1O8HA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 0.3mm ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8hA00
1QCXA 2VJJA 4Z05A 4Z06A 1OOCA 4YZAA 4C2LA 3GRHA 4OJ6A 3EQNA 3GQ8A 2X3HA 2QY1A 3VSUA 4W8RA 1O8FA 1O8LA 1H80A 1KTWA 1O8MA 2O17A 2NT9A 4XN0A 5C1CA 4XLHA 4YEJA 3ZPPA 1OFMA 3GQAA 4U49A 4XKVA 1VBLA 3B4NA 2NZMA 1IDJA 2VBEA 1OGMX 4NK8A 4W8QA 2BSPA 1X0CA 4XLEA 2UVEA 2NSPA 4XMYA 4XL9A 1O8DA 1KCCA 1O8EA 3WWGA 4OJOA 1RMGA 1OFLA 1XG2A 2PYHA 1BHEA 2INUA 4XOPA 2INVA 2ODLA 4URRA 3GQ7A 4XR6A 4XM3A 3ZSCA 2PECA 4OZZA 4XLFA 4YZXA 2VBMA 4XOTA 2QX3A 3B8YA 1O8JA 1QJVA 1PE9A 1O8GA 2O1DA 4U4BA 4W8TA 2NSTA 2X85A 5AMVA 1GQ8A 2IQ7A 1IB4A 4PMHA 3SUCA 3UW0A 1CZFA 1O8HA 1O88A 4OJ5A 3LMWA 2VJIA 3B90A 4YELA 4XORA 2Z8GA 1RU4A 3VMWA 3VSVA 4OJPA 2VBKA 2O0WA 2X6WA 1JTAA 5C1EA 1JRGA 1OGOX 2O04A 1RWRA 3GQ9A 1HG8A 3KRGA 4NK6A 4Z03A 1KCDA 3T9GA 4MR0A 2X6YA 2PYGA 4XLAA 2X6XA 1O8IA 2NTQA 2UVFA 3JURA 3VSTA 4YZ0A 2QXZA 4XNFA 1DBGA 2EWEA 2NTPA 3VMVA 4YZQA 1DBOA 3EQOA 4XKWA 1EE6A 1BN8A 4AVZA 4HWVA 4OZYA 1IA5A 1IDKA 4XLCA 2O0VA 1WMRA 3FY3A 1O8KA 1AIRA 1PXZA 4MXNA 1PLUA 4XQFA 4XONA 4XN3A 1K5CA 4EW9A 4W8SA 2NT6A 1NHCA 2NTBA 4OJLA 4I84A
chains in the Genus database with same CATH superfamily
4YDTA 2G0YA 1QCXA 2VJJA 2VFOA 4Z05A 4Z06A 1OOCA 4YZAA 4C2LA 3GRHA 1QQ1A 4OJ6A 2BM7A 3EQNA 3GQ8A 5DNSA 3AK5A 2X3HA 2QY1A 2QZAA 4JRAC 1QRBA 2XTWA 3VSUA 4W8RA 1K8FA 1O8FA 1K4ZA 1O8LA 1H80A 1KTWA 1O8MA 2VFNA 3BH6B 2NT9A 2O17A 3BH7B 4XN0A 5C1CA 4XLHA 1LLWA 4YEJA 3ZPPA 4OM9A 1EA0A 1OFMA 3GQAA 4U49A 4XKVA 3SQVA 1VBLA 3B4NA 2NZMA 1IDJA 3RIQA 2VBEA 1WXRA 1OGMX 4NK8A 3TH0A 4W8QA 2BSPA 4V02C 2W7ZA 2BM4A 1TYWA 1X0CA 2BX6A 2XC1A 4XLEA 2UVEA 2NSPA 3NB2A 4XMYA 4XL9A 1KCDA 1O8DA 1TYUA 1KCCA 2BM5A 1O8EA 3WWGA 3JX8A 4OJOA 1RMGA 1OFLA 1XG2A 2PYHA 1BHEA 2INUA 2BM6A 2INVA 3H09A 4XOPA 4YFOA 2ODLA 2QYUA 4URRA 3GQ7A 4XR6A 1CLWA 4XM3A 3ZSCA 2J8KA 2PECA 4OZZA 4XLFA 4YZXA 2VBMA 4XOTA 2QX3A 3B8YA 