1O8EA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 1mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8eA00
4MXNA 4XLFA 2VJJA 4XONA 1OGOX 2X3HA 4AVZA 2O0WA 2BSPA 4OJ6A 2IQ7A 1O8JA 1JRGA 4U49A 5AMVA 3VSUA 4W8RA 1O8MA 2ODLA 4Z03A 2O17A 1BHEA 1O8DA 2O04A 3LMWA 1PE9A 1OFLA 4XORA 3WWGA 1CZFA 4XLEA 4XMYA 4W8TA 3JURA 2EWEA 3GRHA 4OJPA 1KCDA 2NSPA 2VJIA 5C1CA 4URRA 4Z05A 4NK8A 4U4BA 3VMVA 4XKWA 4XQFA 4EW9A 1O88A 2QX3A 3UW0A 3GQ8A 4XOTA 4YZ0A 3KRGA 4OZYA 4YZAA 1O8FA 1JTAA 1RWRA 3B8YA 3SUCA 1RU4A 3VSVA 2PYHA 4HWVA 2X6XA 4OJOA 3ZPPA 4XM3A 2NSTA 2O1DA 4YEJA 1RMGA 2PYGA 4OZZA 4PMHA 1K5CA 4C2LA 4I84A 4Z06A 1O8KA 2NTQA 4XKVA 2NZMA 1KCCA 1HG8A 1X0CA 4XN3A 2NT6A 1O8EA 1DBOA 1GQ8A 2PECA 4XOPA 1WMRA 2X6YA 1KTWA 4NK6A 3GQ7A 1O8LA 3EQOA 4W8SA 1O8HA 1IDJA 2INUA 1O8GA 3GQ9A 2VBEA 3B4NA 2Z8GA 2QY1A 2X85A 3FY3A 4OJ5A 1O8IA 4MR0A 2VBMA 1IA5A 1OGMX 4OJLA 4YELA 4XN0A 1IB4A 1XG2A 4XR6A 3GQAA 2NTPA 3B90A 4XLCA 4XL9A 1DBGA 1QCXA 1OFMA 3T9GA 1H80A 4YZXA 2O0VA 1NHCA 1PXZA 4YZQA 5C1EA 1AIRA 2X6WA 1PLUA 2QXZA 1BN8A 4XLHA 2VBKA 1IDKA 4W8QA 1OOCA 4XLAA 3VSTA 1QJVA 2INVA 2NT9A 3ZSCA 1EE6A 2NTBA 4XNFA 2UVFA 3VMWA 2UVEA 3EQNA 1VBLA
chains in the Genus database with same CATH superfamily
4MXNA 3AK5A 2BX6A 4XLFA 2VJJA 2VFNA 4YC5A 3SQVA 4XONA 1OGOX 1EA0A 2X3HA 4AVZA 3PETA 2O0WA 2BSPA 4OJ6A 2IQ7A 1O8JA 1JRGA 1OFDA 1DABA 1QRBA 2QYUA 4U49A 5AMVA 3VSUA 4W8RA 1O8MA 2ODLA 4Z03A 3SY2A 3JX8A 2O17A 3DU1X 3SYJA 1BHEA 1O8DA 2O04A 3NB2A 2F3LA 1PE9A 1TYWA 2BM7A 1OFLA 3LMWA 1QA1A 3RIQA 4XORA 3WWGA 1CZFA 4XLEA 4OM9A 4XMYA 4W8TA 3JURA 2EWEA 3GRHA 4OJPA 1KCDA 2NSPA 2BM6A 2VJIA 3LJYA 3NAWA 4URRA 4Z05A 5C1CA 1LM1A 4NK8A 4U4BA 3VMVA 2V5IA 2VFPA 4XKWA 4XQFA 4EW9A 1O88A 2QX3A 4YCQA 3GQ8A 4XOTA 3UW0A 4YZ0A 3KRGA 4OZYA 1LLZA 4YZAA 1O8FA 1JTAA 4OPWA 4YFOA 1RWRA 3B8YA 3SUCA 1RU4A 3VSVA 2PYHA 1LLWA 4HWVA 4KH3A 2X6XA 2XTYA 4OJOA 1EZGA 2VFOA 3ZPPA 5JMCB 4XM3A 1QA3A 2NSTA 2O1DA 4JRAC 4YEJA 