1O8EA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 1mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8eA00
4YEJA 3GQ8A 4MXNA 1QJVA 3SUCA 2INVA 1O8EA 3JURA 4XR6A 1O8GA 1WMRA 2PYGA 4XONA 2X6XA 1GQ8A 4XKVA 3VSVA 1K5CA 1CZFA 1OGOX 2UVEA 1IDJA 2QX3A 2VJJA 1EE6A 1PE9A 2BSPA 3ZSCA 1DBGA 4NK8A 2VJIA 4YZAA 2X3HA 4OJ6A 2NTBA 4OZZA 4I84A 3LMWA 1O8KA 4XLAA 4XOTA 4OJPA 3VMVA 4OJ5A 5C1EA 1X0CA 1PLUA 1KCCA 4XORA 3GQ9A 2ODLA 4XN0A 1AIRA 1VBLA 3B4NA 4U49A 4MR0A 2O17A 4Z05A 4XN3A 3UW0A 1NHCA 2Z8GA 2PECA 1RU4A 1O8FA 4C2LA 4YELA 4XMYA 1OGMX 4XL9A 4URRA 2INUA 1IA5A 1O8LA 2QY1A 3B90A 1PXZA 1H80A 1OOCA 2UVFA 4OZYA 1DBOA 2VBMA 1BN8A 2NSTA 1IB4A 2VBEA 3ZPPA 4XLEA 1KCDA 3KRGA 4W8RA 3EQNA 2O1DA 4U4BA 4YZQA 3VSUA 4Z06A 4XLCA 4YZ0A 3WWGA 1RWRA 3VMWA 2X6WA 4W8QA 5C1CA 2NT9A 4XM3A 4XLHA 2IQ7A 2VBKA 2NT6A 3EQOA 4W8TA 2X85A 2O0WA 1O8IA 2O0VA 3GQ7A 4YZXA 4XLFA 5AMVA 1QCXA 4XKWA 4PMHA 1HG8A 2NSPA 1XG2A 4NK6A 2O04A 2X6YA 2EWEA 3GQAA 3VSTA 4EW9A 1O8DA 3GRHA 1KTWA 3FY3A 2NTQA 4HWVA 4W8SA 1OFMA 4Z03A 4XNFA 1O8MA 3T9GA 4XOPA 4AVZA 3B8YA 2PYHA 1OFLA 4OJOA 2NZMA 1O8HA 2NTPA 2QXZA 4XQFA 1IDKA 1JTAA 4OJLA 1O88A 1RMGA 1JRGA 1O8JA 1BHEA
chains in the Genus database with same CATH superfamily
3BH7B 5JMCB 4YEJA 3GQ8A 4MXNA 1QJVA 1DABA 3SUCA 2INVA 2XTWA 1O8EA 2O6WA 3JURA 4XR6A 1O8GA 1WMRA 2PYGA 4XONA 2X6XA 2VFNA 2B0RA 2YUHA 1GQ8A 1KQ5A 2BM5A 4XKVA 3VSVA 1L1IA 1K5CA 1CZFA 1OGOX 2UVEA 2XTYA 1IDJA 2BM4A 2QX3A 2VJJA 1EE6A 1PE9A 2BSPA 3ZSCA 1DBGA 2IOUG 2VJIA 3NB2A 4NK8A 4YZAA 2W7ZA 4YEIA 2X3HA 3AK5A 4OJ6A 2NTBA 2VFMA 4OZZA 4I84A 3LMWA 1O8KA 4XLAA 4XOTA 4OJPA 2VFQA 1TSPA 3VMVA 4OJ5A 5C1EA 1X0CA 1PLUA 1KCCA 4XORA 3NAWA 3GQ9A 2ODLA 2F3LA 4XN0A 3SY2A 1AIRA 3RIQA 1VBLA 3B4NA 4U49A 1QA3A 4MR0A 1TYXA 2O17A 4Z05A 4XN3A 4YC5A 3UW0A 1NHCA 2Z8GA 2PECA 2V5IA 1RU4A 4C2LA 5JLVC 4YELA 4XMYA 3JX8A 1OGMX 3SYJA 4XL9A 1QRBA 1TYVA 4URRA 2INUA 1IA5A 3BH6B 3PETA 3N6ZA 2BM6A 4YFOA 4YCQA 1O8LA 