1O8EA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 1mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8eA00
1QJVA 1PXZA 2O0WA 2QXZA 3VSTA 4XLHA 2NT6A 1O8JA 4W8RA 4XR6A 2UVEA 2PECA 4Z05A 5C1EA 2NTQA 4MR0A 2VJJA 1VBLA 3B90A 4XOTA 1BHEA 3ZPPA 2X85A 3LMWA 1O8EA 2O1DA 2BSPA 2O17A 3KRGA 3VSVA 4XLEA 1OGMX 2O0VA 2Z8GA 2VBEA 1X0CA 4XN3A 1IB4A 4W8QA 1PLUA 4Z03A 4OJLA 1BN8A 2INVA 2ODLA 4YZXA 1H80A 2X3HA 4W8TA 1PE9A 4XN0A 1OOCA 4YZ0A 3UW0A 4XORA 3WWGA 4XKVA 4XLCA 3GQ7A 5AMVA 1GQ8A 3VMWA 1K5CA 3ZSCA 2NTPA 2X6XA 4OJ5A 4NK6A 5C1CA 2EWEA 1DBOA 2PYGA 1O88A 4I84A 4XMYA 2NT9A 1WMRA 2O04A 4MXNA 1KTWA 2NTBA 3EQOA 1OGOX 4YELA 1RWRA 3GQAA 2QY1A 4U4BA 1IA5A 2QX3A 2VBKA 1DBGA 1NHCA 1KCDA 1O8FA 4XKWA 4OZZA 3VSUA 4EW9A 4YEJA 4OJPA 1O8MA 4OJ6A 3FY3A 1O8LA 4YZQA 2PYHA 4HWVA 4XNFA 1QCXA 1O8DA 1XG2A 2IQ7A 4W8SA 1AIRA 4XONA 4AVZA 3SUCA 3T9GA 2VBMA 1HG8A 1IDKA 3GRHA 4Z06A 2X6WA 4PMHA 2NSTA 1EE6A 3EQNA 1O8GA 4NK8A 4XOPA 1O8KA 4XM3A 3B4NA 4OZYA 1IDJA 1KCCA 1CZFA 1O8IA 2VJIA 4C2LA 2INUA 3GQ8A 1JTAA 4YZAA 4XQFA 1OFMA 2NZMA 1OFLA 1JRGA 4OJOA 1RMGA 1RU4A 3B8YA 4U49A 2X6YA 3GQ9A 1O8HA 4XLFA 3VMVA 2NSPA 3JURA 4XL9A 4XLAA 4URRA 2UVFA
chains in the Genus database with same CATH superfamily
1QJVA 1PXZA 1TSPA 1L1IA 2BM4A 2O0WA 4XLAA 2QXZA 3BH6B 1HF2A 1QA1A 3VSTA 1K4ZA 2NT6A 4XLHA 1O8JA 4W8RA 4XR6A 2UVEA 2PECA 4Z05A 4YC5A 2NTQA 5C1EA 4MR0A 2VJJA 1VBLA 1OFEA 2VFNA 3B90A 4XOTA 4YCQA 1BHEA 3ZPPA 2QZAA 3H09A 3SY2A 2X85A 2O6WA 1O8EA 1QRCA 2O1DA 2BSPA 2O17A 3DU1X 3KRGA 3LMWA 3VSVA 1K8FA 1QA3A 1KQ5A 4XLEA 1OGMX 2O0VA 2Z8GA 2VBEA 3LJYA 1X0CA 3JX8A 1TYWA 4XN3A 1IB4A 4W8QA 1PLUA 4Z03A 1DABA 4JRAC 4OJLA 5JMCB 1CLWA 4OM9A 3ML3A 1BN8A 2INVA 2ODLA 4YZXA 1H80A 2J8KA 1QQ1A 2X3HA 4W8TA 1PE9A 2XT4A 4XN0A 1OOCA 4YZ0A 3UW0A 4KH3A 4XORA 3WWGA 4YFOA 2BM6A 3NB2A 4XKVA 4XLCA 3GQ7A 5AMVA 1GQ8A 3VMWA 1K5CA 3ZSCA 1OFDA 2NTPA 2X6XA 4OJ5A 4NK6A 5C1CA 2EWEA 1DBOA 2PYGA 1O88A 2YUHA 4I84A 1TYUA 