1O8EA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 1mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8eA00
4W8TA 2NTPA 1KTWA 2UVFA 4URRA 2EWEA 4NK6A 4XN0A 4YELA 3FY3A 1JTAA 4W8SA 1XG2A 4Z06A 2NSTA 1NHCA 1IA5A 5C1EA 2X6YA 4OJPA 1IDJA 3EQNA 4OJ5A 4W8RA 3VMWA 5C1CA 4XONA 1JRGA 1O8FA 4YZXA 3VMVA 2NTBA 2O17A 4XLFA 3SUCA 4XQFA 4XKVA 5AMVA 4XL9A 4XR6A 4OJOA 1IB4A 4Z03A 2O1DA 2QXZA 1IDKA 3T9GA 3B90A 2IQ7A 3EQOA 3ZSCA 1RWRA 3VSUA 2NSPA 4HWVA 4AVZA 4YZAA 4YZQA 4OZZA 3ZPPA 2NTQA 3WWGA 4MR0A 1GQ8A 1K5CA 1O8MA 2ODLA 1O8DA 2X85A 2UVEA 2QX3A 1PXZA 2INVA 4XORA 3VSTA 1DBGA 4YZ0A 1AIRA 4NK8A 4C2LA 2X6XA 4OJ6A 1H80A 1KCCA 4XOPA 2O0WA 1OFLA 1O8IA 3B8YA 2O0VA 1CZFA 1O8KA 2NZMA 2PYGA 1QJVA 2NT6A 4XOTA 1OFMA 1QCXA 1O8HA 2BSPA 1RMGA 2VBEA 1BHEA 2INUA 4XN3A 1OGMX 4MXNA 4YEJA 4XLCA 2VBKA 1OOCA 3LMWA 2QY1A 4Z05A 1PLUA 1DBOA 3B4NA 2X6WA 1O88A 2X3HA 4EW9A 1RU4A 3GRHA 2VBMA 3GQ7A 4OJLA 3VSVA 4U49A 4PMHA 2NT9A 1PE9A 1KCDA 1BN8A 2VJJA 4XMYA 4XLAA 4XKWA 4U4BA 4XLEA 4XNFA 3JURA 2O04A 1O8GA 4W8QA 3KRGA 1OGOX 2Z8GA 1HG8A 2PYHA 1O8JA 1X0CA 1O8LA 3GQ9A 4I84A 4OZYA 3GQ8A 3UW0A 2VJIA 2PECA 3GQAA 1VBLA 1WMRA 4XM3A 1O8EA 4XLHA 1EE6A
chains in the Genus database with same CATH superfamily
2G0YA 4W8TA 2IOUG 2NTPA 3NAWA 1KTWA 4YCQA 2UVFA 4URRA 2EWEA 2XC1A 3JX8A 4NK6A 4XN0A 4YELA 4V02C 1HF2A 3FY3A 1JTAA 4W8SA 1TYXA 1TSPA 1XG2A 2NSTA 2VFOA 4Z06A 1NHCA 1IA5A 5C1EA 2X6YA 1KQ5A 4OJPA 4YFOA 1IDJA 3ML3A 3NB2A 3EQNA 1QA3A 4OJ5A 4W8RA 3VMWA 3AK5A 5C1CA 4XONA 1JRGA 4YC5A 1O8FA 4YZXA 3LYCA 2NTBA 2O17A 4XLFA 3SUCA 3VMVA 4XKVA 4XQFA 5AMVA 3SYJA 4XL9A 4XR6A 4OJOA 1IB4A 2B0RA 4Z03A 2O1DA 3PSZA 1IDKA 2QXZA 2XTWA 3N6ZA 3T9GA 3B90A 2IQ7A 2BM7A 3BH7B 3EQOA 3ZSCA 1RWRA 2QZAA 2NSPA 4HWVA 3VSUA 4AVZA 4YZAA 4YZQA 4OZZA 2J8KA 3ZPPA 2XT2A 2XTXA 1LLZA 2NTQA 2VFQA 3WWGA 4MR0A 1L1IA 1OFEA 3DU1X 1GQ8A 4YEIA 1K5CA 1O8MA 2ODLA 1O8DA 2X85A 3LJYA 2UVEA 2QX3A 1PXZA 2INVA 4XORA 3VSTA 1OFDA 5DNSA 