2QY1A 1LLWA 3B90A 1PXZA 3TH0A 1CLWA 2XTXA 5DNSA 2VFPA 1H80A 1OOCA 2UVFA 4OZYA 1DBOA 2VBMA 1QA1A 1BN8A 3SQVA 4OPWA 2NSTA 4YDTA 1LM1A 2VBEA 1IB4A 3ZPPA 4XLEA 1KCDA 3KRGA 4W8RA 3EQNA 2O1DA 4U4BA 4YZQA 3VSUA 2XT4A 4KH3A 4Z06A 3PSZA 4XLCA 4YZ0A 1QRCA 3WWGA 1RWRA 1TYUA 3SZEA 2X6WA 4W8QA 3VMWA 1HF2A 2NT9A 4XLHA 2IQ7A 1OFEA 2NT6A 2QYUA 2VBKA 3DU1X 4XM3A 2BX6A 3EQOA 4W8TA 2X85A 1LLZA 2O0WA 1O8IA 2O0VA 3GQ7A 4YZXA 2VFOA 2J8KA 4XLFA 2G0YA 3P4GA 1TYWA 2BM7A 5AMVA 1QCXA 1K4ZA 4XKWA 4JRAC 4PMHA 1HG8A 1XG2A 2NSPA 1K8FA 3PSSA 4OM9A 4NK6A 1EZGA 4V02C 2O04A 2X6YA 5C1CA 2EWEA 3GQAA 3LJYA 3VSTA 4EW9A 3ML3A 2XT2A 2XC1A 3GRHA 1QA2A 1KTWA 3FY3A 2NTQA 4HWVA 1OFDA 4W8SA 1OFMA 4Z03A 4XNFA 3LYCA 1O8MA 1EA0A 3H09A 3T9GA 4XOPA 2J8IA 4AVZA 1WXRA 3B8YA 2PYHA 1OFLA 4OJOA 2NZMA 1O8HA 2NTPA 1QQ1A 2QXZA 3N90A 2QZAA 4XQFA 1IDKA 1JTAA 1RMGA 4OJLA 1JRGA 1O88A 1O8FA 1O8DA 1O8JA 1BHEA
chains in the Genus database with same CATH topology
4YEJA 3GQ8A 4MXNA 1QJVA 3SUCA 2INVA 1O8EA 3JURA 4XR6A 1O8GA 1WMRA 2PYGA 4XONA 2X6XA 1GQ8A 4XKVA 3VSVA 1K5CA 1CZFA 1OGOX 2UVEA 1IDJA 2QX3A 2VJJA 1EE6A 1PE9A 2BSPA 3ZSCA 1DBGA 4NK8A 2VJIA 4YZAA 2X3HA 4OJ6A 2NTBA 4OZZA 4I84A 3LMWA 1O8KA 4XLAA 4XOTA 4OJPA 3VMVA 4OJ5A 5C1EA 1X0CA 1PLUA 1KCCA 4XORA 3GQ9A 2ODLA 4XN0A 1AIRA 1VBLA 3B4NA 4U49A 4MR0A 2O17A 4Z05A 4XN3A 3UW0A 1NHCA 2Z8GA 2PECA 1RU4A 1O8FA 4C2LA 4YELA 4XMYA 1OGMX 4XL9A 4URRA 2INUA 1IA5A 1O8LA 2QY1A 3B90A 1PXZA 1H80A 1OOCA 2UVFA 4OZYA 1DBOA 2VBMA 1BN8A 2NSTA 1IB4A 2VBEA 3ZPPA 4XLEA 1KCDA 3KRGA 4W8RA 3EQNA 2O1DA 4U4BA 4YZQA 3VSUA 4Z06A 4XLCA 4YZ0A 3WWGA 1RWRA 3VMWA 2X6WA 4W8QA 5C1CA 2NT9A 4XM3A 4XLHA 2IQ7A 2VBKA 2NT6A 3EQOA 4W8TA 2X85A 2O0WA 1O8IA 2O0VA 3GQ7A 4YZXA 4XLFA 5AMVA 1QCXA 4XKWA 4PMHA 1HG8A 2NSPA 1XG2A 4NK6A 2O04A 2X6YA 2EWEA 3GQAA 3VSTA 4EW9A 1O8DA 3GRHA 1KTWA 3FY3A 2NTQA 4HWVA 4W8SA 1OFMA 4Z03A 4XNFA 1O8MA 3T9GA 4XOPA 4AVZA 3B8YA 2PYHA 1OFLA 4OJOA 2NZMA 1O8HA 2NTPA 2QXZA 