2NT9A 1WMRA 2O04A 2VFQA 4MXNA 2IOUG 1KTWA 4V02C 2NTBA 2VFOA 3EQOA 3PSSA 1OGOX 4YELA 1RWRA 3GQAA 2XTWA 4OPWA 2QY1A 4U4BA 1IA5A 2QX3A 2VBKA 1DBGA 2XT2A 3TH0A 2VFMA 1NHCA 1KCDA 1O8FA 4XKWA 4OZZA 3VSUA 4EW9A 3N90A 4YEJA 4OJPA 1O8MA 1TYXA 2VFPA 4OJ6A 3FY3A 1O8LA 4YZQA 2PYHA 4HWVA 4XNFA 1QCXA 1O8DA 3N6ZA 1XG2A 2IQ7A 4YDTA 1EA0A 4W8SA 1AIRA 4XONA 1QRBA 2F3LA 2J8IA 3P4GA 3PSZA 3RIQA 3SZEA 3LYCA 3SUCA 4AVZA 3T9GA 2VBMA 1HG8A 1IDKA 2XTXA 2V5IA 2XTYA 3GRHA 2X6WA 3NAWA 4Z06A 4YEIA 4PMHA 2NSTA 2QYUA 1EE6A 3EQNA 1O8GA 4NK8A 4XOPA 1O8KA 4XM3A 3B4NA 1LLZA 1IDJA 4OZYA 5DNSA 1KCCA 1CZFA 1O8IA 2VJIA 4C2LA 2INUA 3GQ8A 1JTAA 1LM1A 2BM7A 4YZAA 1LLWA 4XQFA 1OFMA 2NZMA 1OFLA 2XC1A 4OJOA 2BX6A 1RMGA 3AK5A 4XMYA 1WXRA 1RU4A 2G0YA 2B0RA 3B8YA 2X6YA 3GQ9A 4U49A 1QA2A 1O8HA 5JLVC 1TYVA 2W7ZA 3SYJA 2BM5A 4XLFA 3VMVA 2UVFA 2NSPA 3PETA 3JURA 3SQVA 4XL9A 3BH7B 1EZGA 4URRA 1JRGA
chains in the Genus database with same CATH topology
1QJVA 1PXZA 2O0WA 2QXZA 3VSTA 4XLHA 2NT6A 1O8JA 4W8RA 4XR6A 2UVEA 2PECA 4Z05A 5C1EA 2NTQA 4MR0A 2VJJA 1VBLA 3B90A 4XOTA 1BHEA 3ZPPA 2X85A 3LMWA 1O8EA 2O1DA 2BSPA 2O17A 3KRGA 3VSVA 4XLEA 1OGMX 2O0VA 2Z8GA 2VBEA 1X0CA 4XN3A 1IB4A 4W8QA 1PLUA 4Z03A 4OJLA 1BN8A 2INVA 2ODLA 4YZXA 1H80A 2X3HA 4W8TA 1PE9A 4XN0A 1OOCA 4YZ0A 3UW0A 4XORA 3WWGA 4XKVA 4XLCA 3GQ7A 5AMVA 1GQ8A 3VMWA 1K5CA 3ZSCA 2NTPA 2X6XA 4OJ5A 4NK6A 5C1CA 2EWEA 1DBOA 2PYGA 1O88A 4I84A 4XMYA 2NT9A 1WMRA 2O04A 4MXNA 1KTWA 2NTBA 3EQOA 1OGOX 4YELA 1RWRA 3GQAA 2QY1A 4U4BA 1IA5A 2QX3A 2VBKA 1DBGA 1NHCA 1KCDA 1O8FA 4XKWA 4OZZA 3VSUA 4EW9A 4YEJA 4OJPA 1O8MA 4OJ6A 3FY3A 1O8LA 4YZQA 2PYHA 4HWVA 4XNFA 1QCXA 1O8DA 1XG2A 2IQ7A 4W8SA 1AIRA 4XONA 4AVZA 3SUCA 3T9GA 2VBMA 1HG8A 1IDKA 3GRHA 4Z06A 2X6WA 4PMHA 2NSTA 1EE6A 3EQNA 1O8GA 4NK8A 4XOPA 1O8KA 4XM3A 3B4NA 4OZYA 1IDJA 1KCCA 1CZFA 1O8IA 2VJIA 4C2LA 2INUA 3GQ8A 1JTAA 4YZAA 4XQFA 1OFMA 2NZMA 1OFLA 1JRGA 4OJOA 1RMGA 1RU4A 3B8YA 4U49A 2X6YA 3GQ9A 