5KYWB 3SO3C 2DM3A 2CDEB 3ARFD 2IANE 3GI9L 4BQBA 2XBDA 2Z31D 3V6BR 3T1FA 2OR9L 1A7RL 3MGAA 5DJ6A 3BUYA 2VJ0A 2XU9A 3GSVB 5IMMA 3BN3B 3RHWF 2FSEB 2K4AA 1LEGA 2YQ2A 1NC4B 4Z7QF 4DUWA 5FYLD 4IEFB 1CO1A 3GNML 1M1XB 1NSNL 3LTVA 4Y2DA 2VZSA 2G9HA 3HC4H 3OXSA 4MBOA 3V4VL 2CO4A 2R0WH 3D2UB 2FSDA 4RMQA 1MJUL 3ZO9A 4ZW5A 2DD8L 2ZUQC 4HKBB 4KK9D 4GP8B 2V8LA 4PJ9B 1NGXB 4X5WB 5FM5M 2EDWA 4XNMB 4GQRA 3O4LA 3FL7A 3QDHA 3H54A 3O6ML 4XVUC 4QHUA 2DJSA 4A55A 5E6UB 2PCYA 4EZLA 2VDPL 1CK0H 1TCRB 3MFFB 3T8XA 3F7KA 1UACH 1M7IB 4YX2H 2XYBA 1BF8A 5GRXG 3QIWD 4PJIA 4W68A 3VI4B 3ARWA 1Z66A 5HDQH 5AZEL 2WVUA 4XVJH 3DROA 2F18A 1SOXA 1YNKH 4EDWH 3TONA 2EIKB 2JTYA 5E2UH 4FABL 2VDOL 5TH2B 4XN3A 5EZIH 4ZMWA 3NABH 5MEND 5LBGA 4U1JA 1OFLA 4PGEB 5TE6L 3S48A 2XYCA 3U9UA 3QI9C 3KXFB 1P4IL 3C5ZB 4YWGH 4LPXA 4ZUUA 5EN3A 2X5PA 1I1AC 4KX7A 2D3LA 2F7RA 3N85H 3WTTA 4JRLA 3G04B 1RZQA 2QLVB 5DS8B 2R69L 1PKQB 4BK4A 5JQ6H 4FFYA 2OK0H 5FW6A 1WBXA 5DT1H 5DD1H 4X6EA 3HLAB 3HUJF 5A2FA 3QEQA 4XN1A 1IGML 1T1ZB 5EEYA 2VDLH 4XPTH 3ARGC 4NN6B 1YMMA 5GGRB 4QRRD 3CBKB 1LO5B 2ZP8A 1G4RA 3QZOA 4Q6YA 1BFTA 4TULH 1AHWB 4NHUB 1PZ5B 1AAJA 15C8L 3OJDB 2J88H 1TNMA 3VRIB 1T7ZA 3FQWA 4KKPA 1J8HE 2GFBA 2VXUL 3B7TA 1UXSA 1IKNC 3J27A 3QIUB 4A1RA 2VT0A 3WEOA 2IFFL 1E9PA 4GXVH 4PM1A 3CMGA 2X41A 2W8CA 3CFJA 2LOEA 3SE3C 2VLLA 5IMKB 4YHPB 3QUYA 3ZR5A 4QIRA 3TT3H 4GRWH 4N5UA 4ZFOL 1PCXA 4PBDA 1U8OB 1LO2H 5JLZA 4P2OA 1MWOA 2D73A 3MJ7B 2IGTA 5I73C 2PLTA 5E08H 2JJVA 5L0QC 3HE7D 3GTTA 1ZXKA 3O41A 2IAMC 4NQTA 4OZHA 5EULV 2FJGB 4WUUD 3T04D 1H8SA 1WV7T 3VXRE 1T21B 2MTAA 3MLTA 4G6JH 1FVEB 1FLRH 4GNKB 4IIQA 4IRZA 4Z7WE 1IGIL 3UTTE 4PRNA 5CMAA 1AI1L 2A6KB 4WHTB 4I3GA 5CHNA 1I82A 1RUPL 2DEYX 3B56A 4MJ6A 4F5CE 5CWSA 3Q2NA 5DRNA 3KMDA 5DURB 3L9RA 2AK4A 5A6IA 1OCWH 1I3VA 3PIQA 4ETYA 4J1UA 3L7FA 2FO8A 3QFJB 4ANUA 3VGAB 5JIQA 4OCWL 4QRRE 3CUPA 4DQAA 1W0WB 3MNWA 4XNUL 4K7PL 4IKKA 3UJJH 3I6KA 2IDTA 3ARZA 1QZ1A 3NJLA 4OJAA 3ZDZB 3WIFB 1FZMA 1X4ZA 1A6UH 3THML 1EE6A 2BMKA 5IQ9A 3D4ZA 5AVWB 2F2HA 15C8H 4NI6A 5F6IB 5T5FL 4OLYL 1FGVL 3OHXA 4KTDL 1OM3L 3GEFA 4L8SC 2W5PA 2FNBA 2FJUB 3AWGA 3QNFA 3WO4C 5D1QC 4L1LA 4FA7B 1I1FB 2X3HA 1NWOA 3D85A 1GQ8A 4W9DC 1KJVA 2HT2C 5I82A 1QA1A 2C9VA 2X0UA 1JZFA 4F24A 3ML3A 3Q48A 4PJGB 4KI5C 3ZQ9A 3ECUA 5HD8C 4OV5A 2YD6A 1RZKC 4QWWC 3T0ED 1NBZB 4R5XA 3EG9B 3EH3B 5JNYB 3LKRB 3JQOB 4KV5F 4NAQA 3AAZB 4DEWA 7PAZA 3FHQA 5CXPA 4LKCB 4IJ3C 3HR5B 1UOWA 1WFOA 5CD3A 2G5BB 3IGAA 1TITA 5F8QC 1NC2A 1BPVA 5KVGH 3CFDA 3EYSL 2VLKE 1RUKL 1YEKL 1M7UA 4JCLA 4Y8AA 2EE9A 5K39B 4N2DA 4YHOL 2UZXB 3RPBA 2IGFL 4ERSL 1D7CA 1JRGA 2FBRA 4U1GC 5I15L 3S2AA 3FZUD 2BSTA 5LB1A 4NKOA 2PW2A 3PJNA 1UCBH 5F7WC 1D5IH 3I75A 3BZFA 3ULVF 1YMMD 2WBXA 3ARPA 3U6XS 4ZT1A 1WISA 3QIWC 2XXMB 2BJML 4NQSB 4WGVB 1LE5B 2BNQD 2VDMH 3WNMA 5I9QC 2NY0D 1SM3L 3MNVA 2HFTA 5IBTL 1KPVB 2BOCB 1S8DA 3BGFC 5KUMA 4BZ2L 1PNCA 3DYOA 1NAMA 4N2CA 1BQHA 4NPJA 3V8OA 3U25A 4OCSL 5E8EA 3ESPA 3B1TA 4KTEH 5F9JB 2FUTA 3UDWA 4KAQH 1BD2D 2WKOA 1YEWA 3F05A 3IMRA 3M1OA 3VGFA 3H9SA 2NY2C 7FABH 2PWEA 2OX5A 4FQIH 2DYSB 4OCXL 3VFPA 2OTWB 5BVPH 4L8BA 2DLEA 2IWFA 2UZYA 4OZZA 1BG9A 3FT3B 4Q7DA 4F9LC 2IBBA 3EYUL 4FI6A 5HDLA 1DBOA 4IS6A 4EN3A 2CK0H 2YGOA 4JFUA 2FYVA 3F7VB 4UAOC 1SEBB 4EMZA 3SBWA 4G3YL 3KBFA 3BOVA 4XB8A 5DZLA 2FX8L 4Y0GA 5CF3A 3B37A 5DRWB 1O9ZA 2OW7A 1QFOA 1MLCA 3BKMH 3H9HA 2WLHA 4FZEH 4YDLC 1URZA 3VSUA 5I24A 1PF3A 4NCC1 2Y72A 5DVPA 4JZJC 2XRAL 4KXDA 2X3AA 5D7LD 4QOKA 2HWZH 5A2IH 3IMTA 5HGDB 4J7RA 3L3OB 4RZCA 3BUTA 3QEQE 2NY6B 2QHRH 3IB4A 1SY6A 4DF9A 4UINL 3E6FB 5IM7B 1QABA 2VDKL 3PUUA 5E99H 5CEZH 4JRXA 3ERXA 1FSKC 3QIBC 5F9OH 4GG6A 1HJCA 4FEMA 3FT2A 5EOTA 1NBCA 1F90H 2VITA 2NY6D 4WHDA 1X44A 2RAMA 5T3ZL 2BZ7A 4XMPH 5IW6A 4F9LA 1U2HA 4PWFA 3ETTA 3NMEA 3F6IA 2C7UB 3PWLB 4WWKB 4M6NH 1EBPA 3RVXD 3FFCE 2P48B 4C4BA 5IV2B 1A66A 1MJUH 1R19A 2BY1A 3S37L 3RWDA 1F4WH 5KSAA 3FBQA 