4XQFA 1IDKA 1JTAA 4OJLA 1O88A 1RMGA 1JRGA 1O8JA 1BHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEJ A;  3GQ8 A;  4MXN A;  1QJV A;  3SUC A;  2INV A;  1O8E A;  3JUR A;  4XR6 A;  1O8G A;  1WMR A;  2PYG A;  4XON A;  2X6X A;  1GQ8 A;  4XKV A;  3VSV A;  1K5C A;  1CZF A;  1OGO X;  2UVE A;  1IDJ A;  2QX3 A;  2VJJ A;  1EE6 A;  1PE9 A;  2BSP A;  3ZSC A;  1DBG A;  4NK8 A;  2VJI A;  4YZA A;  2X3H A;  4OJ6 A;  2NTB A;  4OZZ A;  4I84 A;  3LMW A;  1O8K A;  4XLA A;  4XOT A;  4OJP A;  3VMV A;  4OJ5 A;  5C1E A;  1X0C A;  1PLU A;  1KCC A;  4XOR A;  3GQ9 A;  2ODL A;  4XN0 A;  1AIR A;  1VBL A;  3B4N A;  4U49 A;  4MR0 A;  2O17 A;  4Z05 A;  4XN3 A;  3UW0 A;  1NHC A;  2Z8G A;  2PEC A;  1RU4 A;  1O8F A;  4C2L A;  4YEL A;  4XMY A;  1OGM X;  4XL9 A;  4URR A;  2INU A;  1IA5 A;  1O8L A;  2QY1 A;  3B90 A;  1PXZ A;  1H80 A;  1OOC A;  2UVF A;  4OZY A;  1DBO A;  2VBM A;  1BN8 A;  2NST A;  1IB4 A;  2VBE A;  3ZPP A;  4XLE A;  1KCD A;  3KRG A;  4W8R A;  3EQN A;  2O1D A;  4U4B A;  4YZQ A;  3VSU A;  4Z06 A;  4XLC A;  4YZ0 A;  3WWG A;  1RWR A;  3VMW A;  2X6W A;  4W8Q A;  5C1C A;  2NT9 A;  4XM3 A;  4XLH A;  2IQ7 A;  2VBK A;  2NT6 A;  3EQO A;  4W8T A;  2X85 A;  2O0W A;  1O8I A;  2O0V A;  3GQ7 A;  4YZX A;  4XLF A;  5AMV A;  1QCX A;  4XKW A;  4PMH A;  1HG8 A;  2NSP A;  1XG2 A;  4NK6 A;  2O04 A;  2X6Y A;  2EWE A;  3GQA A;  3VST A;  4EW9 A;  1O8D A;  3GRH A;  1KTW A;  3FY3 A;  2NTQ A;  4HWV A;  4W8S A;  1OFM A;  4Z03 A;  4XNF A;  1O8M A;  3T9G A;  4XOP A;  4AVZ A;  3B8Y A;  2PYH A;  1OFL A;  4OJO A;  2NZM A;  1O8H A;  2NTP A;  2QXZ A;  4XQF A;  1IDK A;  1JTA A;  4OJL A;  1O88 A;  1RMG A;  1JRG A;  1O8J A;  1BHE A; 
#chains in the Genus database with same CATH topology