1O8HA 4XLFA 3VMVA 2NSPA 3JURA 4XL9A 4XLAA 4URRA 2UVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJV A;  1PXZ A;  2O0W A;  2QXZ A;  3VST A;  4XLH A;  2NT6 A;  1O8J A;  4W8R A;  4XR6 A;  2UVE A;  2PEC A;  4Z05 A;  5C1E A;  2NTQ A;  4MR0 A;  2VJJ A;  1VBL A;  3B90 A;  4XOT A;  1BHE A;  3ZPP A;  2X85 A;  3LMW A;  1O8E A;  2O1D A;  2BSP A;  2O17 A;  3KRG A;  3VSV A;  4XLE A;  1OGM X;  2O0V A;  2Z8G A;  2VBE A;  1X0C A;  4XN3 A;  1IB4 A;  4W8Q A;  1PLU A;  4Z03 A;  4OJL A;  1BN8 A;  2INV A;  2ODL A;  4YZX A;  1H80 A;  2X3H A;  4W8T A;  1PE9 A;  4XN0 A;  1OOC A;  4YZ0 A;  3UW0 A;  4XOR A;  3WWG A;  4XKV A;  4XLC A;  3GQ7 A;  5AMV A;  1GQ8 A;  3VMW A;  1K5C A;  3ZSC A;  2NTP A;  2X6X A;  4OJ5 A;  4NK6 A;  5C1C A;  2EWE A;  1DBO A;  2PYG A;  1O88 A;  4I84 A;  4XMY A;  2NT9 A;  1WMR A;  2O04 A;  4MXN A;  1KTW A;  2NTB A;  3EQO A;  1OGO X;  4YEL A;  1RWR A;  3GQA A;  2QY1 A;  4U4B A;  1IA5 A;  2QX3 A;  2VBK A;  1DBG A;  1NHC A;  1KCD A;  1O8F A;  4XKW A;  4OZZ A;  3VSU A;  4EW9 A;  4YEJ A;  4OJP A;  1O8M A;  4OJ6 A;  3FY3 A;  1O8L A;  4YZQ A;  2PYH A;  4HWV A;  4XNF A;  1QCX A;  1O8D A;  1XG2 A;  2IQ7 A;  4W8S A;  1AIR A;  4XON A;  4AVZ A;  3SUC A;  3T9G A;  2VBM A;  1HG8 A;  1IDK A;  3GRH A;  4Z06 A;  2X6W A;  4PMH A;  2NST A;  1EE6 A;  3EQN A;  1O8G A;  4NK8 A;  4XOP A;  1O8K A;  4XM3 A;  3B4N A;  4OZY A;  1IDJ A;  1KCC A;  1CZF A;  1O8I A;  2VJI A;  4C2L A;  2INU A;  3GQ8 A;  1JTA A;  4YZA A;  4XQF A;  1OFM A;  2NZM A;  1OFL A;  1JRG A;  4OJO A;  1RMG A;  1RU4 A;  3B8Y A;  4U49 A;  2X6Y A;  3GQ9 A;  1O8H A;  4XLF A;  3VMV A;  2NSP A;  3JUR A;  4XL9 A;  4XLA A;  4URR A;  2UVF A; 
#chains in the Genus database with same CATH topology