1O8JA 2XT4A 1QJVA 1PE9A 1O8GA 1QA1A 2O1DA 4U4BA 3PSZA 4W8TA 1TYVA 1L1IA 2NSTA 2X85A 5AMVA 1GQ8A 2VFPA 2IQ7A 1IB4A 4PMHA 3SUCA 5JMCB 2B0RA 1CZFA 1O8HA 2YUHA 3UW0A 3DU1X 4OJ5A 3LMWA 1HF2A 2J8IA 2VJIA 3B90A 4YC5A 4YELA 1TYXA 4OPWA 4XORA 1OFEA 2F3LA 2Z8GA 2IOUG 1RU4A 3ML3A 2NTBA 2XTXA 3VMWA 2XTYA 2V5IA 3VSVA 4OJPA 3PSSA 2VBKA 1LM1A 2O0WA 2X6WA 3SZEA 1JTAA 4YEIA 4YCQA 5C1EA 1JRGA 1OGOX 2O04A 1RWRA 3GQ9A 1HG8A 2VFQA 3KRGA 3NAWA 4NK6A 4Z03A 3SY2A 3T9GA 1LLZA 4MR0A 2X6YA 2PYGA 4XLAA 3LYCA 2X6XA 1O8IA 3LJYA 2NTQA 2UVFA 3JURA 3SYJA 3VSTA 2QXZA 1TSPA 4YZ0A 4XNFA 5JLVC 1QA3A 1DBGA 2EWEA 2NTPA 3VMVA 4YZQA 1DBOA 1KQ5A 3EQOA 4XKWA 1EE6A 1BN8A 4AVZA 4HWVA 4OZYA 1IA5A 4KH3A 1IDKA 1OFDA 4XLCA 1EZGA 2O0VA 1DABA 1WMRA 3FY3A 1O8KA 1AIRA 1PXZA 4MXNA 1PLUA 2XT2A 3PETA 3P4GA 4XQFA 1QRCA 4XONA 3N6ZA 4XN3A 1K5CA 1QA2A 2O6WA 3N90A 4EW9A 4W8SA 2NT6A 1NHCA 2VFMA 1O88A 4OJLA 4I84A
chains in the Genus database with same CATH topology
1QCXA 2VJJA 4Z05A 4Z06A 1OOCA 4YZAA 4C2LA 3GRHA 4OJ6A 3EQNA 3GQ8A 2X3HA 2QY1A 3VSUA 4W8RA 1O8FA 1O8LA 1H80A 1KTWA 1O8MA 2O17A 2NT9A 4XN0A 5C1CA 4XLHA 4YEJA 3ZPPA 1OFMA 3GQAA 4U49A 4XKVA 1VBLA 3B4NA 2NZMA 1IDJA 2VBEA 1OGMX 4NK8A 4W8QA 2BSPA 1X0CA 4XLEA 2UVEA 2NSPA 4XMYA 4XL9A 1O8DA 1KCCA 1O8EA 3WWGA 4OJOA 1RMGA 1OFLA 1XG2A 2PYHA 1BHEA 2INUA 4XOPA 2INVA 2ODLA 4URRA 3GQ7A 4XR6A 4XM3A 3ZSCA 2PECA 4OZZA 4XLFA 4YZXA 2VBMA 4XOTA 2QX3A 3B8YA 1O8JA 1QJVA 1PE9A 1O8GA 2O1DA 4U4BA 4W8TA 2NSTA 2X85A 5AMVA 1GQ8A 2IQ7A 1IB4A 4PMHA 3SUCA 3UW0A 1CZFA 1O8HA 1O88A 4OJ5A 3LMWA 2VJIA 3B90A 4YELA 4XORA 2Z8GA 1RU4A 3VMWA 3VSVA 4OJPA 2VBKA 2O0WA 2X6WA 1JTAA 5C1EA 1JRGA 1OGOX 2O04A 1RWRA 3GQ9A 1HG8A 3KRGA 4NK6A 4Z03A 1KCDA 3T9GA 4MR0A 2X6YA 2PYGA 4XLAA 2X6XA 1O8IA 2NTQA 2UVFA 3JURA 3VSTA 4YZ0A 2QXZA 4XNFA 1DBGA 2EWEA 2NTPA 3VMVA 4YZQA 1DBOA 3EQOA 4XKWA 1EE6A 1BN8A 4AVZA 4HWVA 4OZYA 1IA5A 1IDKA 4XLCA 2O0VA 1WMRA 3FY3A 1O8KA 1AIRA 1PXZA 4MXNA 1PLUA 4XQFA 4XONA 