 3BH7 B;  5JMC B;  4YEJ A;  3GQ8 A;  4MXN A;  1QJV A;  1DAB A;  3SUC A;  2INV A;  2XTW A;  1O8E A;  2O6W A;  3JUR A;  4XR6 A;  1O8G A;  1WMR A;  2PYG A;  4XON A;  2X6X A;  2VFN A;  2B0R A;  2YUH A;  1GQ8 A;  1KQ5 A;  2BM5 A;  4XKV A;  3VSV A;  1L1I A;  1K5C A;  1CZF A;  1OGO X;  2UVE A;  2XTY A;  1IDJ A;  2BM4 A;  2QX3 A;  2VJJ A;  1EE6 A;  1PE9 A;  2BSP A;  3ZSC A;  1DBG A;  2IOU G;  2VJI A;  3NB2 A;  4NK8 A;  4YZA A;  2W7Z A;  4YEI A;  2X3H A;  3AK5 A;  4OJ6 A;  2NTB A;  2VFM A;  4OZZ A;  4I84 A;  3LMW A;  1O8K A;  4XLA A;  4XOT A;  4OJP A;  2VFQ A;  1TSP A;  3VMV A;  4OJ5 A;  5C1E A;  1X0C A;  1PLU A;  1KCC A;  4XOR A;  3NAW A;  3GQ9 A;  2ODL A;  2F3L A;  4XN0 A;  3SY2 A;  1AIR A;  3RIQ A;  1VBL A;  3B4N A;  4U49 A;  1QA3 A;  4MR0 A;  1TYX A;  2O17 A;  4Z05 A;  4XN3 A;  4YC5 A;  3UW0 A;  1NHC A;  2Z8G A;  2PEC A;  2V5I A;  1RU4 A;  4C2L A;  5JLV C;  4YEL A;  4XMY A;  3JX8 A;  1OGM X;  3SYJ A;  4XL9 A;  1QRB A;  1TYV A;  4URR A;  2INU A;  1IA5 A;  3BH6 B;  3PET A;  3N6Z A;  2BM6 A;  4YFO A;  4YCQ A;  1O8L A;  2QY1 A;  1LLW A;  3B90 A;  1PXZ A;  3TH0 A;  1CLW A;  2XTX A;  5DNS A;  2VFP A;  1H80 A;  1OOC A;  2UVF A;  4OZY A;  1DBO A;  2VBM A;  1QA1 A;  1BN8 A;  3SQV A;  4OPW A;  2NST A;  4YDT A;  1LM1 A;  2VBE A;  1IB4 A;  3ZPP A;  4XLE A;  1KCD A;  3KRG A;  4W8R A;  3EQN A;  2O1D A;  4U4B A;  4YZQ A;  3VSU A;  2XT4 A;  4KH3 A;  4Z06 A;  3PSZ A;  4XLC A;  4YZ0 A;  1QRC A;  3WWG A;  1RWR A;  1TYU A;  3SZE A;  2X6W A;  4W8Q A;  3VMW A;  1HF2 A;  2NT9 A;  4XLH A;  2IQ7 A;  1OFE A;  2NT6 A;  2QYU A;  2VBK A;  3DU1 X;  4XM3 A;  2BX6 A;  3EQO A;  4W8T A;  2X85 A;  1LLZ A;  2O0W A;  1O8I A;  2O0V A;  3GQ7 A;  4YZX A;  2VFO A;  2J8K A;  4XLF A;  2G0Y A;  3P4G A;  1TYW A;  2BM7 A;  5AMV A;  1QCX A;  1K4Z A;  4XKW A;  4JRA C;  4PMH A;  1HG8 A;  1XG2 A;  2NSP A;  1K8F A;  3PSS A;  4OM9 A;  4NK6 A;  1EZG A;  4V02 C;  2O04 A;  2X6Y A;  5C1C A;  2EWE A;  3GQA A;  3LJY A;  3VST A;  4EW9 A;  3ML3 A;  2XT2 A;  2XC1 A;  3GRH A;  1QA2 A;  1KTW A;  3FY3 A;  2NTQ A;  4HWV A;  1OFD A;  4W8S A;  1OFM A;  4Z03 A;  4XNF A;  3LYC A;  1O8M A;  1EA0 A;  3H09 A;  3T9G A;  4XOP A;  2J8I A;  4AVZ A;  1WXR A;  3B8Y A;  2PYH A;  1OFL A;  4OJO A;  2NZM A;  1O8H A;  2NTP A;  1QQ1 A;  2QXZ A;  3N90 A;  2QZA A;  4XQF A;  1IDK A;  1JTA A;  1RMG A;  4OJL A;  1JRG A;  1O88 A;  1O8F A;  1O8D A;  1O8J A;  1BHE A; 