3TH0A 3SZEA 1RMGA 2PYGA 4OZZA 2J8KA 1TYUA 4PMHA 1K5CA 4C2LA 4I84A 1QRCA 1HF2A 4Z06A 1O8KA 1TYXA 2NTQA 4XKVA 2O6WA 2NZMA 1KCCA 1HG8A 1X0CA 4XN3A 1CLWA 2BM5A 2NT6A 1O8EA 2W7ZA 1DBOA 1GQ8A 2PECA 4XOPA 1WMRA 2X6YA 1KTWA 4NK6A 3GQ7A 1O8LA 3EQOA 4W8SA 1QA2A 1O8HA 3H09A 1IDJA 2INUA 1O8GA 2XT4A 2VBEA 3B4NA 3GQ9A 2Z8GA 3ML3A 2QY1A 2X85A 3FY3A 2QZAA 1WXRA 3N90A 2XC1A 4OJ5A 1O8IA 2VFMA 4MR0A 3P4GA 2VBMA 1IA5A 1OGMX 4OJLA 2BM4A 3BH7B 2XTXA 4YELA 2YUHA 1QQ1A 4XN0A 1XG2A 1IB4A 4XR6A 3GQAA 2XTWA 2NTPA 3B90A 4XLCA 1OFEA 1DBGA 2VFQA 1QCXA 2G0YA 4XL9A 4YDTA 1OFMA 3T9GA 1H80A 4V02C 1KQ5A 1TSPA 4YZXA 2IOUG 2O0VA 1NHCA 1K8FA 1PXZA 4YZQA 1AIRA 5C1EA 1K4ZA 2X6WA 3N6ZA 5JLVC 3PSZA 1PLUA 2J8IA 1BN8A 2QXZA 4XLHA 2VBKA 1IDKA 4W8QA 1OOCA 1TYVA 4XLAA 3VSTA 1QJVA 3BH6B 2INVA 2NT9A 3ZSCA 5DNSA 1L1IA 1EE6A 2NTBA 4XNFA 2UVFA 3PSSA 2B0RA 3LYCA 3VMWA 2UVEA 3EQNA 1VBLA 2XT2A 4YEIA
chains in the Genus database with same CATH topology
4MXNA 4XLFA 2VJJA 4XONA 1OGOX 2X3HA 4AVZA 2O0WA 2BSPA 4OJ6A 2IQ7A 1O8JA 1JRGA 4U49A 5AMVA 3VSUA 4W8RA 1O8MA 2ODLA 4Z03A 2O17A 1BHEA 1O8DA 2O04A 3LMWA 1PE9A 1OFLA 4XORA 3WWGA 1CZFA 4XLEA 4XMYA 4W8TA 3JURA 2EWEA 3GRHA 4OJPA 1KCDA 2NSPA 2VJIA 5C1CA 4URRA 4Z05A 4NK8A 4U4BA 3VMVA 4XKWA 4XQFA 4EW9A 1O88A 2QX3A 3UW0A 3GQ8A 4XOTA 4YZ0A 3KRGA 4OZYA 4YZAA 1O8FA 1JTAA 1RWRA 3B8YA 3SUCA 1RU4A 3VSVA 2PYHA 4HWVA 2X6XA 4OJOA 3ZPPA 4XM3A 2NSTA 2O1DA 4YEJA 1RMGA 2PYGA 4OZZA 4PMHA 1K5CA 4C2LA 4I84A 4Z06A 1O8KA 2NTQA 4XKVA 2NZMA 1KCCA 1HG8A 1X0CA 4XN3A 2NT6A 1O8EA 1DBOA 1GQ8A 2PECA 4XOPA 1WMRA 2X6YA 1KTWA 4NK6A 3GQ7A 1O8LA 3EQOA 4W8SA 1O8HA 1IDJA 2INUA 1O8GA 3GQ9A 2VBEA 3B4NA 2Z8GA 2QY1A 2X85A 3FY3A 4OJ5A 1O8IA 4MR0A 2VBMA 1IA5A 1OGMX 4OJLA 4YELA 4XN0A 1IB4A 1XG2A 4XR6A 3GQAA 2NTPA 3B90A 4XLCA 4XL9A 1DBGA 1QCXA 1OFMA 3T9GA 1H80A 4YZXA 2O0VA 1NHCA 1PXZA 4YZQA 5C1EA 1AIRA 2X6WA 1PLUA 2QXZA 1BN8A 4XLHA 2VBKA 1IDKA 4W8QA 1OOCA 4XLAA 3VSTA 1QJVA 2INVA 2NT9A 