3P4GA 1DBGA 4YDTA 3SQVA 4YZ0A 2J8IA 1AIRA 4KH3A 4NK8A 4C2LA 2X6XA 4OJ6A 1H80A 3BH6B 3SY2A 2BX6A 1KCCA 5JMCB 4XOPA 2F3LA 1OFLA 2O0WA 1QA2A 1O8IA 3B8YA 2VFNA 2O0VA 1CZFA 1O8KA 3PSSA 2NZMA 2PYGA 1QJVA 1DABA 2NT6A 2O6WA 4XOTA 1OFMA 1QCXA 1O8HA 2BSPA 1RMGA 2VBEA 1BHEA 2INUA 4XN3A 1OGMX 1EE6A 4MXNA 1K4ZA 4YEJA 2QYUA 3RIQA 3SZEA 1QA1A 2BM6A 4XLCA 2VBKA 1OOCA 3TH0A 1QRCA 2QY1A 3LMWA 1WXRA 4OPWA 3PETA 4Z05A 1PLUA 1DBOA 3B4NA 2X6WA 3N90A 1O88A 2W7ZA 2X3HA 4EW9A 1RU4A 3GRHA 2VBMA 3GQ7A 4OJLA 1EZGA 3VSVA 4U49A 4PMHA 2NT9A 2V5IA 1PE9A 1KCDA 1BN8A 1LM1A 1QRBA 2VJJA 4JRAC 4XMYA 2XTYA 4XLAA 4XKWA 4U4BA 2XT4A 4XLEA 3H09A 4XNFA 1EA0A 3JURA 2O04A 1O8GA 1TYWA 4W8QA 4OM9A 3KRGA 1OGOX 2Z8GA 1HG8A 1TYUA 2VFMA 2PYHA 2YUHA 1O8JA 1X0CA 1O8LA 1K8FA 1QQ1A 1TYVA 3GQ9A 4I84A 1LLWA 4OZYA 3GQ8A 2BM5A 3UW0A 2VJIA 5JLVC 2PECA 3GQAA 2BM4A 2VFPA 1VBLA 1WMRA 4XM3A 1O8EA 4XLHA 1CLWA
chains in the Genus database with same CATH topology
4W8TA 2NTPA 1KTWA 2UVFA 4URRA 2EWEA 4NK6A 4XN0A 4YELA 3FY3A 1JTAA 4W8SA 1XG2A 4Z06A 2NSTA 1NHCA 1IA5A 5C1EA 2X6YA 4OJPA 1IDJA 3EQNA 4OJ5A 4W8RA 3VMWA 5C1CA 4XONA 1JRGA 1O8FA 4YZXA 3VMVA 2NTBA 2O17A 4XLFA 3SUCA 4XQFA 4XKVA 5AMVA 4XL9A 4XR6A 4OJOA 1IB4A 4Z03A 2O1DA 2QXZA 1IDKA 3T9GA 3B90A 2IQ7A 3EQOA 3ZSCA 1RWRA 3VSUA 2NSPA 4HWVA 4AVZA 4YZAA 4YZQA 4OZZA 3ZPPA 2NTQA 3WWGA 4MR0A 1GQ8A 1K5CA 1O8MA 2ODLA 1O8DA 2X85A 2UVEA 2QX3A 1PXZA 2INVA 4XORA 3VSTA 1DBGA 4YZ0A 1AIRA 4NK8A 4C2LA 2X6XA 4OJ6A 1H80A 1KCCA 4XOPA 2O0WA 1OFLA 1O8IA 3B8YA 2O0VA 1CZFA 1O8KA 2NZMA 2PYGA 1QJVA 2NT6A 4XOTA 1OFMA 1QCXA 1O8HA 2BSPA 1RMGA 2VBEA 1BHEA 2INUA 4XN3A 1OGMX 4MXNA 4YEJA 4XLCA 2VBKA 1OOCA 3LMWA 2QY1A 4Z05A 1PLUA 1DBOA 3B4NA 2X6WA 1O88A 2X3HA 4EW9A 1RU4A 3GRHA 2VBMA 3GQ7A 4OJLA 3VSVA 4U49A 4PMHA 2NT9A 1PE9A 1KCDA 1BN8A 2VJJA 4XMYA 4XLAA 4XKWA 4U4BA 4XLEA 4XNFA 3JURA 2O04A 1O8GA 4W8QA 3KRGA 1OGOX 2Z8GA 1HG8A 2PYHA 1O8JA 1X0CA 1O8LA 3GQ9A 4I84A 4OZYA 3GQ8A 3UW0A 