1O8EA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 1mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8eA00
4I84A 4XLEA 2VBMA 3VMWA 3FY3A 1PE9A 4XKVA 5C1CA 1O8JA 3GQ9A 4XL9A 4OJOA 4YZXA 4C2LA 4YZAA 3EQNA 1JRGA 1OGOX 1O8KA 1QJVA 4MXNA 3WWGA 4EW9A 4XN3A 1PXZA 1QCXA 4MR0A 4W8SA 3B8YA 1XG2A 1RU4A 4XN0A 4Z05A 2UVFA 3GQ7A 4XNFA 3SUCA 4XMYA 4XOPA 4Z03A 2IQ7A 1OGMX 2NZMA 3EQOA 1BHEA 1IDKA 2VJJA 1OFLA 3VSTA 4XORA 1DBGA 4XR6A 4NK6A 5C1EA 4URRA 3ZSCA 2NTPA 2PYGA 1WMRA 2ODLA 3VSUA 3GQ8A 4YEJA 2QXZA 2X6YA 4XLAA 2NTBA 1K5CA 3KRGA 4XONA 1KCDA 2O1DA 2PECA 2X6WA 4YZQA 2NTQA 4XLFA 2QX3A 4OJLA 2VBKA 2O04A 4YZ0A 3UW0A 1DBOA 1H80A 1O8LA 1O8EA 4OZYA 4OJ6A 1PLUA 4XLCA 3JURA 2INUA 4AVZA 2VJIA 1HG8A 1O8HA 4U4BA 4W8RA 2VBEA 4OJ5A 4OJPA 1O8DA 1O8MA 3ZPPA 2EWEA 1IDJA 1NHCA 2X6XA 3GRHA 3LMWA 2NT9A 2O0VA 2X3HA 4PMHA 2O0WA 1KCCA 1GQ8A 4OZZA 2INVA 2UVEA 1X0CA 4XQFA 2NT6A 1O88A 4W8TA 1IB4A 1RMGA 3B4NA 1AIRA 2NSTA 4XM3A 1OOCA 2BSPA 4XOTA 2QY1A 1VBLA 4W8QA 1CZFA 4XKWA 1O8GA 4Z06A 1IA5A 2O17A 4HWVA 4NK8A 5AMVA 1KTWA 2Z8GA 2NSPA 1O8FA 3GQAA 1BN8A 2PYHA 3T9GA 1OFMA 2X85A 1JTAA 1RWRA 4XLHA 3VSVA 4YELA 1EE6A 3VMVA 1O8IA 3B90A 4U49A
chains in the Genus database with same CATH superfamily
4I84A 3SZEA 4XLEA 2BM6A 4V02C 2VBMA 1K8FA 3VMWA 3FY3A 1QRCA 1TYWA 1PE9A 3ML3A 4XKVA 5C1CA 1O8JA 3GQ9A 3AK5A 2BM5A 4XL9A 4OJOA 4YZXA 4C2LA 3PSSA 4YZAA 3EQNA 1JRGA 3NAWA 1OGOX 1TYUA 2IOUG 1O8KA 1QJVA 4MXNA 3WWGA 4EW9A 4OM9A 3JX8A 1DABA 4XN3A 1PXZA 1QCXA 4MR0A 2VFOA 2J8KA 4W8SA 3B8YA 1XG2A 3BH7B 1RU4A 5JMCB 4XN0A 1QRBA 4Z05A 2UVFA 3GQ7A 4OPWA 4XNFA 3BH6B 2VFQA 3SUCA 1OFEA 2XT4A 4XMYA 4XOPA 4Z03A 2IQ7A 1OGMX 2NZMA 3EQOA 1BHEA 1IDKA 1CLWA 2VJJA 3SQVA 1OFLA 3VSTA 4XORA 3NB2A 1DBGA 4XR6A 4NK6A 1TSPA 5C1EA 3P4GA 3RIQA 4URRA 2VFNA 3PETA 2O6WA 2NTPA 3ZSCA 2PYGA 4YC5A 1WMRA 2B0RA 2ODLA 2BM7A 3GQ8A 3VSUA 3PSZA 4YEJA 1KQ5A 2QXZA 2X6YA 4XLAA 2NTBA 1K5CA 3SYJA 3KRGA 4XONA 4YDTA 1KCDA 2O1DA 