1O8HA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 0.3mm ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8hA00
1BHEA 1NHCA 1RMGA 3B90A 4OJOA 2UVEA 4XLHA 2QY1A 1PLUA 1O8DA 3JURA 2QX3A 4W8QA 1OGOX 1IA5A 2ODLA 1PE9A 4OZZA 3EQOA 1O8KA 2INUA 4YZQA 2O0WA 4W8SA 4XOTA 2X85A 3VSVA 4OJ6A 1O88A 4MR0A 3ZPPA 2EWEA 3GQ7A 4XLAA 4NK8A 3SUCA 4XNFA 2NZMA 1EE6A 1IDKA 3VSUA 2O0VA 3ZSCA 1OFMA 5C1CA 1OOCA 4U4BA 4Z03A 1VBLA 3GQ8A 1RU4A 2X6WA 4XOPA 1JTAA 4XM3A 2VJIA 1KCCA 1PXZA 4XN3A 3EQNA 1CZFA 1O8IA 2IQ7A 4U49A 1WMRA 4PMHA 4YEJA 1DBGA 4YZXA 3FY3A 1O8EA 2NTPA 3KRGA 2NSTA 3VMWA 2X6YA 2O1DA 4NK6A 1O8MA 1QJVA 4MXNA 5AMVA 1IB4A 1DBOA 2NT6A 2VBKA 3VMVA 2NTQA 2UVFA 4AVZA 4XKWA 4HWVA 1O8HA 4OJ5A 2VJJA 2NTBA 3GQ9A 2Z8GA 4XMYA 2INVA 1XG2A 4OZYA 1OGMX 1OFLA 4XL9A 2O04A 1HG8A 2PYHA 3GRHA 2QXZA 4EW9A 4XKVA 3UW0A 4YELA 4URRA 2NT9A 4XR6A 4XQFA 2VBMA 1O8GA 4YZ0A 1X0CA 2NSPA 1O8LA 4XLFA 4OJPA 1IDJA 1JRGA 4Z05A 1AIRA 4W8RA 2O17A 4XONA 2X6XA 1RWRA 4XLEA 2PECA 4W8TA 4XORA 1H80A 3T9GA 2BSPA 1O8FA 1K5CA 3B8YA 2X3HA 3GQAA 4I84A 1KCDA 4C2LA 4XLCA 1O8JA 3WWGA 1GQ8A 3B4NA 5C1EA 1BN8A 2PYGA 4OJLA 1QCXA 4XN0A 1KTWA 3LMWA 4Z06A 2VBEA 4YZAA 3VSTA
chains in the Genus database with same CATH superfamily
1BHEA 1HF2A 1RMGA 3B90A 1K8FA 3BH7B 4OJOA 3SQVA 1NHCA 1L1IA 2UVEA 4XLHA 2XTXA 2QY1A 2J8KA 1PLUA 1O8DA 3JURA 2QX3A 4W8QA 1OGOX 1IA5A 1QA1A 1EA0A 4KH3A 2ODLA 1OFEA 1PE9A 2XT2A 3P4GA 4OZZA 1QRBA 3EQOA 1LLZA 2BM4A 1TYXA 1O8KA 4YDTA 2G0YA 2INUA 4YZQA 2O0WA 4JRAC 4W8SA 4XOTA 1QRCA 2X85A 3VSVA 4OJ6A 1O88A 3LYCA 1LLWA 1LM1A 3BH6B 4MR0A 3JX8A 4YCQA 4OPWA 3ZPPA 2EWEA 3GQ7A 1CLWA 2VFOA 4NK8A 4XLAA 3SUCA 1WXRA 4XNFA 2NZMA 1EE6A 1IDKA 2VFQA 3VSUA 2O0VA 3ZSCA 1OFMA 5C1CA 1OOCA 4U4BA 3SZEA 1TYVA 4Z03A 1VBLA 3GQ8A 1RU4A 2F3LA 2X6WA 4XOPA 1JTAA 4XM3A 2VJIA 5JLVC 1KCCA 1PXZA 4XN3A 3EQNA 1CZFA 1O8IA 2IQ7A 4U49A 1WMRA 2BM5A 3PSSA 2VFNA 4PMHA 2BM7A 1EZGA 2VFMA 4YEJA 1DBGA 4YZXA 3FY3A 1DABA 