3ZSCA 1EE6A 2NTBA 4XNFA 2UVFA 3VMWA 2UVEA 3EQNA 1VBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXN A;  4XLF A;  2VJJ A;  4XON A;  1OGO X;  2X3H A;  4AVZ A;  2O0W A;  2BSP A;  4OJ6 A;  2IQ7 A;  1O8J A;  1JRG A;  4U49 A;  5AMV A;  3VSU A;  4W8R A;  1O8M A;  2ODL A;  4Z03 A;  2O17 A;  1BHE A;  1O8D A;  2O04 A;  3LMW A;  1PE9 A;  1OFL A;  4XOR A;  3WWG A;  1CZF A;  4XLE A;  4XMY A;  4W8T A;  3JUR A;  2EWE A;  3GRH A;  4OJP A;  1KCD A;  2NSP A;  2VJI A;  5C1C A;  4URR A;  4Z05 A;  4NK8 A;  4U4B A;  3VMV A;  4XKW A;  4XQF A;  4EW9 A;  1O88 A;  2QX3 A;  3UW0 A;  3GQ8 A;  4XOT A;  4YZ0 A;  3KRG A;  4OZY A;  4YZA A;  1O8F A;  1JTA A;  1RWR A;  3B8Y A;  3SUC A;  1RU4 A;  3VSV A;  2PYH A;  4HWV A;  2X6X A;  4OJO A;  3ZPP A;  4XM3 A;  2NST A;  2O1D A;  4YEJ A;  1RMG A;  2PYG A;  4OZZ A;  4PMH A;  1K5C A;  4C2L A;  4I84 A;  4Z06 A;  1O8K A;  2NTQ A;  4XKV A;  2NZM A;  1KCC A;  1HG8 A;  1X0C A;  4XN3 A;  2NT6 A;  1O8E A;  1DBO A;  1GQ8 A;  2PEC A;  4XOP A;  1WMR A;  2X6Y A;  1KTW A;  4NK6 A;  3GQ7 A;  1O8L A;  3EQO A;  4W8S A;  1O8H A;  1IDJ A;  2INU A;  1O8G A;  3GQ9 A;  2VBE A;  3B4N A;  2Z8G A;  2QY1 A;  2X85 A;  3FY3 A;  4OJ5 A;  1O8I A;  4MR0 A;  2VBM A;  1IA5 A;  1OGM X;  4OJL A;  4YEL A;  4XN0 A;  1IB4 A;  1XG2 A;  4XR6 A;  3GQA A;  2NTP A;  3B90 A;  4XLC A;  4XL9 A;  1DBG A;  1QCX A;  1OFM A;  3T9G A;  1H80 A;  4YZX A;  2O0V A;  1NHC A;  1PXZ A;  4YZQ A;  5C1E A;  1AIR A;  2X6W A;  1PLU A;  2QXZ A;  1BN8 A;  4XLH A;  2VBK A;  1IDK A;  4W8Q A;  1OOC A;  4XLA A;  3VST A;  1QJV A;  2INV A;  2NT9 A;  3ZSC A;  1EE6 A;  2NTB A;  4XNF A;  2UVF A;  3VMW A;  2UVE A;  3EQN A;  1VBL A; 
#chains in the Genus database with same CATH topology