2PECA 2X6WA 4YZQA 2NTQA 3LJYA 2QX3A 4XLFA 4OJLA 1QA3A 2VBKA 2O04A 4YZ0A 3UW0A 1DBOA 1H80A 1O8LA 1O8EA 4OZYA 4OJ6A 1PLUA 4XLCA 4YFOA 3JURA 2INUA 4AVZA 2VJIA 1HG8A 2V5IA 3N6ZA 1O8HA 4U4BA 4W8RA 2VBEA 2QYUA 4OJ5A 5JLVC 4OJPA 1O8DA 1QA1A 1WXRA 1O8MA 3ZPPA 2F3LA 2VFPA 2EWEA 3H09A 1IDJA 1NHCA 2X6XA 2VFMA 1LLZA 1TYXA 3GRHA 3N90A 2J8IA 2W7ZA 3LMWA 2G0YA 2NT9A 2O0VA 2X3HA 2O0WA 2XC1A 1GQ8A 4PMHA 4YEIA 4OZZA 1KCCA 2INVA 1LM1A 4KH3A 2UVEA 1X0CA 4XQFA 2NT6A 1O88A 4W8TA 1IB4A 1RMGA 3B4NA 1AIRA 2NSTA 1TYVA 4XM3A 1OOCA 2BSPA 4XOTA 3TH0A 2QY1A 2BX6A 1VBLA 4W8QA 1OFDA 1CZFA 1LLWA 3DU1X 1K4ZA 1O8GA 2YUHA 4XKWA 1QA2A 2XTWA 4Z06A 1EZGA 1IA5A 2O17A 4JRAC 4HWVA 4NK8A 5AMVA 1KTWA 2Z8GA 2NSPA 1O8FA 2XTYA 2QZAA 1BN8A 2PYHA 3GQAA 1EA0A 3T9GA 1OFMA 2X85A 3LYCA 3SY2A 2XTXA 1JTAA 1HF2A 1RWRA 4YCQA 1QQ1A 4XLHA 3VSVA 5DNSA 4YELA 1EE6A 2BM4A 3VMVA 1L1IA 2XT2A 1O8IA 3B90A 4U49A
chains in the Genus database with same CATH topology
4I84A 4XLEA 2VBMA 3VMWA 3FY3A 1PE9A 4XKVA 5C1CA 1O8JA 3GQ9A 4XL9A 4OJOA 4YZXA 4C2LA 4YZAA 3EQNA 1JRGA 1OGOX 1O8KA 1QJVA 4MXNA 3WWGA 4EW9A 4XN3A 1PXZA 1QCXA 4MR0A 4W8SA 3B8YA 1XG2A 1RU4A 4XN0A 4Z05A 2UVFA 3GQ7A 4XNFA 3SUCA 4XMYA 4XOPA 4Z03A 2IQ7A 1OGMX 2NZMA 3EQOA 1BHEA 1IDKA 2VJJA 1OFLA 3VSTA 4XORA 1DBGA 4XR6A 4NK6A 5C1EA 4URRA 3ZSCA 2NTPA 2PYGA 1WMRA 2ODLA 3VSUA 3GQ8A 4YEJA 2QXZA 2X6YA 4XLAA 2NTBA 1K5CA 3KRGA 4XONA 1KCDA 2O1DA 2PECA 2X6WA 4YZQA 2NTQA 4XLFA 2QX3A 4OJLA 2VBKA 2O04A 4YZ0A 3UW0A 1DBOA 1H80A 1O8LA 1O8EA 4OZYA 4OJ6A 1PLUA 4XLCA 3JURA 2INUA 4AVZA 2VJIA 1HG8A 1O8HA 4U4BA 4W8RA 2VBEA 4OJ5A 4OJPA 1O8DA 1O8MA 3ZPPA 2EWEA 1IDJA 1NHCA 2X6XA 3GRHA 3LMWA 2NT9A 2O0VA 2X3HA 4PMHA 2O0WA 1KCCA 1GQ8A 4OZZA 2INVA 2UVEA 1X0CA 4XQFA 2NT6A 1O88A 4W8TA 1IB4A 1RMGA 3B4NA 1AIRA 2NSTA 4XM3A 1OOCA 2BSPA 4XOTA 2QY1A 1VBLA 4W8QA 1CZFA 4XKWA 1O8GA 4Z06A 1IA5A 2O17A 4HWVA 4NK8A 5AMVA 1KTWA 2Z8GA 2NSPA 1O8FA 3GQAA 1BN8A 2PYHA 3T9GA 1OFMA 2X85A 1JTAA 