3LJYA 1O8EA 2NTPA 3KRGA 2NSTA 3VMWA 2X6YA 2O1DA 2XC1A 3SYJA 4NK6A 1O8MA 1QJVA 4MXNA 5AMVA 1IB4A 1DBOA 2NT6A 2BM6A 2VBKA 2VFPA 2W7ZA 3VMVA 2NTQA 3VSTA 2UVFA 4AVZA 2XTWA 4XKWA 2B0RA 1O8HA 4HWVA 4OJ5A 2QYUA 2O6WA 4OM9A 2VJJA 3NB2A 2NTBA 2XT4A 1K4ZA 2J8IA 3N6ZA 3GQ9A 3N90A 3PSZA 2Z8GA 4XMYA 2INVA 1TYWA 1XG2A 4OZYA 1OGMX 1OFLA 4XL9A 2O04A 2XTYA 1HG8A 2PYHA 3GRHA 1OFDA 2QXZA 3SY2A 2QZAA 4EW9A 4XKVA 3UW0A 1QA2A 4YELA 4URRA 2NT9A 3RIQA 1QA3A 3ML3A 4XR6A 4XQFA 2VBMA 3TH0A 1O8GA 3T9GA 4YFOA 4YZ0A 1X0CA 2NSPA 1O8LA 4XLFA 1KQ5A 1IDJA 4OJPA 1JRGA 4Z05A 5DNSA 1TYUA 3PETA 1AIRA 4W8RA 4YC5A 2O17A 4XONA 2X6XA 1RWRA 1TSPA 2PECA 2YUHA 4W8TA 1H80A 4XLEA 2BSPA 1O8FA 4XORA 1K5CA 3AK5A 3B8YA 3H09A 2X3HA 3GQAA 3NAWA 4I84A 1KCDA 4C2LA 2BX6A 1O8JA 2IOUG 4XLCA 1QQ1A 1GQ8A 3WWGA 3B4NA 3DU1X 5C1EA 1BN8A 2PYGA 4OJLA 4YEIA 1QCXA 4XN0A 1KTWA 3LMWA 4Z06A 2VBEA 4YZAA 4V02C 2V5IA 5JMCB
chains in the Genus database with same CATH topology
1BHEA 1NHCA 1RMGA 3B90A 4OJOA 2UVEA 4XLHA 2QY1A 1PLUA 1O8DA 3JURA 2QX3A 4W8QA 1OGOX 1IA5A 2ODLA 1PE9A 4OZZA 3EQOA 1O8KA 2INUA 4YZQA 2O0WA 4W8SA 4XOTA 2X85A 3VSVA 4OJ6A 1O88A 4MR0A 3ZPPA 2EWEA 3GQ7A 4XLAA 4NK8A 3SUCA 4XNFA 2NZMA 1EE6A 1IDKA 3VSUA 2O0VA 3ZSCA 1OFMA 5C1CA 1OOCA 4U4BA 4Z03A 1VBLA 3GQ8A 1RU4A 2X6WA 4XOPA 1JTAA 4XM3A 2VJIA 1KCCA 1PXZA 4XN3A 3EQNA 1CZFA 1O8IA 2IQ7A 4U49A 1WMRA 4PMHA 4YEJA 1DBGA 4YZXA 3FY3A 1O8EA 2NTPA 3KRGA 2NSTA 3VMWA 2X6YA 2O1DA 4NK6A 1O8MA 1QJVA 4MXNA 5AMVA 1IB4A 1DBOA 2NT6A 2VBKA 3VMVA 2NTQA 2UVFA 4AVZA 4XKWA 4HWVA 1O8HA 4OJ5A 2VJJA 2NTBA 3GQ9A 2Z8GA 4XMYA 2INVA 1XG2A 4OZYA 1OGMX 1OFLA 4XL9A 2O04A 1HG8A 2PYHA 3GRHA 2QXZA 4EW9A 4XKVA 3UW0A 4YELA 4URRA 2NT9A 4XR6A 4XQFA 2VBMA 1O8GA 4YZ0A 1X0CA 2NSPA 1O8LA 4XLFA 4OJPA 1IDJA 1JRGA 4Z05A 1AIRA 4W8RA 2O17A 4XONA 2X6XA 1RWRA 4XLEA 2PECA 4W8TA 4XORA 1H80A 3T9GA 2BSPA 1O8FA 1K5CA 3B8YA 2X3HA 3GQAA 4I84A 1KCDA 4C2LA 4XLCA 1O8JA 3WWGA 1GQ8A 3B4NA 5C1EA 1BN8A 2PYGA 