 4MXN A;  3AK5 A;  2BX6 A;  4XLF A;  2VJJ A;  2VFN A;  4YC5 A;  3SQV A;  4XON A;  1OGO X;  1EA0 A;  2X3H A;  4AVZ A;  3PET A;  2O0W A;  2BSP A;  4OJ6 A;  2IQ7 A;  1O8J A;  1JRG A;  1OFD A;  1DAB A;  1QRB A;  2QYU A;  4U49 A;  5AMV A;  3VSU A;  4W8R A;  1O8M A;  2ODL A;  4Z03 A;  3SY2 A;  3JX8 A;  2O17 A;  3DU1 X;  3SYJ A;  1BHE A;  1O8D A;  2O04 A;  3NB2 A;  2F3L A;  1PE9 A;  1TYW A;  2BM7 A;  1OFL A;  3LMW A;  1QA1 A;  3RIQ A;  4XOR A;  3WWG A;  1CZF A;  4XLE A;  4OM9 A;  4XMY A;  4W8T A;  3JUR A;  2EWE A;  3GRH A;  4OJP A;  1KCD A;  2NSP A;  2BM6 A;  2VJI A;  3LJY A;  3NAW A;  4URR A;  4Z05 A;  5C1C A;  1LM1 A;  4NK8 A;  4U4B A;  3VMV A;  2V5I A;  2VFP A;  4XKW A;  4XQF A;  4EW9 A;  1O88 A;  2QX3 A;  4YCQ A;  3GQ8 A;  4XOT A;  3UW0 A;  4YZ0 A;  3KRG A;  4OZY A;  1LLZ A;  4YZA A;  1O8F A;  1JTA A;  4OPW A;  4YFO A;  1RWR A;  3B8Y A;  3SUC A;  1RU4 A;  3VSV A;  2PYH A;  1LLW A;  4HWV A;  4KH3 A;  2X6X A;  2XTY A;  4OJO A;  1EZG A;  2VFO A;  3ZPP A;  5JMC B;  4XM3 A;  1QA3 A;  2NST A;  2O1D A;  4JRA C;  4YEJ A;  3TH0 A;  3SZE A;  1RMG A;  2PYG A;  4OZZ A;  2J8K A;  1TYU A;  4PMH A;  1K5C A;  4C2L A;  4I84 A;  1QRC A;  1HF2 A;  4Z06 A;  1O8K A;  1TYX A;  2NTQ A;  4XKV A;  2O6W A;  2NZM A;  1KCC A;  1HG8 A;  1X0C A;  4XN3 A;  1CLW A;  2BM5 A;  2NT6 A;  1O8E A;  2W7Z A;  1DBO A;  1GQ8 A;  2PEC A;  4XOP A;  1WMR A;  2X6Y A;  1KTW A;  4NK6 A;  3GQ7 A;  1O8L A;  3EQO A;  4W8S A;  1QA2 A;  1O8H A;  3H09 A;  1IDJ A;  2INU A;  1O8G A;  2XT4 A;  2VBE A;  3B4N A;  3GQ9 A;  2Z8G A;  3ML3 A;  2QY1 A;  2X85 A;  3FY3 A;  2QZA A;  1WXR A;  3N90 A;  2XC1 A;  4OJ5 A;  1O8I A;  2VFM A;  4MR0 A;  3P4G A;  2VBM A;  1IA5 A;  1OGM X;  4OJL A;  2BM4 A;  3BH7 B;  2XTX A;  4YEL A;  2YUH A;  1QQ1 A;  4XN0 A;  1XG2 A;  1IB4 A;  4XR6 A;  3GQA A;  2XTW A;  2NTP A;  3B90 A;  4XLC A;  1OFE A;  1DBG A;  2VFQ A;  1QCX A;  2G0Y A;  4XL9 A;  4YDT A;  1OFM A;  3T9G A;  1H80 A;  4V02 C;  1KQ5 A;  1TSP A;  4YZX A;  2IOU G;  2O0V A;  1NHC A;  1K8F A;  1PXZ A;  4YZQ A;  1AIR A;  5C1E A;  1K4Z A;  2X6W A;  3N6Z A;  5JLV C;  3PSZ A;  1PLU A;  2J8I A;  1BN8 A;  2QXZ A;  4XLH A;  2VBK A;  1IDK A;  4W8Q A;  1OOC A;  1TYV A;  4XLA A;  3VST A;  1QJV A;  3BH6 B;  2INV A;  2NT9 A;  3ZSC A;  5DNS A;  1L1I A;  1EE6 A;  2NTB A;  4XNF A;  2UVF A;  3PSS A;  2B0R A;  3LYC A;  3VMW A;  2UVE A;  3EQN A;  1VBL A;  2XT2 A;  4YEI A; 