1RWRA 4XLHA 3VSVA 4YELA 1EE6A 3VMVA 1O8IA 3B90A 4U49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I84 A;  4XLE A;  2VBM A;  3VMW A;  3FY3 A;  1PE9 A;  4XKV A;  5C1C A;  1O8J A;  3GQ9 A;  4XL9 A;  4OJO A;  4YZX A;  4C2L A;  4YZA A;  3EQN A;  1JRG A;  1OGO X;  1O8K A;  1QJV A;  4MXN A;  3WWG A;  4EW9 A;  4XN3 A;  1PXZ A;  1QCX A;  4MR0 A;  4W8S A;  3B8Y A;  1XG2 A;  1RU4 A;  4XN0 A;  4Z05 A;  2UVF A;  3GQ7 A;  4XNF A;  3SUC A;  4XMY A;  4XOP A;  4Z03 A;  2IQ7 A;  1OGM X;  2NZM A;  3EQO A;  1BHE A;  1IDK A;  2VJJ A;  1OFL A;  3VST A;  4XOR A;  1DBG A;  4XR6 A;  4NK6 A;  5C1E A;  4URR A;  3ZSC A;  2NTP A;  2PYG A;  1WMR A;  2ODL A;  3VSU A;  3GQ8 A;  4YEJ A;  2QXZ A;  2X6Y A;  4XLA A;  2NTB A;  1K5C A;  3KRG A;  4XON A;  1KCD A;  2O1D A;  2PEC A;  2X6W A;  4YZQ A;  2NTQ A;  4XLF A;  2QX3 A;  4OJL A;  2VBK A;  2O04 A;  4YZ0 A;  3UW0 A;  1DBO A;  1H80 A;  1O8L A;  1O8E A;  4OZY A;  4OJ6 A;  1PLU A;  4XLC A;  3JUR A;  2INU A;  4AVZ A;  2VJI A;  1HG8 A;  1O8H A;  4U4B A;  4W8R A;  2VBE A;  4OJ5 A;  4OJP A;  1O8D A;  1O8M A;  3ZPP A;  2EWE A;  1IDJ A;  1NHC A;  2X6X A;  3GRH A;  3LMW A;  2NT9 A;  2O0V A;  2X3H A;  4PMH A;  2O0W A;  1KCC A;  1GQ8 A;  4OZZ A;  2INV A;  2UVE A;  1X0C A;  4XQF A;  2NT6 A;  1O88 A;  4W8T A;  1IB4 A;  1RMG A;  3B4N A;  1AIR A;  2NST A;  4XM3 A;  1OOC A;  2BSP A;  4XOT A;  2QY1 A;  1VBL A;  4W8Q A;  1CZF A;  4XKW A;  1O8G A;  4Z06 A;  1IA5 A;  2O17 A;  4HWV A;  4NK8 A;  5AMV A;  1KTW A;  2Z8G A;  2NSP A;  1O8F A;  3GQA A;  1BN8 A;  2PYH A;  3T9G A;  1OFM A;  2X85 A;  1JTA A;  1RWR A;  4XLH A;  3VSV A;  4YEL A;  1EE6 A;  3VMV A;  1O8I A;  3B90 A;  4U49 A; 
#chains in the Genus database with same CATH topology