4OJLA 1QCXA 4XN0A 1KTWA 3LMWA 4Z06A 2VBEA 4YZAA 3VSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHE A;  1NHC A;  1RMG A;  3B90 A;  4OJO A;  2UVE A;  4XLH A;  2QY1 A;  1PLU A;  1O8D A;  3JUR A;  2QX3 A;  4W8Q A;  1OGO X;  1IA5 A;  2ODL A;  1PE9 A;  4OZZ A;  3EQO A;  1O8K A;  2INU A;  4YZQ A;  2O0W A;  4W8S A;  4XOT A;  2X85 A;  3VSV A;  4OJ6 A;  1O88 A;  4MR0 A;  3ZPP A;  2EWE A;  3GQ7 A;  4XLA A;  4NK8 A;  3SUC A;  4XNF A;  2NZM A;  1EE6 A;  1IDK A;  3VSU A;  2O0V A;  3ZSC A;  1OFM A;  5C1C A;  1OOC A;  4U4B A;  4Z03 A;  1VBL A;  3GQ8 A;  1RU4 A;  2X6W A;  4XOP A;  1JTA A;  4XM3 A;  2VJI A;  1KCC A;  1PXZ A;  4XN3 A;  3EQN A;  1CZF A;  1O8I A;  2IQ7 A;  4U49 A;  1WMR A;  4PMH A;  4YEJ A;  1DBG A;  4YZX A;  3FY3 A;  1O8E A;  2NTP A;  3KRG A;  2NST A;  3VMW A;  2X6Y A;  2O1D A;  4NK6 A;  1O8M A;  1QJV A;  4MXN A;  5AMV A;  1IB4 A;  1DBO A;  2NT6 A;  2VBK A;  3VMV A;  2NTQ A;  2UVF A;  4AVZ A;  4XKW A;  4HWV A;  1O8H A;  4OJ5 A;  2VJJ A;  2NTB A;  3GQ9 A;  2Z8G A;  4XMY A;  2INV A;  1XG2 A;  4OZY A;  1OGM X;  1OFL A;  4XL9 A;  2O04 A;  1HG8 A;  2PYH A;  3GRH A;  2QXZ A;  4EW9 A;  4XKV A;  3UW0 A;  4YEL A;  4URR A;  2NT9 A;  4XR6 A;  4XQF A;  2VBM A;  1O8G A;  4YZ0 A;  1X0C A;  2NSP A;  1O8L A;  4XLF A;  4OJP A;  1IDJ A;  1JRG A;  4Z05 A;  1AIR A;  4W8R A;  2O17 A;  4XON A;  2X6X A;  1RWR A;  4XLE A;  2PEC A;  4W8T A;  4XOR A;  1H80 A;  3T9G A;  2BSP A;  1O8F A;  1K5C A;  3B8Y A;  2X3H A;  3GQA A;  4I84 A;  1KCD A;  4C2L A;  4XLC A;  1O8J A;  3WWG A;  1GQ8 A;  3B4N A;  5C1E A;  1BN8 A;  2PYG A;  4OJL A;  1QCX A;  4XN0 A;  1KTW A;  3LMW A;  4Z06 A;  2VBE A;  4YZA A;  3VST A; 
#chains in the Genus database with same CATH topology