2VJIA 2PECA 3GQAA 1VBLA 1WMRA 4XM3A 1O8EA 4XLHA 1EE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8T A;  2NTP A;  1KTW A;  2UVF A;  4URR A;  2EWE A;  4NK6 A;  4XN0 A;  4YEL A;  3FY3 A;  1JTA A;  4W8S A;  1XG2 A;  4Z06 A;  2NST A;  1NHC A;  1IA5 A;  5C1E A;  2X6Y A;  4OJP A;  1IDJ A;  3EQN A;  4OJ5 A;  4W8R A;  3VMW A;  5C1C A;  4XON A;  1JRG A;  1O8F A;  4YZX A;  3VMV A;  2NTB A;  2O17 A;  4XLF A;  3SUC A;  4XQF A;  4XKV A;  5AMV A;  4XL9 A;  4XR6 A;  4OJO A;  1IB4 A;  4Z03 A;  2O1D A;  2QXZ A;  1IDK A;  3T9G A;  3B90 A;  2IQ7 A;  3EQO A;  3ZSC A;  1RWR A;  3VSU A;  2NSP A;  4HWV A;  4AVZ A;  4YZA A;  4YZQ A;  4OZZ A;  3ZPP A;  2NTQ A;  3WWG A;  4MR0 A;  1GQ8 A;  1K5C A;  1O8M A;  2ODL A;  1O8D A;  2X85 A;  2UVE A;  2QX3 A;  1PXZ A;  2INV A;  4XOR A;  3VST A;  1DBG A;  4YZ0 A;  1AIR A;  4NK8 A;  4C2L A;  2X6X A;  4OJ6 A;  1H80 A;  1KCC A;  4XOP A;  2O0W A;  1OFL A;  1O8I A;  3B8Y A;  2O0V A;  1CZF A;  1O8K A;  2NZM A;  2PYG A;  1QJV A;  2NT6 A;  4XOT A;  1OFM A;  1QCX A;  1O8H A;  2BSP A;  1RMG A;  2VBE A;  1BHE A;  2INU A;  4XN3 A;  1OGM X;  4MXN A;  4YEJ A;  4XLC A;  2VBK A;  1OOC A;  3LMW A;  2QY1 A;  4Z05 A;  1PLU A;  1DBO A;  3B4N A;  2X6W A;  1O88 A;  2X3H A;  4EW9 A;  1RU4 A;  3GRH A;  2VBM A;  3GQ7 A;  4OJL A;  3VSV A;  4U49 A;  4PMH A;  2NT9 A;  1PE9 A;  1KCD A;  1BN8 A;  2VJJ A;  4XMY A;  4XLA A;  4XKW A;  4U4B A;  4XLE A;  4XNF A;  3JUR A;  2O04 A;  1O8G A;  4W8Q A;  3KRG A;  1OGO X;  2Z8G A;  1HG8 A;  2PYH A;  1O8J A;  1X0C A;  1O8L A;  3GQ9 A;  4I84 A;  4OZY A;  3GQ8 A;  3UW0 A;  2VJI A;  2PEC A;  3GQA A;  1VBL A;  1WMR A;  4XM3 A;  1O8E A;  4XLH A;  1EE6 A; 
#chains in the Genus database with same CATH topology