5DJ0B 2O1DA 4ICXA 3ZE1F 2YR3A 3TZVB 3SB3A 2PCPB 1NCAL 3MX0A 4QTIL 4OLZL 1U8JA 5E6ID 4I9XA 2X4PA 4S0SD 1PZBA 2BERA 4JRXD 3DUUA 4GS7B 4YNYB 1E40A 4ONFH 4IRZH 2PNDA 5B3JE 3BUPA 4N2IA 3I6GA 3MO1A 4JMNA 4MAYC 4G8FB 4WFFE 3RB7A 3PFQA 3QPKA 3HEIB 5B8CB 2CKBA 5HDQL 1NAMH 4LB8A 4AYMC 1NAKH 4JRYA 1F11B 1UKSA 1YUHB 4E9SA 3F00A 4QHKI 4KQ3H 4LLAA 3L5JA 3MOQA 5AVTB 2FVNA 3SDXA 1LP9E 4WK4B 1NGZB 4FNUA 1RWRA 3QDGB 2CE6A 4RRPG 3QI9A 4WFGE 4K23L 4R4BB 3OQRA 5F6HJ 1IT9L 3VGAC 2OTPA 2GC7C 4NKDB 2KDGA 5FHAH 1AXTL 3ZRFC 4PQXA 2XTYA 2P4AB 2PYEE 2FGZA 1BLNB 2K45A 3CDZA 4P99A 3Q5OA 2D0GA 5EIVA 1MWAH 5AUMA 1KDIA 3UJTL 3PP4L 1QA3A 2D2CC 4PWKA 1UQSA 4D9LH 4UM9B 2NR6C 1Z6JT 4WENB 4RFEA 4P59H 2BNQB 3EO0A 5HYFA 4JHWL 1EBAA 1DN0A 3STZB 4N8CL 4OM9A 2QFRA 4QHNA 1GZHC 4X6CB 5IMLB 1GH7A 4H0GA 4JY4A 1MFVA 1IU1A 1MUJA 4PHZA 3HPJB 3SO5A 3JSSA 2NY1D 5BCAA 3IK2A 2WQXA 3OGOE 5LCVA 3SKUD 4NWTH 1TTRA 5JR1L 4WWID 4M93B 2JXMA 5TQ2L 2Q8BL 2ENJA 3P2DA 3LRSB 1D6VH 4M8QB 4Y2DC 5HYSB 1OV8A 3BJLA 1FVCB 4G1EB 5IVXB 2VFNA 2IPTH 4XR8C 5DUBB 3BFQG 1EVTC 1CFTB 3FCBA 3O2VH 4LCVA 3C6EA 1I1AB 3O9WA 1I1YA 5F1NA 3U46A 1SYSA 2V0AA 2ARJA 4XC3L 1M05B 2P7TA 3VRLF 3QQ4A 2BP0B 3IT8D 2VXTH 3C6SB 3RUGA 4LL1A 5C2BL 2R7EB 4GSUA 4IMLB 3FQTA 3FU6A 3IS0X 4X7SH 5IW1B 4Y16D 4K5OA 2VDRL 3ARGB 4NN6C 3U36B 2AJZA 5I1KL 3TEZA 3JV6B 4U1IB 3Q8BA 5LNGA 1HZLA 2Z6FA 1WFTA 5DLLA 2W9DL 1Z9PA 4JKPH 3L5WB 4IDJL 3EGSB 3II2A 1M71A 3MYJB 1GJWA 1HKLH 2JCCF 1KZQA 1O6SB 2XCMC 3P1VA 4LDOB 3HOGA 3QVAA 3FPXA 4LSSL 2O1AA 1TMQA 1SNRA 2Y36L 1XH1A 4NM4H 1QPPA 5H4YA 4J2XA 3RWEB 4JFEE 1SOSA 1YSOA 4KQ4H 2L04A 4PJCA 4PGJA 1RZIB 3N43B 3ME0A 1AOHA 4ODVH 5E94B 3ZKND 2AP2A 5H4ZA 2EVGA 1YNTA 4BSJA 1XCXA 4IHBA 1BWWA 1RLWA 1KB9K 1NLDH 3FONB 3X17A 4YUEL 4MLSA 1YEEH 3L3KB 4H44C 5E00A 1W0YT 2XV2A 1FYTD 1X5LA 4YE4L 2B5IC 2X4TA 3LAFA 4PGBB 4ZAKB 3NG5A 2WBJB 1D6EB 4FL4B 2W9DH 1HL4A 1AKJA 3F7LA 3VXPA 3Q2LA 4WFED 1ZMYA 1JDCA 5B3JF 1F0LA 4S1RH 4F7CB 2O6DA 3AFLA 1J9SA 4BFBD 1M9SA 2AAAA 3VD5A 3K3QA 4YE0A 3WN5B 4FTDA 4K71B 2A9DA 3GUTB 4FG6C 2BWDA 2YA0A 3N44F 2PCFB 1ID5I 2LQRA 4GMTH 4M7KL 4HV8A 2VMEA 1MCNA 4R0LC 4UQ2B 2BOBA 2YAHA 3VFTB 2BM7A 3B7UX 4FI7A 4JFYA 1GYUA 1FHGA 5C71A 3WO4B 1L7TL 3OKLA 4FQ2H 3T6WA 1EIBA 4XCEA 4PD4J 5DWPA 5IREA 4PJ5D 2WB7A 4W9HC 2OSLA 3MJ6A 1FCGA 4A7QA 4MDIB 2Y7LA 2G4GA 2I07A 4N8PA 4EUPB 2AGJH 4JANA 4HSQA 4GXUN 1R6VA 2V8MA 1LLAA 1P4LA 4JG1L 4MXVF 1P69B 4TSCL 5FGBC 5AOMA 2CUAA 3NZ8B 4KZDL 2EXTA 5HPOA 1AO7E 1GAFH 2NZ1A 1A02N 4Z3GA 3PAYA 2YN3A 4NENB 1TJIL 2WZ6A 4JO4L 3EYSH 2DM2A 2Y3NA 1JZHA 1K9TA 4A2GA 3QIUD 3QIBB 3P0GB 3VI3E 1QLFB 4XCFH 1J48A 1WIOA 5LN4A 4GMTL 3I2CH 4O2EB 3ARBC 4ZMPA 2B4CL 2Q7AA 1RURH 3VG9C 4G82A 1NAML 3GQ8A 1DANT 1OHQA 2ZZUT 1EJOL 3V0WH 5DHVA 4CKVX 1CE1L 1ECZA 3HJEA 1WP6A 2ZYRA 4JG9A 1RU4A 1U8NB 2AXHA 3QWOA 3VWJD 4ZG1A 4YQXH 3QFDA 5GGUB 1COBA 5FGBA 2ZCKH 2KYIA 2WXMA 1ORSA 3ECBB 3VFVB 3KPOB 2WTOA 4KVNH 5EBMA 2EC9T 3UPRB 2GBAA 2DLIA 4PJIF 4XXDA 2HCZX 3SQOH 3MCLL 4FQPA 4JZNA 1P53A 4DCQB 4P2QE 5E8DL 3N42B 1KEML 5K9KB 3J2PA 3KJ4B 4IHOB 4OIIH 3V7AE 1RMGA 4LCUA 1ERNA 5F96L 3UAJD 1HHIA 1CIUA 2R0KL 3FCTB 3VG0H 2Q5BA 2AQSA 4GINA 1BVOA 4PBXA 5I71C 1DLHA 4B97A 4KJQC 4MMZC 2B9AA 4EIBA 4HULB 4PJFE 1OLZA 1A3LH 1RMFL 1NC4A 4UQ3A 1YMHA 2BCKA 5FHBH 5JOPD 2AV7B 2R0WL 2EDLA 2CGZA 2LABA 2YBGA 2G9HB 3FUFA 2WZ5A 3G3LA 4DN4H 3SBQA 5DI8A 4HIPA 3L1OL 1INEL 5DVKA 4LLUA 4C56B 4JRFA 4X6FA 3V6ZB 1JNNH 2Q86B 5JXAL 4JFED 1GJUA 4UINH 1WAPA 4EDXA 2A4CA 32C2A 2I60H 1UM6L 4G70B 1G0YR 4N2GA 1M7IA 4MCZA 2IAMA 4HW6A 1RULH 4UQIM 1JE6A 3PS6A 3GJFA 3NSYA 1FIGH 3PWPE 4JFXB 3D69B 1L9PA 1F13A 1OGTB 2FO4B 2GEEA 1JMZA 3DC0A 4ISVA 3M1CA 1RK7A 4HX1B 4YC2C 4K7PX 3KHQA 2O17A 1WMRA 1YECL 5ITBL 5SWQB 2Q2EB 3CSFA 4DNLA 1ZGLA 3Q7JA 4PGEA 1A5FH 4JKKA 5PAZA 3SCMB 4KK5C 4RGMC 4HKJA 5ISZA 1O9WA 4FADA 3CDFA 5MP6L 1WCQA 1GMIA 4YDKL 1OTTC 2H7WA 3F84A 4J8RB 3SZEA 4XOEA 5DS8A 5IOPB 