 1BHE A;  1HF2 A;  1RMG A;  3B90 A;  1K8F A;  3BH7 B;  4OJO A;  3SQV A;  1NHC A;  1L1I A;  2UVE A;  4XLH A;  2XTX A;  2QY1 A;  2J8K A;  1PLU A;  1O8D A;  3JUR A;  2QX3 A;  4W8Q A;  1OGO X;  1IA5 A;  1QA1 A;  1EA0 A;  4KH3 A;  2ODL A;  1OFE A;  1PE9 A;  2XT2 A;  3P4G A;  4OZZ A;  1QRB A;  3EQO A;  1LLZ A;  2BM4 A;  1TYX A;  1O8K A;  4YDT A;  2G0Y A;  2INU A;  4YZQ A;  2O0W A;  4JRA C;  4W8S A;  4XOT A;  1QRC A;  2X85 A;  3VSV A;  4OJ6 A;  1O88 A;  3LYC A;  1LLW A;  1LM1 A;  3BH6 B;  4MR0 A;  3JX8 A;  4YCQ A;  4OPW A;  3ZPP A;  2EWE A;  3GQ7 A;  1CLW A;  2VFO A;  4NK8 A;  4XLA A;  3SUC A;  1WXR A;  4XNF A;  2NZM A;  1EE6 A;  1IDK A;  2VFQ A;  3VSU A;  2O0V A;  3ZSC A;  1OFM A;  5C1C A;  1OOC A;  4U4B A;  3SZE A;  1TYV A;  4Z03 A;  1VBL A;  3GQ8 A;  1RU4 A;  2F3L A;  2X6W A;  4XOP A;  1JTA A;  4XM3 A;  2VJI A;  5JLV C;  1KCC A;  1PXZ A;  4XN3 A;  3EQN A;  1CZF A;  1O8I A;  2IQ7 A;  4U49 A;  1WMR A;  2BM5 A;  3PSS A;  2VFN A;  4PMH A;  2BM7 A;  1EZG A;  2VFM A;  4YEJ A;  1DBG A;  4YZX A;  3FY3 A;  1DAB A;  3LJY A;  1O8E A;  2NTP A;  3KRG A;  2NST A;  3VMW A;  2X6Y A;  2O1D A;  2XC1 A;  3SYJ A;  4NK6 A;  1O8M A;  1QJV A;  4MXN A;  5AMV A;  1IB4 A;  1DBO A;  2NT6 A;  2BM6 A;  2VBK A;  2VFP A;  2W7Z A;  3VMV A;  2NTQ A;  3VST A;  2UVF A;  4AVZ A;  2XTW A;  4XKW A;  2B0R A;  1O8H A;  4HWV A;  4OJ5 A;  2QYU A;  2O6W A;  4OM9 A;  2VJJ A;  3NB2 A;  2NTB A;  2XT4 A;  1K4Z A;  2J8I A;  3N6Z A;  3GQ9 A;  3N90 A;  3PSZ A;  2Z8G A;  4XMY A;  2INV A;  1TYW A;  1XG2 A;  4OZY A;  1OGM X;  1OFL A;  4XL9 A;  2O04 A;  2XTY A;  1HG8 A;  2PYH A;  3GRH A;  1OFD A;  2QXZ A;  3SY2 A;  2QZA A;  4EW9 A;  4XKV A;  3UW0 A;  1QA2 A;  4YEL A;  4URR A;  2NT9 A;  3RIQ A;  1QA3 A;  3ML3 A;  4XR6 A;  4XQF A;  2VBM A;  3TH0 A;  1O8G A;  3T9G A;  4YFO A;  4YZ0 A;  1X0C A;  2NSP A;  1O8L A;  4XLF A;  1KQ5 A;  1IDJ A;  4OJP A;  1JRG A;  4Z05 A;  5DNS A;  1TYU A;  3PET A;  1AIR A;  4W8R A;  4YC5 A;  2O17 A;  4XON A;  2X6X A;  1RWR A;  1TSP A;  2PEC A;  2YUH A;  4W8T A;  1H80 A;  4XLE A;  2BSP A;  1O8F A;  4XOR A;  1K5C A;  3AK5 A;  3B8Y A;  3H09 A;  2X3H A;  3GQA A;  3NAW A;  4I84 A;  1KCD A;  4C2L A;  2BX6 A;  1O8J A;  2IOU G;  4XLC A;  1QQ1 A;  1GQ8 A;  3WWG A;  3B4N A;  3DU1 X;  5C1E A;  1BN8 A;  2PYG A;  4OJL A;  4YEI A;  1QCX A;  4XN0 A;  1KTW A;  3LMW A;  4Z06 A;  2VBE A;  4YZA A;  4V02 C;  2V5I A;  5JMC B; 