 4I84 A;  3SZE A;  4XLE A;  2BM6 A;  4V02 C;  2VBM A;  1K8F A;  3VMW A;  3FY3 A;  1QRC A;  1TYW A;  1PE9 A;  3ML3 A;  4XKV A;  5C1C A;  1O8J A;  3GQ9 A;  3AK5 A;  2BM5 A;  4XL9 A;  4OJO A;  4YZX A;  4C2L A;  3PSS A;  4YZA A;  3EQN A;  1JRG A;  3NAW A;  1OGO X;  1TYU A;  2IOU G;  1O8K A;  1QJV A;  4MXN A;  3WWG A;  4EW9 A;  4OM9 A;  3JX8 A;  1DAB A;  4XN3 A;  1PXZ A;  1QCX A;  4MR0 A;  2VFO A;  2J8K A;  4W8S A;  3B8Y A;  1XG2 A;  3BH7 B;  1RU4 A;  5JMC B;  4XN0 A;  1QRB A;  4Z05 A;  2UVF A;  3GQ7 A;  4OPW A;  4XNF A;  3BH6 B;  2VFQ A;  3SUC A;  1OFE A;  2XT4 A;  4XMY A;  4XOP A;  4Z03 A;  2IQ7 A;  1OGM X;  2NZM A;  3EQO A;  1BHE A;  1IDK A;  1CLW A;  2VJJ A;  3SQV A;  1OFL A;  3VST A;  4XOR A;  3NB2 A;  1DBG A;  4XR6 A;  4NK6 A;  1TSP A;  5C1E A;  3P4G A;  3RIQ A;  4URR A;  2VFN A;  3PET A;  2O6W A;  2NTP A;  3ZSC A;  2PYG A;  4YC5 A;  1WMR A;  2B0R A;  2ODL A;  2BM7 A;  3GQ8 A;  3VSU A;  3PSZ A;  4YEJ A;  1KQ5 A;  2QXZ A;  2X6Y A;  4XLA A;  2NTB A;  1K5C A;  3SYJ A;  3KRG A;  4XON A;  4YDT A;  1KCD A;  2O1D A;  2PEC A;  2X6W A;  4YZQ A;  2NTQ A;  3LJY A;  2QX3 A;  4XLF A;  4OJL A;  1QA3 A;  2VBK A;  2O04 A;  4YZ0 A;  3UW0 A;  1DBO A;  1H80 A;  1O8L A;  1O8E A;  4OZY A;  4OJ6 A;  1PLU A;  4XLC A;  4YFO A;  3JUR A;  2INU A;  4AVZ A;  2VJI A;  1HG8 A;  2V5I A;  3N6Z A;  1O8H A;  4U4B A;  4W8R A;  2VBE A;  2QYU A;  4OJ5 A;  5JLV C;  4OJP A;  1O8D A;  1QA1 A;  1WXR A;  1O8M A;  3ZPP A;  2F3L A;  2VFP A;  2EWE A;  3H09 A;  1IDJ A;  1NHC A;  2X6X A;  2VFM A;  1LLZ A;  1TYX A;  3GRH A;  3N90 A;  2J8I A;  2W7Z A;  3LMW A;  2G0Y A;  2NT9 A;  2O0V A;  2X3H A;  2O0W A;  2XC1 A;  1GQ8 A;  4PMH A;  4YEI A;  4OZZ A;  1KCC A;  2INV A;  1LM1 A;  4KH3 A;  2UVE A;  1X0C A;  4XQF A;  2NT6 A;  1O88 A;  4W8T A;  1IB4 A;  1RMG A;  3B4N A;  1AIR A;  2NST A;  1TYV A;  4XM3 A;  1OOC A;  2BSP A;  4XOT A;  3TH0 A;  2QY1 A;  2BX6 A;  1VBL A;  4W8Q A;  1OFD A;  1CZF A;  1LLW A;  3DU1 X;  1K4Z A;  1O8G A;  2YUH A;  4XKW A;  1QA2 A;  2XTW A;  4Z06 A;  1EZG A;  1IA5 A;  2O17 A;  4JRA C;  4HWV A;  4NK8 A;  5AMV A;  1KTW A;  2Z8G A;  2NSP A;  1O8F A;  2XTY A;  2QZA A;  1BN8 A;  2PYH A;  3GQA A;  1EA0 A;  3T9G A;  1OFM A;  2X85 A;  3LYC A;  3SY2 A;  2XTX A;  1JTA A;  1HF2 A;  1RWR A;  4YCQ A;  1QQ1 A;  4XLH A;  3VSV A;  5DNS A;  4YEL A;  1EE6 A;  2BM4 A;  3VMV A;  1L1I A;  2XT2 A;  1O8I A;  3B90 A;  4U49 A; 