3BPNB 4N2MA 3NA4A 2D3VA 5FGCB 4PLNC 4KZEH 4IRZL 2X6UA 3BAIA 2R0LH 4GKZB 3WJJA 5IQOA 2NZ9D 4JHZA 3SQBB 2YEZA 1FIEA 3FUDA 3P30H 4M03A 4WK0B 4IRSC 2IAAC 2R0KH 2FEDD 3CCHA 3GMQA 4RH4A 3AADB 5HHVH 4IRJB 3TGXA 4BDVA 1PEZA 3WKMH 5LBVA 2IH1A 1S7RA 3MA9L 1E8XA 2YPLD 1TQCB 1CU4H 5B1KA 5JW5B 5AW0B 1TKWA 4F7PA 2CSPA 2HH0L 2ZICA 3ILPA 3UO8B 4A7SA 3SUCA 2WZPD 2L8AA 3H2PA 3NSCA 3PAZA 4WTXA 5CIPA 1NKOA 3PGCA 1TSHA 2W92A 1LO4L 1TNNA 4IK7A 1M3IA 1FE8L 2LLNA 3VD4A 3SKMA 1KCSH 3HBGA 7PCYA 4XB3A 2SODB 2K6ZA 3G5ZA 1TYVA 3KPQA 4M62H 1FC1A 4YXKH 1QBLH 3QDGE 1IBFA 3BP7A 2PPDA 1H3VA 1X9QA 1OWRM 4PGCB 2HN7B 1QSFD 3T2NL 2IDSA 1OLLA 3GYRA 2AMUA 4S1SL 3F01A 3Q2CA 3KR3H 4XCFL 5I1GL 4WJ5B 2G9KA 4K5MA 4AITA 2J20A 3H09A 1R3JA 3T9GA 2IPTL 3JWDL 3E6HB 1HILB 1DBGA 3A23A 2LTQC 1NOFA 2GUOA 1MFUA 5IVZA 4J1UB 3I9AA 4UTCA 3TCLA 4Y7MA 2YPLB 2KLTA 3BPOB 3P11H 1AVAA 1NCDL 3NZHL 2X1OA 4FZ8L 3ZE0F 2WNGA 1WC7A 5F1IA 4H25A 3KZ8A 5C9KA 4OJFH 3VVWA 3RGVC 3ILQC 3HC3H 4ZTPL 3LJ3A 2QVIA 4U1LA 1FYTA 2MNUA 2ZX9A 4LCWA 4AKPA 2UUDK 3CZLA 2AXWA 3T77B 4KK8D 2FLBT 4RX4D 3N3EA 2HG5A 2WWOA 3UEZA 4F27A 3MRPA 4WDIB 1FFRA 3C5XA 3X2QB 2HUHA 1AJ7H 4KNTA 43C9A 5B38A 3MZTA 1XB3A 3G5XB 4W4NA 2ZNWA 3MNZB 2R1YA 2A3TA 2XTXA 5AAMC 4XL9A 2CO7B 2B2XH 2YMOA 5CGTA 1DLFL 2MPAL 3IS1X 4PJGA 1QR1B 5JDSA 1HQ4B 1OZUA 4GI9A 4WCYH 3KWWA 3WELA 3TA3D 1RHFA 2KS0A 2DIBA 4G42B 2AV1B 3VNYA 1WS7A 3QEUA 4P4KB 4NCC2 4ZTPH 3ZRCC 4D9RE 1QFWH 4R2GC 1HNFA 2EUXA 4JO3L 1KLGA 2J8UE 3OTTA 3MLUH 1VZGA 2ICWI 4FCAA 1NGQL 5CSBA 1U33A 4B53A 3OKKA 3KW8A 3MV8E 4QMEA 1PZDA 4HFUL 2OYPA 3TIDA 1JZJA 1D5ZB 4XLFA 3LS5L 4ORZC 4KXZH 2AJSH 2VJIA 4J3OF 4NN5C 2DIEA 3IU4H 3BN9C 4AZ8B 3MOAH 2OQJB 2EEDA 2PXYD 3D06A 4U1NB 3ULAB 3RY5A 3DK2A 2R51A 3N41F 4L8SB 1LILA 4OZIF 5DQJB 4KVCH 4UNVA 4LOUD 1JWSA 1FF5A 3QXVA 3QJFA 4JFZH 5H35A 2H32A 1LE5A 4XNBA 2YKKA 1G7QA 1MHHB 2DYPB 4BSWB 1S8DB 5CN3A 1OTTD 1D5MA 4BFIB 1CLOL 2SEBA 3VO0A 4XBMA 4MVBD 3ALWA 5IK3B 4YHML 2EH8H 4JQVA 4M8VA 1YNTF 5CLXA 2OCJA 4IQHA 4MCNA 5KJ4A 2Y5TB 2Q2LA 4A67A 3MLYL 3NOIA 4ZS7H 4E9XA 3U7WL 3H9SB 1OM9A 3QJSB 3BVTA 4LOEA 1VEPA 4FXGC 1GYWA 4EJ1C 3S3PA 3B5TA 3JYCA 4ANKA 3GRWH 4MXQD 4BELD 4YH6A 4FQLL 1Q9LB 4X8GA 3PXJA 2OXGA 3ML8A 3DVNA 3H7BA 2YEQA 1HHKB 1SN2A 2C9PA 3TX4A 4L3CA 4OGYH 4FQQA 1HEZB 5FO8A 4NQEE 3FY3A 4YEJA 1GGUA 1MWAB 2ICCA 1R3HB 1N6UA 2QFPA 4WHCA 3AM8C 2IH9A 1HXKA 1RVFL 1O75A 5EBWA 3HC0B 4QTHA 4UV4L 2FDBP 3QXAA 4F2FA 4Z78B 4DGVL 4N3TA 2WLIA 4GUPA 2LR4A 1B2WH 2E27L 2V5TA 4I1NB 5I1CL 4HJIA 2QGCA 3K6FA 4NUMA 1F45A 2QPSA 3B7YA 4CSTA 5I18L 3ETBF 1NGWA 4QHPA 3N5AA 3PY9A 4GG6B 3QULB 5JA8B 1SHWA 2BH0A 4PJDF 1L3NA 3UTOA 2VO8A 5T1LD 1MI5E 1A6ZA 1RZ8B 4JKLA 3IU3A 4GUCA 4HH9B 2HMID 1TZHB 1DQJB 1SVZA 1YQVH 3MJ8B 4DUXA 2FWLB 5LNEA 1GCFA 3MUGA 4G83A 4MFHA 3GSUA 5IP4A 4GG8B 2ZWYA 4CAGA 4DVRH 4KV5E 4LNRA 2GTZA 1A14L 3FXIC 3QPXH 4KRLB 4JFHD 4Z95L 2ENYA 2DQFB 2P5EB 3FN9A 1MCDA 4MB4A 5D70L 3ZKQD 3K7UA 1MI5A 4RNRA 4MHHG 4GRMB 4MA1C 4N8VA 5H37H 3RJDA 1IM3B 2H8PB 4FERA 3A6CL 4BYHA 2WPGA 4UOZA 5I66B 3NBNA 1OE2A 4NJ9L 3OMIB 3VD2A 4ANXA 1EPFA 2I24N 2Z4TA 2HUEA 2ITCB 3HN3A 3S37H 1NGZA 5L6YH 3MC0A 1N8ZA 4YZFE 3U2SA 1NIDA 5JPNB 1ZGLP 4XNYL 3S8WA 4GSDH 1OOCA 3BPOC 5LGHH 4C56E 5DJYB 3UAFA 5DFTA 1SFDA 1DYZA 5LKNA 1MCKA 3FU9A 2J1WA 1Z0NA 1PY0A 4NC1E 2IIJA 2WWKO 3CX5J 3BVWA 2N56A 2CO6B 1B90A 5DJZA 3Q6GL 2F0CA 1PG7H 3UH8A 1BEYL 4Y5XC 3RG1C 2VLJD 3W57A 2XWTB 4I0PB 3FN0H 3FFCB 1YEFL 3OHMB 1H0DA 4IGBD 1IDJA 1MRDL 3KPRA 2PN5A 2GI7A 2J43A 2VGLM 2VQ4A 1DEEA 2KHAA 2E47A 1SUJA 3MODH 5CO1A 5B39G 4UIMB 5IJVB 3TBSB 1ZLVK 2CBPA 3HNSL 3MNMA 5FUZH 4AEFA 3AU1A 4MAUL 4I77H 5D7IA 1B9KA 2XQ0A 5HHXH 5EO9B 2J56A 1CDCA 3Q6FB 1T6WA 5ICXA 2I9LB 3P54A 4OZGE 4Y5YC 4AL8H 1I1AD 3O3AA 7TAAA 1BPLB 4JLRB 4PR5A 1CURA 2P5WB 2PXYA 4TVPD 1TQBC 2E9GA 4IKJA 4J12A 4JJ5A 4U6XB 5I6MA 4KKCD 2X6WA 5J6HB 5KVGE 2IC2A 1XF1A 3PABA 1H6EA 1IQWH 4NNPH 4PJXA 2QQQA 