#chains in the Genus database with same CATH homology
 1BHE A;  1NHC A;  1RMG A;  3B90 A;  4OJO A;  2UVE A;  4XLH A;  2QY1 A;  1PLU A;  1O8D A;  3JUR A;  2QX3 A;  4W8Q A;  1OGO X;  1IA5 A;  2ODL A;  1PE9 A;  4OZZ A;  3EQO A;  1O8K A;  2INU A;  4YZQ A;  2O0W A;  4W8S A;  4XOT A;  2X85 A;  3VSV A;  4OJ6 A;  1O88 A;  4MR0 A;  3ZPP A;  2EWE A;  3GQ7 A;  4XLA A;  4NK8 A;  3SUC A;  4XNF A;  2NZM A;  1EE6 A;  1IDK A;  3VSU A;  2O0V A;  3ZSC A;  1OFM A;  5C1C A;  1OOC A;  4U4B A;  4Z03 A;  1VBL A;  3GQ8 A;  1RU4 A;  2X6W A;  4XOP A;  1JTA A;  4XM3 A;  2VJI A;  1KCC A;  1PXZ A;  4XN3 A;  3EQN A;  1CZF A;  1O8I A;  2IQ7 A;  4U49 A;  1WMR A;  4PMH A;  4YEJ A;  1DBG A;  4YZX A;  3FY3 A;  1O8E A;  2NTP A;  3KRG A;  2NST A;  3VMW A;  2X6Y A;  2O1D A;  4NK6 A;  1O8M A;  1QJV A;  4MXN A;  5AMV A;  1IB4 A;  1DBO A;  2NT6 A;  2VBK A;  3VMV A;  2NTQ A;  2UVF A;  4AVZ A;  4XKW A;  4HWV A;  1O8H A;  4OJ5 A;  2VJJ A;  2NTB A;  3GQ9 A;  2Z8G A;  4XMY A;  2INV A;  1XG2 A;  4OZY A;  1OGM X;  1OFL A;  4XL9 A;  2O04 A;  1HG8 A;  2PYH A;  3GRH A;  2QXZ A;  4EW9 A;  4XKV A;  3UW0 A;  4YEL A;  4URR A;  2NT9 A;  4XR6 A;  4XQF A;  2VBM A;  1O8G A;  4YZ0 A;  1X0C A;  2NSP A;  1O8L A;  4XLF A;  4OJP A;  1IDJ A;  1JRG A;  4Z05 A;  1AIR A;  4W8R A;  2O17 A;  4XON A;  2X6X A;  1RWR A;  4XLE A;  2PEC A;  4W8T A;  4XOR A;  1H80 A;  3T9G A;  2BSP A;  1O8F A;  1K5C A;  3B8Y A;  2X3H A;  3GQA A;  4I84 A;  1KCD A;  4C2L A;  4XLC A;  1O8J A;  3WWG A;  1GQ8 A;  3B4N A;  5C1E A;  1BN8 A;  2PYG A;  4OJL A;  1QCX A;  4XN0 A;  1KTW A;  3LMW A;  4Z06 A;  2VBE A;  4YZA A;  3VST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...