#chains in the Genus database with same CATH homology
 4I84 A;  4XLE A;  2VBM A;  3VMW A;  3FY3 A;  1PE9 A;  4XKV A;  5C1C A;  1O8J A;  3GQ9 A;  4XL9 A;  4OJO A;  4YZX A;  4C2L A;  4YZA A;  3EQN A;  1JRG A;  1OGO X;  1O8K A;  1QJV A;  4MXN A;  3WWG A;  4EW9 A;  4XN3 A;  1PXZ A;  1QCX A;  4MR0 A;  4W8S A;  3B8Y A;  1XG2 A;  1RU4 A;  4XN0 A;  4Z05 A;  2UVF A;  3GQ7 A;  4XNF A;  3SUC A;  4XMY A;  4XOP A;  4Z03 A;  2IQ7 A;  1OGM X;  2NZM A;  3EQO A;  1BHE A;  1IDK A;  2VJJ A;  1OFL A;  3VST A;  4XOR A;  1DBG A;  4XR6 A;  4NK6 A;  5C1E A;  4URR A;  3ZSC A;  2NTP A;  2PYG A;  1WMR A;  2ODL A;  3VSU A;  3GQ8 A;  4YEJ A;  2QXZ A;  2X6Y A;  4XLA A;  2NTB A;  1K5C A;  3KRG A;  4XON A;  1KCD A;  2O1D A;  2PEC A;  2X6W A;  4YZQ A;  2NTQ A;  4XLF A;  2QX3 A;  4OJL A;  2VBK A;  2O04 A;  4YZ0 A;  3UW0 A;  1DBO A;  1H80 A;  1O8L A;  1O8E A;  4OZY A;  4OJ6 A;  1PLU A;  4XLC A;  3JUR A;  2INU A;  4AVZ A;  2VJI A;  1HG8 A;  1O8H A;  4U4B A;  4W8R A;  2VBE A;  4OJ5 A;  4OJP A;  1O8D A;  1O8M A;  3ZPP A;  2EWE A;  1IDJ A;  1NHC A;  2X6X A;  3GRH A;  3LMW A;  2NT9 A;  2O0V A;  2X3H A;  4PMH A;  2O0W A;  1KCC A;  1GQ8 A;  4OZZ A;  2INV A;  2UVE A;  1X0C A;  4XQF A;  2NT6 A;  1O88 A;  4W8T A;  1IB4 A;  1RMG A;  3B4N A;  1AIR A;  2NST A;  4XM3 A;  1OOC A;  2BSP A;  4XOT A;  2QY1 A;  1VBL A;  4W8Q A;  1CZF A;  4XKW A;  1O8G A;  4Z06 A;  1IA5 A;  2O17 A;  4HWV A;  4NK8 A;  5AMV A;  1KTW A;  2Z8G A;  2NSP A;  1O8F A;  3GQA A;  1BN8 A;  2PYH A;  3T9G A;  1OFM A;  2X85 A;  1JTA A;  1RWR A;  4XLH A;  3VSV A;  4YEL A;  1EE6 A;  3VMV A;  1O8I A;  3B90 A;  4U49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...