2CJUH 4XOBA 3NIDF 3TH0A 4HG4K 1I1AA 3MR9B 2CKBL 4O58L 2BS71 3WFHB 3KWTA 5CR8A 2ARJB 4NWUL 3RLSA 3IGLA 5CN2A 5FW7A 2BPBA 4LLDA 5IB5A 1LEIB 4XONA 4OIBA 2K78A 3MRGB 1DVSA 4LASH 3HC4L 2F19H 3BP6B 5FOJA 3V4VH 2IALB 2ZKHL 4JR9L 3UADA 3HAEB 4M7ZB 4M5TA 4NPKA 1NBVL 4KBPA 3QUKA 5E2WL 3CFBB 3MBXH 1QFPA 1H15A 4S1QL 3UZVB 1IAIM 3LH2L 4MJJA 5DVNA 2OMVA 2IGFH 2WO2B 4R8WH 1QRNB 5GS0H 4ZOAA 4NZTH 1A4BA 1SHSA 4KJPC 5HHPB 1W6LA 3OZ9L 4WVRA 2ENSA 3U7AA 4OCWH 3A47A 1OB0A 3EDFA 1DZBA 1JL8A 5F0LB 2BM6A 1BREA 4ZZFA 4LVHB 3LNFA 3Q06A 1OAKL 2FCBA 4C8XA 3O3EA 4QCIA 2I69A 2VJXA 4PJXF 1L9NA 2HXAA 2BINA 3AZUA 3LNGA 4OJFL 1KLFB 2GAZA 2WXOA 3Q0HA 1EMTL 4D0DA 3WAJA 2X70B 4NKQB 3TBWB 1MI5D 1TXKA 3VAEA 2F53A 1ETZA 1DVUA 9PCYA 2YK1L 3RQ3A 3PDGA 5EORL 5DNSA 3S35H 1SXZA 3B9DA 2ORBH 5A2JH 4UMSA 4G8IB 3DX2A 4BWTA 1A2YA 1EH9A 1PX8A 2ATPB 5FF6B 4NNYA 4HPHA 3EXJA 1RV6X 2WY3B 1RZJL 3CZSA 4Z7OB 4HV8B 4LARL 1JP5A 4JPIB 1SEQH 5GZOA 3QW9A 1JOIA 1E6JL 5DEGB 1AGEA 5KSUA 1DVFB 2CU9A 3O6KH 4TQEL 1ZT1B 2XWCA 3PG2A 5KSVA 2WB1A 2BP8A 2OSLB 4NP9A 5A40E 1O8FA 4YZAA 2AABH 3AC0A 3AS1A 2ZXQA 1UH4A 4JFEB 4YHMH 5DC4B 3WMPA 3A4EA 3BP4B 3FQUB 4PB9L 2N1KA 4DP4X 4DPAX 1U8CA 4C56D 4FFZA 2M1KA 3VFUB 1G7HB 2JIXB 4MMYA 4UT6L 3ZZQA 1FHNA 3CN4A 3JZ7A 1GS6X 1CTNA 3X3FH 3ENEA 1FAKT 3FS9A 5BO0D 3UTSE 1P1ZA 2C8NA 2DWXA 3AUWB 3F6LA 5HHNB 3P9LA 1UWGH 2XZAL 3O4LE 5DR5H 4GLRH 3AB0B 3ZYIA 1V55B 1ND0A 4PJHE 5DMGD 4NJ9H 1PYWA 5EF2A 2ZKXA 1CI5A 2CIIA 1KIUB 1JWMA 2G3ZA 5GGTH 2QSVA 3VFGL 5H2BA 5D7KE 5GJTH 3UXFA 2BP5M 3AQDA 4XNYH 4HZLB 2FEEL 1C12B 5L8KB 4XODA 3EQOA 2KLSA 3QAQA 4XX1G 4R0LA 4TTDC 3P9MB 5HI5C 3PGDB 4U3XA 3PJLA 5CCGE 2LGNA 4E42A 4DW2H 2E9IA 5EUOA 2VZTA 3OAZK 5BS0A 1ORQA 4LVNC 4XXWC 1PEWA 2E27H 5KYWA 3FTGB 2BLFA 2NX5D 3S37X 3CC5B 5CZVL 5I6XB 2B14A 4OJ5A 3PWVB 4XNQB 4Y5VB 1NCTA 3MQIA 4M43H 3IFLH 4X0KA 2UX6A 5HJ3A 3SO3B 2JKNA 1MCIA 5M95B 3LNHA 5JXEC 5MHSE 1QJVA 4DZ8B 4PJ5E 3SKJL 1IC7L 3ZK0A 4OZIE 3IVKA 2QDVA 2IWEA 3OC5A 4UIKH 2QQNL 2RFXA 5D1ZC 1OE3A 1KELL 1KCVL 1JHTA 1IT9H 1NUFA 1E4KA 3CFTA 4BCYA 3QYNA 4XI5C 1W80A 3CX2A 1XZWA 4BXVA 4PMEA 1BFOA 4EN3D 5T3XD 2W0KA 1WJ3A 1NCCL 3IAGC 4GAAA 5T5FA 3BSGA 1GHFH 1QFUH 4DGVH 5CR1A 4UV4H 2ERJC 2W60A 2XY1A 4X6FB 3V6ZA 2WHVA 3IDYC 2P26A 4HWNA 3SKNA 2VZ3A 4X5QA 1T1WB 2ZAHA 2GPZA 4OFKA 3K71B 2WXIA 4ONHA 2EXYC 2CO3A 1A3RH 2OMUB 5T33H 2ZSVB 4AOFA 1ZT7B 3Q1SL 5ANME 2ZSWB 3ROOA 3D09A 4XMPL 4L1DA 5A1AA 4N5ED 1IGFL 3CVIL 1QYGL 2XDHA 2Z8WC 2EABA 4PJBB 4LIQL 4Y2DD 3WUWG 2O61B 3FAXA 2W07B 4TUJA 5FOBA 1I3UA 3L1OH 4Z77B 2C9RA 2HPTA 2Z92A 4L0YA 3NCYS 4J3BA 3GRHA 4AQ1A 4QRUB 2FECL 5FO7B 3H7LA 1GC1C 2DWYA 4YR6B 4PCKA 1BMGA 5C0BD 5LQBL 1S7QA 4U4BA 3UTSD 3QFGA 3FTXA 4XWOD 5DDHA 2G5UA 4ZO6A 4BKLB 1UWEH 1QG3A 1V3KA 4LIQE 4DN3L 2JFCA 3GKZA 2EH7H 2WYHA 3RKPA 3B9KA 3FO9B 5GRJH 2GFBB 3DOSB 5TDNA 3UG4A 4BJLA 4DK6A 1F3DJ 3L54A 1MKFA 2BDNH 1E90A 3QCUL 4BDVB 4F57L 2MKWA 1HF2A 5D2LA 4JVPA 1OK0A 4Y4HB 4Y1AD 3DBXB 3DPDA 5AD0A 5G2NA 1HHGB 1WAAA 4NUGL 2G30A 1DLFH 2MPAH 4Y4KA 5KG9B 4OCXH 2Y2WA 1DCEA 2YAQA 3O8XB 3V5KB 3SYJA 5CNHA 5D55A 3MBED 5DGRA 2JNZA 1SF3A 2XWZA 1UXMA 4XMZA 1QQDA 4UYPA 3ZDZF 4QKTA 3ARBA 3HCVB 1UD6A 4LSVH 3WNOA 1J87A 4NSKA 3VMWA 5SWZA 3SPIA 4K3HA 5C70A 2BNRA 3ABLB 1VBLA 3G5ZB 2ITEA 3LHPL 2QVFB 3KLSA 3WDHA 2XIIA 3ARRA 3C09C 5AKRA 4FFYL 5CHNB 5BZWA 3RVVD 2R69A 3TO2A 2VKWA 5JMCB 2F5AL 5HHXL 5AWNL 3SDDC 5BRZB 4WSJA 5E24E 4TSBH 3OZ9H 1HESA 3OQ3B 4M6ML 4XAWL 4AY0A 2DQUH 5LXGL 2TSAA 1DFBH 5BZXA 1DVTA 4I9WD 4OGXH 4P2QA 1UTDA 6PCYA 4H8WC 5EC1A 2NY3C 2DLTA 1MCPL 4G8GA 4Y5YB 2HTKC 2WXJA 1QKZH 1W0WA 3WTUA 3RIAF 4RZKA 1A4CA 3JWNE 5HGBB 3QR0A 1SLVA 2XSKA 3H0TA 4HGMA 2X9WA 1CGSL 1DDTA 1HI6B 4PRPB 3BZEB 3RP1A 4FYSA 2V7HA 2BMKB 5IQ9B 2K8MA 1H8LA 5J1SC 5CEZE 5FUCC 4DN4L 3UP1A 2JB5H 3U7WH 3C5ZC 1RP8A 3GHEL 4MNQB 3OL2A 2AJVH 5IKCA 3KYKL 2W9EL 1NWPA 2A0LD 3CZKA 4NQEB 2XT1B 3PQYB 3ZKMC 2PECA 2HT2D 3FF8A 3MRFB 