 1QJV A;  1PXZ A;  1TSP A;  1L1I A;  2BM4 A;  2O0W A;  4XLA A;  2QXZ A;  3BH6 B;  1HF2 A;  1QA1 A;  3VST A;  1K4Z A;  2NT6 A;  4XLH A;  1O8J A;  4W8R A;  4XR6 A;  2UVE A;  2PEC A;  4Z05 A;  4YC5 A;  2NTQ A;  5C1E A;  4MR0 A;  2VJJ A;  1VBL A;  1OFE A;  2VFN A;  3B90 A;  4XOT A;  4YCQ A;  1BHE A;  3ZPP A;  2QZA A;  3H09 A;  3SY2 A;  2X85 A;  2O6W A;  1O8E A;  1QRC A;  2O1D A;  2BSP A;  2O17 A;  3DU1 X;  3KRG A;  3LMW A;  3VSV A;  1K8F A;  1QA3 A;  1KQ5 A;  4XLE A;  1OGM X;  2O0V A;  2Z8G A;  2VBE A;  3LJY A;  1X0C A;  3JX8 A;  1TYW A;  4XN3 A;  1IB4 A;  4W8Q A;  1PLU A;  4Z03 A;  1DAB A;  4JRA C;  4OJL A;  5JMC B;  1CLW A;  4OM9 A;  3ML3 A;  1BN8 A;  2INV A;  2ODL A;  4YZX A;  1H80 A;  2J8K A;  1QQ1 A;  2X3H A;  4W8T A;  1PE9 A;  2XT4 A;  4XN0 A;  1OOC A;  4YZ0 A;  3UW0 A;  4KH3 A;  4XOR A;  3WWG A;  4YFO A;  2BM6 A;  3NB2 A;  4XKV A;  4XLC A;  3GQ7 A;  5AMV A;  1GQ8 A;  3VMW A;  1K5C A;  3ZSC A;  1OFD A;  2NTP A;  2X6X A;  4OJ5 A;  4NK6 A;  5C1C A;  2EWE A;  1DBO A;  2PYG A;  1O88 A;  2YUH A;  4I84 A;  1TYU A;  2NT9 A;  1WMR A;  2O04 A;  2VFQ A;  4MXN A;  2IOU G;  1KTW A;  4V02 C;  2NTB A;  2VFO A;  3EQO A;  3PSS A;  1OGO X;  4YEL A;  1RWR A;  3GQA A;  2XTW A;  4OPW A;  2QY1 A;  4U4B A;  1IA5 A;  2QX3 A;  2VBK A;  1DBG A;  2XT2 A;  3TH0 A;  2VFM A;  1NHC A;  1KCD A;  1O8F A;  4XKW A;  4OZZ A;  3VSU A;  4EW9 A;  3N90 A;  4YEJ A;  4OJP A;  1O8M A;  1TYX A;  2VFP A;  4OJ6 A;  3FY3 A;  1O8L A;  4YZQ A;  2PYH A;  4HWV A;  4XNF A;  1QCX A;  1O8D A;  3N6Z A;  1XG2 A;  2IQ7 A;  4YDT A;  1EA0 A;  4W8S A;  1AIR A;  4XON A;  1QRB A;  2F3L A;  2J8I A;  3P4G A;  3PSZ A;  3RIQ A;  3SZE A;  3LYC A;  3SUC A;  4AVZ A;  3T9G A;  2VBM A;  1HG8 A;  1IDK A;  2XTX A;  2V5I A;  2XTY A;  3GRH A;  2X6W A;  3NAW A;  4Z06 A;  4YEI A;  4PMH A;  2NST A;  2QYU A;  1EE6 A;  3EQN A;  1O8G A;  4NK8 A;  4XOP A;  1O8K A;  4XM3 A;  3B4N A;  1LLZ A;  1IDJ A;  4OZY A;  5DNS A;  1KCC A;  1CZF A;  1O8I A;  2VJI A;  4C2L A;  2INU A;  3GQ8 A;  1JTA A;  1LM1 A;  2BM7 A;  4YZA A;  1LLW A;  4XQF A;  1OFM A;  2NZM A;  1OFL A;  2XC1 A;  4OJO A;  2BX6 A;  1RMG A;  3AK5 A;  4XMY A;  1WXR A;  1RU4 A;  2G0Y A;  2B0R A;  3B8Y A;  2X6Y A;  3GQ9 A;  4U49 A;  1QA2 A;  1O8H A;  5JLV C;  1TYV A;  2W7Z A;  3SYJ A;  2BM5 A;  4XLF A;  3VMV A;  2UVF A;  2NSP A;  3PET A;  3JUR A;  3SQV A;  4XL9 A;  3BH7 B;  1EZG A;  4URR A;  1JRG A; 