#chains in the Genus database with same CATH homology
 4YEJ A;  3GQ8 A;  4MXN A;  1QJV A;  3SUC A;  2INV A;  1O8E A;  3JUR A;  4XR6 A;  1O8G A;  1WMR A;  2PYG A;  4XON A;  2X6X A;  1GQ8 A;  4XKV A;  3VSV A;  1K5C A;  1CZF A;  1OGO X;  2UVE A;  1IDJ A;  2QX3 A;  2VJJ A;  1EE6 A;  1PE9 A;  2BSP A;  3ZSC A;  1DBG A;  4NK8 A;  2VJI A;  4YZA A;  2X3H A;  4OJ6 A;  2NTB A;  4OZZ A;  4I84 A;  3LMW A;  1O8K A;  4XLA A;  4XOT A;  4OJP A;  3VMV A;  4OJ5 A;  5C1E A;  1X0C A;  1PLU A;  1KCC A;  4XOR A;  3GQ9 A;  2ODL A;  4XN0 A;  1AIR A;  1VBL A;  3B4N A;  4U49 A;  4MR0 A;  2O17 A;  4Z05 A;  4XN3 A;  3UW0 A;  1NHC A;  2Z8G A;  2PEC A;  1RU4 A;  1O8F A;  4C2L A;  4YEL A;  4XMY A;  1OGM X;  4XL9 A;  4URR A;  2INU A;  1IA5 A;  1O8L A;  2QY1 A;  3B90 A;  1PXZ A;  1H80 A;  1OOC A;  2UVF A;  4OZY A;  1DBO A;  2VBM A;  1BN8 A;  2NST A;  1IB4 A;  2VBE A;  3ZPP A;  4XLE A;  1KCD A;  3KRG A;  4W8R A;  3EQN A;  2O1D A;  4U4B A;  4YZQ A;  3VSU A;  4Z06 A;  4XLC A;  4YZ0 A;  3WWG A;  1RWR A;  3VMW A;  2X6W A;  4W8Q A;  5C1C A;  2NT9 A;  4XM3 A;  4XLH A;  2IQ7 A;  2VBK A;  2NT6 A;  3EQO A;  4W8T A;  2X85 A;  2O0W A;  1O8I A;  2O0V A;  3GQ7 A;  4YZX A;  4XLF A;  5AMV A;  1QCX A;  4XKW A;  4PMH A;  1HG8 A;  2NSP A;  1XG2 A;  4NK6 A;  2O04 A;  2X6Y A;  2EWE A;  3GQA A;  3VST A;  4EW9 A;  1O8D A;  3GRH A;  1KTW A;  3FY3 A;  2NTQ A;  4HWV A;  4W8S A;  1OFM A;  4Z03 A;  4XNF A;  1O8M A;  3T9G A;  4XOP A;  4AVZ A;  3B8Y A;  2PYH A;  1OFL A;  4OJO A;  2NZM A;  1O8H A;  2NTP A;  2QXZ A;  4XQF A;  1IDK A;  1JTA A;  4OJL A;  1O88 A;  1RMG A;  1JRG A;  1O8J A;  1BHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...