2VMDA 4RDQG 3VQ1C 2YD8A 3LEXA 3QQDB 1NCDH 3NZHH 3I02A 1S7WA 1G0XA 3C08L 4XVUD 1OM3H 1JPGA 2BZDA 2F15A 2J8UA 4TVPH 4WEBH 3BN9D 4X9BA 2AEQH 1KYOJ 3DHPA 5D5MF 5E1AA 3QS3A 3V52H 1BOYA 1O8LA 5GGSB 1EJ8A 1A6TA 5DEFA 1O8KA 1IILE 4G42A 3T0XA 3EOAA 4KMQA 1FH5L 1ILSA 5D7LE 3RWHA 2VWEE 3WS6C 1TEFA 2OMYB 3L9EA 3FQ1A 2VR5A 2NNRA 2ZWLT 4K8RL 5I6KA 3ILDA 1CB4A 4PJ9D 3QUZB 1OAYL 3C6LB 4LBEA 3P4MA 3I75B 3PE9A 2NTPA 4UBDC 3VD0A 2FHCA 1P9MA 2XN9B 1J0KA 1E8WA 1OT2A 4MHHI 3ARDA 1J10A 1NFDB 4H2AA 4LHUB 4UUJB 5I0ZA 5F0JB 4CU8A 4ONOA 2AJUH 3EF7A 2UY7A 3S96B 3QZLA 2NW2B 4OFIA 4P4RB 5LO7A 5IEHB 4PI0A 3R0MA 1H6FA 1B2YA 4RISH 1N9PA 4L4VD 4M48L 2DMBA 3CIAA 4QPEA 1MHHA 2DYPA 4N85A 2R23A 1OGSA 2WLKA 3VXUD 4G80B 1U21A 2Y2TA 1FH5H 3P69A 3N9GL 3PNWA 1FYHB 3MRQB 1LO3L 3BWUC 4MX7A 5C6TH 3G6AB 4JE0A 3SE9L 4ADJA 5EO0B 1NSNH 2AERT 4CBZA 1AO7B 2E59A 5ERWA 1N10A 2NY2B 4JDVB 3SY0B 3C2AH 3N06B 5L9DL 2AANA 2P8LB 1F00I 4J3VA 3W11C 2HX7A 5CBEB 1MJ8H 4JS7A 3T0WA 1WBZA 2DQMA 4LLWB 1IFGA 1Q1JL 1SEBA 4UCFA 4TOYH 1PLUA 1YYLL 2X2UA 1M6UA 4GY4A 3ULVC 3FU3A 4N87A 5DMGC 2EICA 1R0AL 5EDSA 1O7VA 3INUH 5C1MB 4OLXH 5F7YC 1HEZA 1T66C 4F9PC 4IRJD 2MHAB 4LDLB 5BW7A 4RWHA 3D2TA 1XFPA 2L7UA 3HBQA 4TN9A 8PAZA 3H2WA 4ORGA 2VDQB 3D39B 2D4DA 1FLTX 2JWYA 4MMXC 4QTHB 4HUKB 4UZGA 1I9EA 4NZFA 4ZMYA 1OAXH 3EH2A 1E50A 1K2DB 2DQHL 4OIFA 5T1LA 1CMOA 1OIOA 2A9NH 2LVCA 3Q1SH 1ZDQA 5F1SA 5FHBL 3GMNA 1QEWB 4TM9A 3IPFA 5DTFB 4FQCH 1S9YA 1ZVSB 4GKNB 4LXFA 1JZ7A 4O5LL 5E2VL 5HXMA 5CIPH 2I9TB 2QPUA 3TBCA 1EJ6A 2DQEH 4GBXC 4WI2A 3ULUE 4JRYE 5HGHA 3CMOH 2YD1A 3V4PA 1P7QD 1XGQB 1TVBA 2CR3A 3VXMA 3D0AA 3HI6L 5HYQA 1AD0B 2IBZX 3HZMB 3MV8D 4N0CD 4L3ED 5F96H 2HTKD 3BP5A 3STLB 2YLHA 2YA2A 4HJGA 1TZHA 1HCZA 4FC3E 1Q0YL 2OS7A 3BSZH 2G4EA 1H3TA 4UU9B 2ED9A 6TAAA 4Z76B 3MJ8A 1WA2X 1CDBA 2X4PB 4XP4L 3N91A 3EO9L 3AROA 2V5RA 1T7YA 2NUPB 5EU4A 1A1MB 2IANB 5I8CA 3AWFA 4G6KL 3H42L 3SY2A 1OGAA 2L7QA 1VGKA 4IBYA 4JRYB 3SDDB 3UC0H 4S1QH 3VM5A 4FLHA 4F8LA 4HIHB 3SDXB 1A3RL 1EXUA 1PZ2A 2AJ3A 1KEGH 3MSPA 2C1PB 5CJQL 4RSYA 4Z3TA 2WQ8A 1LP9F 1QHQA 5AW4B 3TOPA 3KNBB 1NDTA 1PU0A 4NRXB 3A67H 4BRVA 1RIVL 5I17B 5FCUH 2QSCL 5JTWA 4WI9A 2VBMA 3L2MA 3ET9F 4G9FA 2O5YH 3M45A 4K7PY 4V1DE 1WWBX 1IZJA 4V2BA 3FULA 1WCBA 2V9TA 5KSBF 4R5VA 1LK2A 3BQUA 1BZEA 1UQSB 2QSQA 1F18A 1PW3A 3L81A 2O5YL 5DWUL 1XG2A 2CDGA 5I74B 3T71A 1BV8A 1IKNA 5AQ0A 1CLVA 1YNLL 2XZCH 2YXVA 4JM0A 4Z3EA 3TVMA 3BXNA 3T6XA 4R7LA 3ZPDA 4MBRA 4YS4A 5C0JB 3DOHA 2OR8A 1MWAL 4JKWA 3NA9H 1F8TH 4OKVA 3QQ3A 3DHUA 4KTYA 4DP9X 4XPTL 1D9KA 3UO1L 1ZK5A 3NCXA 4XVSH 4GMSH 5D7IB 5HYSA 2ESVE 4Q4EA 3WLBA 4F93B 1KYOK 4F1SA 4FYQA 5IVXA 4JLRA 4PR5B 5FWRA 2Y7QB 25C8L 2PWHA 3NRFA 1U3ZA 2VXUH 4DGUA 3SYQA 3BSHA 4PUBL 4NP4H 3MXVH 5FA3B 1W72L 1J88A 1A6AB 2HKHL 1WWCA 1IL1A 3QQ4B 4HS8L 2E4FA 4NC0B 4NCDA 1T2QH 1EHKB 4D3CH 1QRBA 3DOIA 5D4IA 3L1FA 3MJ9A 4LZKA 2DTMH 4KMTH 1OCRB 2BXYA 1KGCD 3KPRD 4RCAA 1TFHA 5IOKA 2AJZB 4E41E 4FZEL 5IB5B 1LEIA 3AREA 4HISA 2ITDA 1HOEA 4GQZA 3AK5A 4MRCA 5C09B 1G6RL 3C2SA 3NB2A 2W9EH 3MPCA 1GR7A 3WKQA 4N90D 4QRSA 1LLWA 3D25A 1NIBA 2P49B 1AHKA 1EZVY 3DGGB 2CG9X 3PHSA 1TJHL 4QY8A 2VC2L 1JGVH 3S5LA 4U31A 3P4OB 1NCIA 3C09B 2X89A 3DHMA 3Q01A 1RERA 5GXBB 3D0LA 3HB3D 5F0MB 3WFCH 8CGTA 5D2NE 3TN0B 1SY6H 3HVNA 5D1ZA 3WIIH 3NJXA 1X9LA 1UUNA 3T65A 1GCYA 2XLLA 3BH7B 5KAQG 5FYLL 2V6HA 4ZAKA 3LVTA 1GZQB 5KYYA 1G9NH 4UQDA 4EXKA 3QZNA 4H8PA 1MAJA 5JOEA 5DJ8B 1E5ZA 1EV2E 3P3SA 5EO1B 3T2PA 2DKSA 4CN1A 1SM3H 4J2QA 3I50H 2FT6A 4WFFD 2VW7A 1OAKH 5C1EA 1V3JA 4I87A 1FNGB 3ABZA 4G8IA 2OJEB 5HY9B 4ZOEA 2ATPA 4XNXL 5TTRA 3WMQA 3VFTA 3LIZA 3Q05A 1JZEA 4NN5B 3QZPA 2BNRD 4LP4A 2EYRB 1LQSR 2GIYA 4X6CE 2LHAA 3CAFA 2AVGA 2KZ1B 4JY6A 2GSMB 1ACXA 2H2SC 4QRPE 1ETB1 1RXLA 1JDAA 1JHKL 1AHWC 1AGEB 4EIZC 3TV8A 4EUPA 1SQMA 2BRRL 4L4JA 2JVUA 1VHPA 5F6HI 2ZYIA 4H13C 4UB0H 3TT1L 4F3FA 2A6IA 4MA8L 4JDTH 5JQHC 1HE7A 3MRMA 4NQQA 