4XN3A 1K5CA 4EW9A 4W8SA 2NT6A 1NHCA 2NTBA 4OJLA 4I84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCX A;  2VJJ A;  4Z05 A;  4Z06 A;  1OOC A;  4YZA A;  4C2L A;  3GRH A;  4OJ6 A;  3EQN A;  3GQ8 A;  2X3H A;  2QY1 A;  3VSU A;  4W8R A;  1O8F A;  1O8L A;  1H80 A;  1KTW A;  1O8M A;  2O17 A;  2NT9 A;  4XN0 A;  5C1C A;  4XLH A;  4YEJ A;  3ZPP A;  1OFM A;  3GQA A;  4U49 A;  4XKV A;  1VBL A;  3B4N A;  2NZM A;  1IDJ A;  2VBE A;  1OGM X;  4NK8 A;  4W8Q A;  2BSP A;  1X0C A;  4XLE A;  2UVE A;  2NSP A;  4XMY A;  4XL9 A;  1O8D A;  1KCC A;  1O8E A;  3WWG A;  4OJO A;  1RMG A;  1OFL A;  1XG2 A;  2PYH A;  1BHE A;  2INU A;  4XOP A;  2INV A;  2ODL A;  4URR A;  3GQ7 A;  4XR6 A;  4XM3 A;  3ZSC A;  2PEC A;  4OZZ A;  4XLF A;  4YZX A;  2VBM A;  4XOT A;  2QX3 A;  3B8Y A;  1O8J A;  1QJV A;  1PE9 A;  1O8G A;  2O1D A;  4U4B A;  4W8T A;  2NST A;  2X85 A;  5AMV A;  1GQ8 A;  2IQ7 A;  1IB4 A;  4PMH A;  3SUC A;  3UW0 A;  1CZF A;  1O8H A;  1O88 A;  4OJ5 A;  3LMW A;  2VJI A;  3B90 A;  4YEL A;  4XOR A;  2Z8G A;  1RU4 A;  3VMW A;  3VSV A;  4OJP A;  2VBK A;  2O0W A;  2X6W A;  1JTA A;  5C1E A;  1JRG A;  1OGO X;  2O04 A;  1RWR A;  3GQ9 A;  1HG8 A;  3KRG A;  4NK6 A;  4Z03 A;  1KCD A;  3T9G A;  4MR0 A;  2X6Y A;  2PYG A;  4XLA A;  2X6X A;  1O8I A;  2NTQ A;  2UVF A;  3JUR A;  3VST A;  4YZ0 A;  2QXZ A;  4XNF A;  1DBG A;  2EWE A;  2NTP A;  3VMV A;  4YZQ A;  1DBO A;  3EQO A;  4XKW A;  1EE6 A;  1BN8 A;  4AVZ A;  4HWV A;  4OZY A;  1IA5 A;  1IDK A;  4XLC A;  2O0V A;  1WMR A;  3FY3 A;  1O8K A;  1AIR A;  1PXZ A;  4MXN A;  1PLU A;  4XQF A;  4XON A;  4XN3 A;  1K5C A;  4EW9 A;  4W8S A;  2NT6 A;  1NHC A;  2NTB A;  4OJL A;  4I84 A; 
#chains in the Genus database with same CATH topology