#chains in the Genus database with same CATH homology
 1QJV A;  1PXZ A;  2O0W A;  2QXZ A;  3VST A;  4XLH A;  2NT6 A;  1O8J A;  4W8R A;  4XR6 A;  2UVE A;  2PEC A;  4Z05 A;  5C1E A;  2NTQ A;  4MR0 A;  2VJJ A;  1VBL A;  3B90 A;  4XOT A;  1BHE A;  3ZPP A;  2X85 A;  3LMW A;  1O8E A;  2O1D A;  2BSP A;  2O17 A;  3KRG A;  3VSV A;  4XLE A;  1OGM X;  2O0V A;  2Z8G A;  2VBE A;  1X0C A;  4XN3 A;  1IB4 A;  4W8Q A;  1PLU A;  4Z03 A;  4OJL A;  1BN8 A;  2INV A;  2ODL A;  4YZX A;  1H80 A;  2X3H A;  4W8T A;  1PE9 A;  4XN0 A;  1OOC A;  4YZ0 A;  3UW0 A;  4XOR A;  3WWG A;  4XKV A;  4XLC A;  3GQ7 A;  5AMV A;  1GQ8 A;  3VMW A;  1K5C A;  3ZSC A;  2NTP A;  2X6X A;  4OJ5 A;  4NK6 A;  5C1C A;  2EWE A;  1DBO A;  2PYG A;  1O88 A;  4I84 A;  4XMY A;  2NT9 A;  1WMR A;  2O04 A;  4MXN A;  1KTW A;  2NTB A;  3EQO A;  1OGO X;  4YEL A;  1RWR A;  3GQA A;  2QY1 A;  4U4B A;  1IA5 A;  2QX3 A;  2VBK A;  1DBG A;  1NHC A;  1KCD A;  1O8F A;  4XKW A;  4OZZ A;  3VSU A;  4EW9 A;  4YEJ A;  4OJP A;  1O8M A;  4OJ6 A;  3FY3 A;  1O8L A;  4YZQ A;  2PYH A;  4HWV A;  4XNF A;  1QCX A;  1O8D A;  1XG2 A;  2IQ7 A;  4W8S A;  1AIR A;  4XON A;  4AVZ A;  3SUC A;  3T9G A;  2VBM A;  1HG8 A;  1IDK A;  3GRH A;  4Z06 A;  2X6W A;  4PMH A;  2NST A;  1EE6 A;  3EQN A;  1O8G A;  4NK8 A;  4XOP A;  1O8K A;  4XM3 A;  3B4N A;  4OZY A;  1IDJ A;  1KCC A;  1CZF A;  1O8I A;  2VJI A;  4C2L A;  2INU A;  3GQ8 A;  1JTA A;  4YZA A;  4XQF A;  1OFM A;  2NZM A;  1OFL A;  1JRG A;  4OJO A;  1RMG A;  1RU4 A;  3B8Y A;  4U49 A;  2X6Y A;  3GQ9 A;  1O8H A;  4XLF A;  3VMV A;  2NSP A;  3JUR A;  4XL9 A;  4XLA A;  4URR A;  2UVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...