 2G0Y A;  4W8T A;  2IOU G;  2NTP A;  3NAW A;  1KTW A;  4YCQ A;  2UVF A;  4URR A;  2EWE A;  2XC1 A;  3JX8 A;  4NK6 A;  4XN0 A;  4YEL A;  4V02 C;  1HF2 A;  3FY3 A;  1JTA A;  4W8S A;  1TYX A;  1TSP A;  1XG2 A;  2NST A;  2VFO A;  4Z06 A;  1NHC A;  1IA5 A;  5C1E A;  2X6Y A;  1KQ5 A;  4OJP A;  4YFO A;  1IDJ A;  3ML3 A;  3NB2 A;  3EQN A;  1QA3 A;  4OJ5 A;  4W8R A;  3VMW A;  3AK5 A;  5C1C A;  4XON A;  1JRG A;  4YC5 A;  1O8F A;  4YZX A;  3LYC A;  2NTB A;  2O17 A;  4XLF A;  3SUC A;  3VMV A;  4XKV A;  4XQF A;  5AMV A;  3SYJ A;  4XL9 A;  4XR6 A;  4OJO A;  1IB4 A;  2B0R A;  4Z03 A;  2O1D A;  3PSZ A;  1IDK A;  2QXZ A;  2XTW A;  3N6Z A;  3T9G A;  3B90 A;  2IQ7 A;  2BM7 A;  3BH7 B;  3EQO A;  3ZSC A;  1RWR A;  2QZA A;  2NSP A;  4HWV A;  3VSU A;  4AVZ A;  4YZA A;  4YZQ A;  4OZZ A;  2J8K A;  3ZPP A;  2XT2 A;  2XTX A;  1LLZ A;  2NTQ A;  2VFQ A;  3WWG A;  4MR0 A;  1L1I A;  1OFE A;  3DU1 X;  1GQ8 A;  4YEI A;  1K5C A;  1O8M A;  2ODL A;  1O8D A;  2X85 A;  3LJY A;  2UVE A;  2QX3 A;  1PXZ A;  2INV A;  4XOR A;  3VST A;  1OFD A;  5DNS A;  3P4G A;  1DBG A;  4YDT A;  3SQV A;  4YZ0 A;  2J8I A;  1AIR A;  4KH3 A;  4NK8 A;  4C2L A;  2X6X A;  4OJ6 A;  1H80 A;  3BH6 B;  3SY2 A;  2BX6 A;  1KCC A;  5JMC B;  4XOP A;  2F3L A;  1OFL A;  2O0W A;  1QA2 A;  1O8I A;  3B8Y A;  2VFN A;  2O0V A;  1CZF A;  1O8K A;  3PSS A;  2NZM A;  2PYG A;  1QJV A;  1DAB A;  2NT6 A;  2O6W A;  4XOT A;  1OFM A;  1QCX A;  1O8H A;  2BSP A;  1RMG A;  2VBE A;  1BHE A;  2INU A;  4XN3 A;  1OGM X;  1EE6 A;  4MXN A;  1K4Z A;  4YEJ A;  2QYU A;  3RIQ A;  3SZE A;  1QA1 A;  2BM6 A;  4XLC A;  2VBK A;  1OOC A;  3TH0 A;  1QRC A;  2QY1 A;  3LMW A;  1WXR A;  4OPW A;  3PET A;  4Z05 A;  1PLU A;  1DBO A;  3B4N A;  2X6W A;  3N90 A;  1O88 A;  2W7Z A;  2X3H A;  4EW9 A;  1RU4 A;  3GRH A;  2VBM A;  3GQ7 A;  4OJL A;  1EZG A;  3VSV A;  4U49 A;  4PMH A;  2NT9 A;  2V5I A;  1PE9 A;  1KCD A;  1BN8 A;  1LM1 A;  1QRB A;  2VJJ A;  4JRA C;  4XMY A;  2XTY A;  4XLA A;  4XKW A;  4U4B A;  2XT4 A;  4XLE A;  3H09 A;  4XNF A;  1EA0 A;  3JUR A;  2O04 A;  1O8G A;  1TYW A;  4W8Q A;  4OM9 A;  3KRG A;  1OGO X;  2Z8G A;  1HG8 A;  1TYU A;  2VFM A;  2PYH A;  2YUH A;  1O8J A;  1X0C A;  1O8L A;  1K8F A;  1QQ1 A;  1TYV A;  3GQ9 A;  4I84 A;  1LLW A;  4OZY A;  3GQ8 A;  2BM5 A;  3UW0 A;  2VJI A;  5JLV C;  2PEC A;  3GQA A;  2BM4 A;  2VFP A;  1VBL A;  1WMR A;  4XM3 A;  1O8E A;  4XLH A;  1CLW A; 