3VGEA 1XEUA 5TDPB 3BP4A 3FQUA 3CSYA 4X7FC 5LDSA 1QA9B 3NGBC 1P6AB 4KXCA 2WXKA 3QO1B 1U8KA 1F4XH 3X12B 1G7PA 1DTUA 2DLFL 3L4VA 4NAJA 2X6BA 1ZWIA 2XPYA 3QK0A 4TQEH 4IKIA 5C8JB 3HE6A 1PMYA 4LCCA 4F8OA 3SPHA 2GITB 4MZIA 4KJYB 4QHLB 4Y1TA 4I5BB 5KTEH 3VFNA 1DJWA 4ATWA 1AGBA 1NHCA 5C08D 5AW9B 3CSPA 4DKDC 2CO1A 2XX1A 2Z31B 2VERA 2C9SA 2O5ZH 5DFVD 1OGMX 2NYKA 3KPLB 1KIUA 1E8ZA 3LHAA 1BIIB 4QRRA 1I31A 4QXTA 4A2FA 5HPMA 4Z7NE 4GAJH 3MRLB 3TBVB 4XXDB 4YSCA 2QADC 2ZOKA 2BW4A 4KKNA 4YPJA 3RWCA 4NLHA 2H2SD 4WK2B 2JI1A 1CTMA 5JUEH 3DNKA 3MRDA 3PGDA 2R2HB 4YAQB 4L8CB 4JPVL 4WUKH 1LMKA 2Y1YA 4E5XA 5IMMB 1ORQB 2VDMB 4M8RA 1EDHA 3IETA 3WEAA 4NAMA 3FCTA 3CXFA 3FO1A 4B9IA 3NH7H 4TOYL 4KOCA 5HJ3B 1BQLL 3E9TA 4PWHA 1BXAA 1RIHL 2X38A 4OLWH 4PY8I 1IJNA 3PHQA 3WWGA 1GYCA 3IVKB 1T22B 3ZSTA 1NIFA 3VWJB 1TJIH 4JO4H 4ZUTA 5J9PA 3N40F 2O5ZL 3RUGE 2PP7A 5MENB 4W9KC 5KYNA 3O4LB 5E99L 5IMOB 1XH3A 1WITA 2ESVA 2ZXWB 3ZIYA 2KC0A 4UB0L 4D0BA 4RFNB 2EINB 3NTCL 1NMBH 5TJWK 1F90L 2VAJA 4FFVD 1JGEA 5FDYA 3EYUH 3E8UH 3L1EA 4ALAL 4D9QD 4ZXBC 4OQTL 3SDAA 3DRQA 3K6DA 4P2RA 2BHYA 3BSZA 3GZKA 3BVUA 3KVPA 4LEOB 1EHLL 5L2KE 4K3GA 3C75A 3GJFB 1LYQA 4JKNA 1RZGA 3DMMC 4X98B 4GJTB 3K71A 1S7UB 4ZMTA 4Q2ZA 3STZA 1Z9OA 3C5ZA 2R15A 2JLLA 3D2UD 4L37B 4HS3A 3K6NA 3QRBA 2O61A 4W9FC 3RBGA 2VSDA 4JFPA 4CDGC 5DMJB 2A38A 2VSKB 2XX0A 1EGJA 4ZFZB 3W9EB 4CA4A 5DJXA 3WNNA 4C83A 3QEHA 1AE6H 2D9CA 4KPHL 5T1JA 3B5HA 3ZDYF 5EEZA 4GI8A 3HG4A 4HEMA 4U7KA 2VXQA 1IKOP 4YHNA 2QKIA 1ZLUH 2ZUTA 1PZ5A 5ECGA 4AL8C 2OZ4H 1XSOA 1EX0A 1OT4A 4AV0A 2GY5A 3RX9A 3KVQA 1BVLA 5AKVA 3HNVL 4P4KD 4Q9RH 4HIXH 1HCYA 1HQRB 3FOMA 4OLWL 2NY1C 2H32H 5MERA 4PJ8B 2OL3A 4I4WB 4TQHA 4NBYB 1J18A 1QNIA 2DWTA 3HHMA 3MRJB 3QUYB 3GBML 2YWZA 4UQBA 1W8EA 2YC1B 1TKWB 4ZODA 5LGHL 1QBAA 4QTIH 4Y19A 4JRXE 4MA7H 3ILPB 1VFMA 4YSDA 1VERA 2VDRH 4W9EC 4WUUE 4XVJL 3UJIL 4DJMA 1JNJA 1VCBC 1FH2A 5BRPA 2V2XA 4MA7L 3WNLA 5AL0A 1MFEL 1GVIA 2Z93B 2YEVB 5C7XL 5BNXD 2ZOOA 2NT1A 4BKTC 3MV11 4RGMB 4U4IA 2R27A 2KPWA 5KOMC 4E41D 5GZOD 5IHHA 4FULA 1ZHLA 2YBRA 1JMXA 3BESR 4G11A 3UBXI 4TTGA 1NCWH 1MFCL 3C87A 5AVSB 3KLHD 3RUGF 2WBWB 3U9WA 1FE8H 5E9DE 5IQ7H 3S35L 1LHZA 3L7FB 2H5UA 3IFOB 3W39B 2GUOB 4LCWE 1JF5A 1W72H 1RZJH 4O02B 4BA8A 3MXVL 3CSTA 1WDAA 4IU3A 3U6XA 4NXKA 4YLBA 2WQRA 5EUOF 3OKEB 3U0TB 4G8GB 1BYOA 2PXYC 5FYJH 3OKNB 1IBDA 2AQNA 4N3UA 4PWEA 2NY3B 5E1QA 3ZKXC 4BRJA 2NZMA 1FO0H 4JGNA 1CE6A 3PPSA 5D6CB 4MCMA 2IDCA 2W0LA 3BZ4A 3AS2A 3B5GA 4L3EB 4W9CC 5CUSL 4C57C 4B96A 2HKFH 3QORC 2GABA 1J5OL 3EQNA 4HP5A 1IVTA 2VXSL 4NB7A 3VA2C 1FAIH 4GBXD 4XC1L 4AIEA 3W9DA 1RQ5A 3LKQB 3PWJA 4OJPA 2NNAA 2HG5B 2VIRA 3MVSA 1R3KB 4PW9A 3RNKA 1DBKL 4OV5B 1MCPH 2JJTC 1Q1JH 3T8VA 1IAOB 3HZ3A 1E9OA 2Z65C 3TCXA 4LAJH 3FT4A 1K8IB 3OXRA 2D31A 1YN7A 3L7EB 3MCG1 1VPOH 1V10A 5JQIB 3S8FB 5JDJA 3ARFC 2VSCA 2BSED 3MBEB 2XNAA 4G9DA 4H20H 4ODBD 3RWGA 4JFFB 3EGDA 3IJ7A 2NCEA 1DQML 5I0VA 3K5RA 4Y4FD 2WNWA 3SDAD 5L4JA 2G5BA 1DE4B 1JPGB 3IGAB 4R8WL 1WBYA 2XBTA 1PGRB 1TEGA 1W16A 2V2WB 1L9QA 3BQUD 4NX0A 2HYMA 1Q94B 2R59A 3BKYL 3R8QA 4KUCF 1OCWL 3D0VB 3SSGA 5IG7A 5EZOH 3CTTA 4LNVA 3EAKA 4LSQH 4OLUL 5LGKA 2GTQA 2UZXA 5E6SB 1YJDH 2QV4A 3MFGB 1QWHA 4JY5L 1HSAB 4OD1H 3T3PE 4XH2A 5E2JA 2Z1KA 3CV5A 1A4JA 1MFBH 1A7NL 4KROB 3BKCL 2V9UA 3V5DB 4LSPL 1ZPUA 3QQ9D 2NXYD 2VQ1A 3FHEA 3V0DA 2GVYA 2NUTA 2AJYH 3FQ4A 2YWYA 5E4OA 3SYAA 3QR1A 4LPWA 1ZA3B 4L8SA 1KPVA 3ULUD 4OLYH 1H5BC 5T5FH 1JGDB 2ADIA 3KLAA 1FJ1B 2DL2A 2VLJA 4KHXH 2E76C 4LL9A 2AABL 4PCTA 1JZ5A 3LS5H 2ZCZA 4PRIB 2W65B 1G7MB 4AJWA 1ZHKB 1D5MB 3JT2A 2GUYA 4LBAA 3LKNA 4GRWF 3DIFB 4AYFB 2CNZA 2M8XA 3DX3A 3PWUA 3M7FB 1JVKA 4MD0A 3VJ6A 5F9WC 1KYAA 4JK0D 3VRJA 1XV8A 1EJOH 3RIKA 3RWFB 1P7HL 1UWEL 3KM2A 3PNWB 1J0JA 1AZBA 5T1KA 1I8AA 5T1DL 4DKEH 2DWDB 2GIMA 2RALA 4IS6B 2A73B 5LWYL 3TFKD 4XOTA 1TYUA 2WSKA 4F5CA 3LKPB 2JJTA 1T0NB 3O6MH 4P9HH 1J5CA 3MI6A 5IVXF 1G7LA 4GQQA 