 4YDT A;  2G0Y A;  1QCX A;  2VJJ A;  2VFO A;  4Z05 A;  4Z06 A;  1OOC A;  4YZA A;  4C2L A;  3GRH A;  1QQ1 A;  4OJ6 A;  2BM7 A;  3EQN A;  3GQ8 A;  5DNS A;  3AK5 A;  2X3H A;  2QY1 A;  2QZA A;  4JRA C;  1QRB A;  2XTW A;  3VSU A;  4W8R A;  1K8F A;  1O8F A;  1K4Z A;  1O8L A;  1H80 A;  1KTW A;  1O8M A;  2VFN A;  3BH6 B;  2NT9 A;  2O17 A;  3BH7 B;  4XN0 A;  5C1C A;  4XLH A;  1LLW A;  4YEJ A;  3ZPP A;  4OM9 A;  1EA0 A;  1OFM A;  3GQA A;  4U49 A;  4XKV A;  3SQV A;  1VBL A;  3B4N A;  2NZM A;  1IDJ A;  3RIQ A;  2VBE A;  1WXR A;  1OGM X;  4NK8 A;  3TH0 A;  4W8Q A;  2BSP A;  4V02 C;  2W7Z A;  2BM4 A;  1TYW A;  1X0C A;  2BX6 A;  2XC1 A;  4XLE A;  2UVE A;  2NSP A;  3NB2 A;  4XMY A;  4XL9 A;  1KCD A;  1O8D A;  1TYU A;  1KCC A;  2BM5 A;  1O8E A;  3WWG A;  3JX8 A;  4OJO A;  1RMG A;  1OFL A;  1XG2 A;  2PYH A;  1BHE A;  2INU A;  2BM6 A;  2INV A;  3H09 A;  4XOP A;  4YFO A;  2ODL A;  2QYU A;  4URR A;  3GQ7 A;  4XR6 A;  1CLW A;  4XM3 A;  3ZSC A;  2J8K A;  2PEC A;  4OZZ A;  4XLF A;  4YZX A;  2VBM A;  4XOT A;  2QX3 A;  3B8Y A;  1O8J A;  2XT4 A;  1QJV A;  1PE9 A;  1O8G A;  1QA1 A;  2O1D A;  4U4B A;  3PSZ A;  4W8T A;  1TYV A;  1L1I A;  2NST A;  2X85 A;  5AMV A;  1GQ8 A;  2VFP A;  2IQ7 A;  1IB4 A;  4PMH A;  3SUC A;  5JMC B;  2B0R A;  1CZF A;  1O8H A;  2YUH A;  3UW0 A;  3DU1 X;  4OJ5 A;  3LMW A;  1HF2 A;  2J8I A;  2VJI A;  3B90 A;  4YC5 A;  4YEL A;  1TYX A;  4OPW A;  4XOR A;  1OFE A;  2F3L A;  2Z8G A;  2IOU G;  1RU4 A;  3ML3 A;  2NTB A;  2XTX A;  3VMW A;  2XTY A;  2V5I A;  3VSV A;  4OJP A;  3PSS A;  2VBK A;  1LM1 A;  2O0W A;  2X6W A;  3SZE A;  1JTA A;  4YEI A;  4YCQ A;  5C1E A;  1JRG A;  1OGO X;  2O04 A;  1RWR A;  3GQ9 A;  1HG8 A;  2VFQ A;  3KRG A;  3NAW A;  4NK6 A;  4Z03 A;  3SY2 A;  3T9G A;  1LLZ A;  4MR0 A;  2X6Y A;  2PYG A;  4XLA A;  3LYC A;  2X6X A;  1O8I A;  3LJY A;  2NTQ A;  2UVF A;  3JUR A;  3SYJ A;  3VST A;  2QXZ A;  1TSP A;  4YZ0 A;  4XNF A;  5JLV C;  1QA3 A;  1DBG A;  2EWE A;  2NTP A;  3VMV A;  4YZQ A;  1DBO A;  1KQ5 A;  3EQO A;  4XKW A;  1EE6 A;  1BN8 A;  4AVZ A;  4HWV A;  4OZY A;  1IA5 A;  4KH3 A;  1IDK A;  1OFD A;  4XLC A;  1EZG A;  2O0V A;  1DAB A;  1WMR A;  3FY3 A;  1O8K A;  1AIR A;  1PXZ A;  4MXN A;  1PLU A;  2XT2 A;  3PET A;  3P4G A;  4XQF A;  1QRC A;  4XON A;  3N6Z A;  4XN3 A;  1K5C A;  1QA2 A;  2O6W A;  3N90 A;  4EW9 A;  4W8S A;  2NT6 A;  1NHC A;  2VFM A;  1O88 A;  4OJL A;  4I84 A; 