#chains in the Genus database with same CATH homology
 4MXN A;  4XLF A;  2VJJ A;  4XON A;  1OGO X;  2X3H A;  4AVZ A;  2O0W A;  2BSP A;  4OJ6 A;  2IQ7 A;  1O8J A;  1JRG A;  4U49 A;  5AMV A;  3VSU A;  4W8R A;  1O8M A;  2ODL A;  4Z03 A;  2O17 A;  1BHE A;  1O8D A;  2O04 A;  3LMW A;  1PE9 A;  1OFL A;  4XOR A;  3WWG A;  1CZF A;  4XLE A;  4XMY A;  4W8T A;  3JUR A;  2EWE A;  3GRH A;  4OJP A;  1KCD A;  2NSP A;  2VJI A;  5C1C A;  4URR A;  4Z05 A;  4NK8 A;  4U4B A;  3VMV A;  4XKW A;  4XQF A;  4EW9 A;  1O88 A;  2QX3 A;  3UW0 A;  3GQ8 A;  4XOT A;  4YZ0 A;  3KRG A;  4OZY A;  4YZA A;  1O8F A;  1JTA A;  1RWR A;  3B8Y A;  3SUC A;  1RU4 A;  3VSV A;  2PYH A;  4HWV A;  2X6X A;  4OJO A;  3ZPP A;  4XM3 A;  2NST A;  2O1D A;  4YEJ A;  1RMG A;  2PYG A;  4OZZ A;  4PMH A;  1K5C A;  4C2L A;  4I84 A;  4Z06 A;  1O8K A;  2NTQ A;  4XKV A;  2NZM A;  1KCC A;  1HG8 A;  1X0C A;  4XN3 A;  2NT6 A;  1O8E A;  1DBO A;  1GQ8 A;  2PEC A;  4XOP A;  1WMR A;  2X6Y A;  1KTW A;  4NK6 A;  3GQ7 A;  1O8L A;  3EQO A;  4W8S A;  1O8H A;  1IDJ A;  2INU A;  1O8G A;  3GQ9 A;  2VBE A;  3B4N A;  2Z8G A;  2QY1 A;  2X85 A;  3FY3 A;  4OJ5 A;  1O8I A;  4MR0 A;  2VBM A;  1IA5 A;  1OGM X;  4OJL A;  4YEL A;  4XN0 A;  1IB4 A;  1XG2 A;  4XR6 A;  3GQA A;  2NTP A;  3B90 A;  4XLC A;  4XL9 A;  1DBG A;  1QCX A;  1OFM A;  3T9G A;  1H80 A;  4YZX A;  2O0V A;  1NHC A;  1PXZ A;  4YZQ A;  5C1E A;  1AIR A;  2X6W A;  1PLU A;  2QXZ A;  1BN8 A;  4XLH A;  2VBK A;  1IDK A;  4W8Q A;  1OOC A;  4XLA A;  3VST A;  1QJV A;  2INV A;  2NT9 A;  3ZSC A;  1EE6 A;  2NTB A;  4XNF A;  2UVF A;  3VMW A;  2UVE A;  3EQN A;  1VBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...