5HYJB 1ZTXL 3M8OL 1M57B 1GAFL 2XG5A 3CLEH 4LLYB 4P48A 3BVVA 3GSWA 2K6YA 3VXSB 1DQKA 3OZLA 1MRFL 1IDKA 5GSVA 1C5DA 2KZWA 5MP6H 2EKSA 1MH5B 4P9ML 3X13B 1BXXA 1I8KA 3MROB 4OCLC 4GSXA 4P23A 5F7AA 2XWJA 3KHOA 1MW3A 5DHVH 4N1HB 1AS8A 4KZEL 2V9RA 1JZDC 4DPRA 3GSQB 4TUOB 4O02L 1TJXA 4S1DC 3FUEA 3VFGH 1QFWI 5AW2B 5FYKE 2R1XA 3GGWB 1E30A 3AJ7A 3HE7C 1A65A 2NXZB 3EZ8A 2IADB 4KKAC 3RIAK 4YXHL 2IJ0C 2A0LC 1HK6A 1K5CA 1EEYB 3CPUA 2D7PA 2W0FA 4UNTA 2LU5A 3W0WD 2YQ3A 4HFWB 2CNYA 4ZTOL 5I2IA 4TULL 1XGRB 5AOKA 2YJLA 5EMYA 1H19A 1AJ7L 4FQIL 4URRA 2Y07H 1TZAA 3NAAH 4TNGA 4UT9H 1LD9A 1U3YA 3OJVC 4ZUWA 3EJYC 3ZN6A 4BXSV 1RULL 1I9JL 3SGKC 2F53D 3DWTA 4NZUH 3NTCH 2B59B 3GJFK 2IEPA 4GO9A 3ZGHA 4H1LA 2GTZB 4U1MB 3UERA 3VYNA 3L3HB 4LSVL 3ARSA 3UACA 4WEBL 3DJTA 1ZV2A 5EU4B 3RZWA 4RNRB 3MGTA 1NCGA 3PAVA 4OY9A 1BVZA 1RUQH 1M42A 3VFOB 4MLIA 3LD8C 3QZWA 5BRZD 3BPCA 2FBJH 3BWSA 4ES8A 3GI8H 5T3ZE 4UBDD 1JGVL 1PZCA 4KMLB 2D3JA 1DSYA 1KGWA 2O6EA 1SOQA 3V0AC 5C0RH 1HT6A 2ICWJ 3ULUL 3JWDH 1KWGA 4X7SL 1ZS8A 2ZWZA 5F3BA 1C7SA 3H42H 3V9EA 1G7JA 4Y4FA 2QKIC 1OQXA 1T0MA 3EFOA 1CDJA 1NTDA 2R2CA 4KJQD 4MA3A 5AG8A 3SODB 2VLRE 1EFXB 3BIAX 1IEAB 2XIBA 3NABL 5FGRA 1J5HA 1INDL 3HMWL 1XCTA 3CFEA 4HK0A 4RESB 2ALAA 4Y16C 3WJLC 1TYXA 1V7NL 2WBJD 5EFIB 1SYVB 5EU7C 1FDLL 4QNPE 2DWSA 2X4QA 1ADWA 8FABA 3U1SH 3JBG7 1Z5LB 4KQ0A 5EU6E 3JTTA 4TVPE 3ZU8A 1UACL 4OD2A 4POYA 5F93C 2VYRE 3VFWA 3FB6A 5C9JB 2NYYC 3QQ3B 2VZUA 3GKWH 3MCKB 4GMSL 4U1KB 3P30L 2XOTA 2NY4B 3OB0H 3DTXA 3ULUC 1HINL 2ITFA 4CILA 3U1QA 3WLBB 1M05A 2CGYA 3D6GA 1DQQB 3KDPB 4P5RA 1PY9A 1U3JA 5CZKA 1MW2A 2XTJE 5GGVH 2BWQA 3K72B 2XTJC 4PJXB 1I9JH 2FHBA 3IKCA 3ZYZA 1E65A 2VDNL 2YLKA 3QFJD 1HAWA 5BUPA 2BIHA 3MMEA 4ZW3A 3U7YH 1UB5B 5FW8A 2BW5A 1K8DA 3CFCL 2YAMA 1XF4A 4U1IA 3ELQA 3SDCC 1E6OL 1AXTH 4OFYA 4AEIH 4U49A 4OJLA 4WHYH 1V5JA 4Y5XB 3HG1A 4QHMB 4HCRL 4NNPL 3GT6A 2BNUA 1HHJB 4NQCD 1H3GA 1BIHA 4XZUA 5KUKA 3GF8A 3I6LE 4XCCH 4NQVA 1QAWA 3D85D 3ZTNL 4Z7OF 3RWEA 4XE0A 2X10A 4HUVA 2N0MA 3TESA 1FFPB 5T3XL 4DKFL 2EDNA 4JHAH 2Q76B 1DDHB 4LESA 4AEHH 1VADB 1TJMA 3QI9D 3MODL 3UZQB 1N0XL 2EYTB 4WW2A 5E00B 2ZJSL 1OOWA 1FQ9C 1RZKL 5HHQA 5D1QA 1D5BB 3N1FC 2EUWA 1HWGB 2X6VA 2N3JA 4GAGH 1TSPA 1I8LC 1VIWA 3ISWA 1AKJB 3VXPB 5FYJD 4WWPA 4ZQKB 1SVCP 4R4NC 1KN2H 3PCYA 4NM8L 4OW6A 1ASPA 3TBTB 1DO6A 4JFWA 5KYYB 3CD4A 3IMSA 2J7LA 3LYRA 1S6NA 5DJ8A 1LWJA 2VW4A 1IEBB 3LRGA 4NNYB 1I9RH 4UOJA 3BFWA 2OP4H 3FFCD 5BV7H 2ICWB 1UURA 3J8F7 1OXYA 4FQCL 2CGRL 4JPIA 2EE0A 1A7OH 3QFJE 1OCOB 3BEWB 2WMPB 4HHAB 3TWYA 5BV7L 1AIRA 3GHEH 4NO5A 4PJEE 2DAVA 4XPFL 2ADFL 2FT7A 4OM0L 3GRGA 3LN4A 5I1GH 2DWEA 5I19H 2DQ6A 5FA4A 5L88L 3PV6B 3ESNA 4XWOC 4HGWA 1OAUH 3ZDZE 4P5KB 1R5WB 3LS4L 3CVHB 1S78C 4G7QB 4KRMB 5D7LA 3IMWA 3TJEH 2EDQA 3MRMB 1FCCA 3O11A 3QUYD 4KUCD 1TCMA 3HG3A 5F44A 3ZQXA 3IXAB 2Y24A 1B6DA 1QLEH 1O6TA 4LSPH 2DN7A 3ABGA 1I1CA 4FYTA 1U8KB 3P9LB 4HU2A 1XL6A 4BH7A 5A16A 3MRKB 3ZVVA 5C8JA 4XT1C 3U30B 3FB8B 1XF2B 3VGHA 3QDJD 4KH3A 4PCYA 4KJYA 1I8UA 3IJHA 3EO1A 5LGYA 1RJZA 1UM4H 3SPVA 3QHZL 2W81C 2VRQA 3VGGA 4NIKB 3SJVD 1KCUH 4BHUI 4LSRL 1PZAA 4K3JH 1TENA 3KPSA 3ZMRA 4EZJA 5C0GB 5IZ7A 4H1LH 1H9VA 3N9GH 5BRQA 5CJ5A 4GQ9H 4GT7A 1BX2A 1CLWA 5KVEH 1CN4A 1JYXA 5DZ9A 3BT0A 2V2TB 1MHCB 2ADYA 2CLVB 2Q87A 4XBEL 3ZHDA 1A14H 4AK2A 1L7TH 1XF5A 5E5RB 3V6OC 3K4DA 1GIGH 4WV1C 2XKUA 5DHMC 2E7BA 3LVEA 4X0KB 2YJQA 5D9SA 3QNYA 2X40A 3BWZA 4NYLA 4R97B 1UOVA 1SLXA 3SOBH 4S2SA 2ZT9C 3TTYA 1FA4A 2WBJC 4FL4C 4KJWC 4PJ9A 1EEZB 1JHTB 2MNWA 2QEJA 3IE9A 4GOSA 4XNMA 1YPZE 1RU9L 2ED7A 3LH8A 4ZUTB 3MTRA 1C16B 1CZ8H 4XI5D 1H3PL 3W3BA 1DABA 4GW5A 3NQKA 3X1BA 2L7JA 4YSOA 2V3FA 5D71H 1NL0H 2GT9A 3ES6B 2JQAA 5DR5L 2EDRA 5FCSH 4ABQA 4OJDH 1M3JA 5IWLC 2H4EA 3CFQA 5F88A 1E4XI 2A77L 1IM9B 3ETSA 5DHYB 4NQED 4ZRGA 5DD0L 3LCYA 3V4UH 5E1IA 3TO4D 5ICZB 2CDFA 3CPLB 1X5ZA 1ZT7A 4XO3A 4MNQD 2BIPA 5I76B 4LHUG 4Z8FH 1HH6A 