#chains in the Genus database with same CATH homology
 1QCX A;  2VJJ A;  4Z05 A;  4Z06 A;  1OOC A;  4YZA A;  4C2L A;  3GRH A;  4OJ6 A;  3EQN A;  3GQ8 A;  2X3H A;  2QY1 A;  3VSU A;  4W8R A;  1O8F A;  1O8L A;  1H80 A;  1KTW A;  1O8M A;  2O17 A;  2NT9 A;  4XN0 A;  5C1C A;  4XLH A;  4YEJ A;  3ZPP A;  1OFM A;  3GQA A;  4U49 A;  4XKV A;  1VBL A;  3B4N A;  2NZM A;  1IDJ A;  2VBE A;  1OGM X;  4NK8 A;  4W8Q A;  2BSP A;  1X0C A;  4XLE A;  2UVE A;  2NSP A;  4XMY A;  4XL9 A;  1O8D A;  1KCC A;  1O8E A;  3WWG A;  4OJO A;  1RMG A;  1OFL A;  1XG2 A;  2PYH A;  1BHE A;  2INU A;  4XOP A;  2INV A;  2ODL A;  4URR A;  3GQ7 A;  4XR6 A;  4XM3 A;  3ZSC A;  2PEC A;  4OZZ A;  4XLF A;  4YZX A;  2VBM A;  4XOT A;  2QX3 A;  3B8Y A;  1O8J A;  1QJV A;  1PE9 A;  1O8G A;  2O1D A;  4U4B A;  4W8T A;  2NST A;  2X85 A;  5AMV A;  1GQ8 A;  2IQ7 A;  1IB4 A;  4PMH A;  3SUC A;  3UW0 A;  1CZF A;  1O8H A;  1O88 A;  4OJ5 A;  3LMW A;  2VJI A;  3B90 A;  4YEL A;  4XOR A;  2Z8G A;  1RU4 A;  3VMW A;  3VSV A;  4OJP A;  2VBK A;  2O0W A;  2X6W A;  1JTA A;  5C1E A;  1JRG A;  1OGO X;  2O04 A;  1RWR A;  3GQ9 A;  1HG8 A;  3KRG A;  4NK6 A;  4Z03 A;  1KCD A;  3T9G A;  4MR0 A;  2X6Y A;  2PYG A;  4XLA A;  2X6X A;  1O8I A;  2NTQ A;  2UVF A;  3JUR A;  3VST A;  4YZ0 A;  2QXZ A;  4XNF A;  1DBG A;  2EWE A;  2NTP A;  3VMV A;  4YZQ A;  1DBO A;  3EQO A;  4XKW A;  1EE6 A;  1BN8 A;  4AVZ A;  4HWV A;  4OZY A;  1IA5 A;  1IDK A;  4XLC A;  2O0V A;  1WMR A;  3FY3 A;  1O8K A;  1AIR A;  1PXZ A;  4MXN A;  1PLU A;  4XQF A;  4XON A;  4XN3 A;  1K5C A;  4EW9 A;  4W8S A;  2NT6 A;  1NHC A;  2NTB A;  4OJL A;  4I84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...