#chains in the Genus database with same CATH homology
 4W8T A;  2NTP A;  1KTW A;  2UVF A;  4URR A;  2EWE A;  4NK6 A;  4XN0 A;  4YEL A;  3FY3 A;  1JTA A;  4W8S A;  1XG2 A;  4Z06 A;  2NST A;  1NHC A;  1IA5 A;  5C1E A;  2X6Y A;  4OJP A;  1IDJ A;  3EQN A;  4OJ5 A;  4W8R A;  3VMW A;  5C1C A;  4XON A;  1JRG A;  1O8F A;  4YZX A;  3VMV A;  2NTB A;  2O17 A;  4XLF A;  3SUC A;  4XQF A;  4XKV A;  5AMV A;  4XL9 A;  4XR6 A;  4OJO A;  1IB4 A;  4Z03 A;  2O1D A;  2QXZ A;  1IDK A;  3T9G A;  3B90 A;  2IQ7 A;  3EQO A;  3ZSC A;  1RWR A;  3VSU A;  2NSP A;  4HWV A;  4AVZ A;  4YZA A;  4YZQ A;  4OZZ A;  3ZPP A;  2NTQ A;  3WWG A;  4MR0 A;  1GQ8 A;  1K5C A;  1O8M A;  2ODL A;  1O8D A;  2X85 A;  2UVE A;  2QX3 A;  1PXZ A;  2INV A;  4XOR A;  3VST A;  1DBG A;  4YZ0 A;  1AIR A;  4NK8 A;  4C2L A;  2X6X A;  4OJ6 A;  1H80 A;  1KCC A;  4XOP A;  2O0W A;  1OFL A;  1O8I A;  3B8Y A;  2O0V A;  1CZF A;  1O8K A;  2NZM A;  2PYG A;  1QJV A;  2NT6 A;  4XOT A;  1OFM A;  1QCX A;  1O8H A;  2BSP A;  1RMG A;  2VBE A;  1BHE A;  2INU A;  4XN3 A;  1OGM X;  4MXN A;  4YEJ A;  4XLC A;  2VBK A;  1OOC A;  3LMW A;  2QY1 A;  4Z05 A;  1PLU A;  1DBO A;  3B4N A;  2X6W A;  1O88 A;  2X3H A;  4EW9 A;  1RU4 A;  3GRH A;  2VBM A;  3GQ7 A;  4OJL A;  3VSV A;  4U49 A;  4PMH A;  2NT9 A;  1PE9 A;  1KCD A;  1BN8 A;  2VJJ A;  4XMY A;  4XLA A;  4XKW A;  4U4B A;  4XLE A;  4XNF A;  3JUR A;  2O04 A;  1O8G A;  4W8Q A;  3KRG A;  1OGO X;  2Z8G A;  1HG8 A;  2PYH A;  1O8J A;  1X0C A;  1O8L A;  3GQ9 A;  4I84 A;  4OZY A;  3GQ8 A;  3UW0 A;  2VJI A;  2PEC A;  3GQA A;  1VBL A;  1WMR A;  4XM3 A;  1O8E A;  4XLH A;  1EE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...