1DL7L 1MJ7L 4L4TE 4TNVF 3FB5B 1PG7L 3NIGF 3WG7B 3MU3A 5AVUB 2LT9A 2CK2A 3JWOC 1PKQA 4HSAC 4YFLF 1WWAX 3BSZL 5IVXE 1KTCA 1ADQH 1TYEB 4HFUH 4Z77A 4B9KC 5ISZB 5E95B 3IJEA 5CCJA 2A74C 2XQYG 4WY7H 1IGYB 4UDTA 5TF0A 2YPKA 4HDIA 4ELME 3KGTA 3UW0A 1SEQL 3D07A 4S1DD 1LO5A 5GS2D 3LXCA 4AEHL 5HVWA 4NZRL 3VWJC 3IDNA 5B3NA 4IBVA 3MLVH 4V2CB 3EJUA 1AQKH 5I0WA 1ACCA 3ZXAC 4CNIB 1ECYA 4HEPG 4XAKD 4L5FL 2FL5B 2QKIB 1S9KC 3GMLA 3IMBA 1W91A 2BRRH 1TYWA 2VXTL 3HFMH 4LHUD 4KX8A 4RRPM 4K7PH 3II3A 3DV6B 4PGDB 1IBGL 4M6AA 3Q3GA 5J13B 3FOMB 4YN3A 5JLZB 3QUZD 2OZNA 5I6NA 3MJ7A 5F89A 5CIPB 4K94L 1JTAA 1OP3K 1EGJH 4Y19B 1C5BH 2R83A 4M6OH 1ROCA 2ZKHH 1REIA 1A9EB 4WKZA 4KKRA 3Q5YA 4F8PA 1X0CA 4HD9A 3I9IA 3ARBB 1YG9A 3DVFA 4LCIL 2RQ8A 4NQUA 1U58B 4U0QB 4NSKB 4U2ZA 5SX5K 2Z93A 5DXWA 1KACB 2VRKA 1WZ1H 4LT7A 5HJDA 5DRNB 2H1PH 2BNRB 4GEJA 4ONFL 4AW4A 3T4YA 1B4JL 5J57B 4QYOA 5KVDE 4G7SB 35C8H 3JV4B 3P4NB 5BQ7A 3D9AH 5IJDC 4LVOB 1ZHLB 1OK8A 3I6LD 1KG0B 4ZMAT 1J8RA 4BUQA 3VXNA 5KZCD 1ANUA 3T08A 3EJPA 3CFUA 1NAKL 3FMGL 5JHLL 4FQJH 3FQRA 3Q6GH 3FSVA 4N6RA 2H6PB 3D4CA 3IRCA 1Y1UA 3F65A 5KVGL 4PJFA 4ZMQA 1K8FA 5DD6A 1WFIA 4K23H 3H55A 5C0BB 3QQXA 5F1IB 2ZXBA 4NUJA 3P0YH 1P4BL 2ZD0A 1UGKA 5MEOA 4M7KH 1NCJA 4BFRA 1XF3B 4S0HA 3E3QC 3IN2A 4PVNA 3GINA 3MREB 3G5YB 1PLAA 1WGVA 2J21A 3EJJX 3IGFA 5BZDB 2HJKB 1LWHA 1UADC 2F68X 3HFML 4MNQA 5IKCB 3MAWA 3LIZL 4LHQB 1E6JH 4I1RA 4BZ1A 4GKSA 5GISH 5L2KB 1JTOA 3ARTA 5F3FA 3WN6A 1EAOA 4R96A 1FZJA 4NQEA 5CN1A 2G3XA 1LEKA 2FLMA 4TUKH 5FX3A 1HH9A 4OVUA 2Y22A 3IFPB 2OJZH 3RNKB 2J5LB 4Y9CA 2EZ0C 1MREL 4K15A 5HVFB 5H37G 1CDIA 4LKCA 5HHME 1NCBH 5KS9B 2R1WB 3AU0A 2IQAB 3OXRB 4ZBJA 4DOHB 1RI8A 2J8UB 2OL3H 4X4ME 2DICA 3GLDA 4MSWB 2E9JA 5G4NA 4WI0B 4PV8B 1R4XA 3CFDB 1N12A 5EH1A 3HW7A 1IGJB 2F8OA 3MLYH 4XC3H 1E4KC 4MXQC 1II4E 1FNEB 1ZANH 2NNFA 1UFGA 2Y5EA 2DY2A 4PN6A 4KK8C 3RTQA 2JKLA 2H1LM 4F7MA 5C2UB 2F54B 2EAEA 2CQVA 3AXHA 2VL5B 4YBQD 1CT8B 2H26B 2ZOUA 5CZRA 2FEJA 4Y1AB 1MZYA 1QRNE 1YEDA 4BKSC 5CINL 5BJTA 3H53A 4U1NA 2NY7L 3KYOA 3FHAA 2WLYA 3KDMB 3UFIA 5F9DC 2KZKA 2NXZD 3IFNH 1G6RA 3POHA 4NQDD 2UY7B 5HVHB 3OR7A 3UZEA 3R4RA 5FDWB 3JVGC 1N26A 2N59A 1X5IA 2YK1H 4YHIB 2ADIB 2NSMA 2QPFA 2VH5H 4DEUA 5EC2A 2WO4A 3MV8A 4X4XA 4DUVA 4I9WE 2DPKA 2ZNXA 1F4XL 2QDWA 4P46D 1W72A 4JO1H 3DIFA 5KYXB 4Y9BA 2UZYB 3FT3A 1L3WA 1XH0A 5AENA 5D2LF 2XWBA 4EI5D 4HLZG 5DHDA 3EBIA 1S5HB 2ZF8A 2FSEA 4WCYL 3W82A 4JDVA 2EIZA 4MQXD 1DJGA 2F1AA 5EIIB 3C8KA 3WHE1 5ES4B 4NFCA 5C08E 5HYJD 5I16B 3TBYB 2YPVL 2EDOA 4FLQA 3UROR 4AVHA 5KJRL 2PYFB 1EHLH 5I15H 3SDDD 5J89A 1M6OA 1U2YA 1N6QH 5L8LB 1JXFA 5D72H 5EEXA 4HJEA 1ZGLM 2W95A 5E8NA 1NANH 2AEPH 3ECQA 2R29L 3B34A 4MB1A 4PJEA 3DI3B 5FLVA 1OALA 3VQ2C 1BZ9A 2EUVA 4FLSA 4EN3C 1FFOA 1KTLA 4DKEL 1GOHA 4ZYKB 4KKZA 2B39A 3X13A 5A2AA 1FNFA 3OHXC 2ZUUA 4JFZL 2JELH 4FQHB 5FUCE 1EQWA 2QY1A 2NW3B 5BMFH 2JKSA 3RDTC 4HMCA 2XTWA 4PTTA 4GSDL 4OCRH 2EDMA 1WFNA 1XIWA 4W4OC 2EH8L 3BPLB 3RWDB 3UDWC 5KSAB 1X7QB 1RURL 1A6ZB 3DX7A 4QTFA 3B8YA 2GI0A 3BUBA 1WD8A 4WO0A 3JTSA 3TZVA 2W0FB 4GO8A 3LV3B 4PRBB 3FQXA 3PSSA 1U8JB 4K8RC 4YBHA 1RU9H 4HFWA 4J3XA 1AZRA 3LZRA 1CL7I 5E2TH 1T03H 4HJGB 1W0VB 4GG8A 5GGRA 3X11B 4ETQA 2E5EA 1AANA 4LNRB 2ARWA 1MF2L 2XPGA 1OKEA 4PWGA 2CM5A 4Z76A 3FFDB 5D7IE 1CU4L 5HYJE 4J23A 1GRWA 1GY1A 5DU7A 5H94A 5DZVA 1CVSC 3B2VH 1UM5H 3FQWB 2D7MA 3GSNA 3QYCA 3WS3A 5B39A 1R0AH 2AI0L 4OZ4B 3OLDA 4FN0A 4P3WA 5I66A 5JHMA 4JREC 1WK0A 4NKDA 1GTNA 2EP6A 2XRAH 3KL5A 1KB5A 2KKQA 1HYRC 4XC1H 5E9DA 1OP3H 4YHPA 4NQCA 5BVJA 3CDZB 4PBWD 2WVVB 4PJ9C 3DJRA 3L4WA 2Z8RA 2X3BA 3HHRB 1CFNA 2FATL 4OZGA 1M2VA 3S3SA 4APQB 3MRBB 2ICEB 1QBBA 4HJ1A 3ZOAA 2LV4A 4ZW7A 5JLVC 2BVPB 5ENWA 5L2KD 5KN5B 3LKOB 4NZDA 1S3KH 3BISA 3GS7A 5ALBL 3V0FA 1J1OL 5DS1A 1AYRA 4AENB 3EHBC 5FV1L 1LM8V 4JRAC 5HGAA 1BOGA 4O2CB 1T0MB 4KXAA 3A67L 2PO6B 4A6YA 3BAEL 3QYMA 2QPDB 3RPIB 4QXUH 1OPOA 3BEVB 4GBX