1O8HA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 0.3mm ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8hA00
2Z8GA 3SUCA 2QXZA 2O0VA 2O04A 1OFLA 1AIRA 4XLEA 1HG8A 2IQ7A 2NTQA 2NTPA 1OGMX 3GQ7A 2O1DA 2X85A 1DBGA 4XONA 5C1EA 1BN8A 1OFMA 1RWRA 4YEJA 4XLAA 4MXNA 2NZMA 1O8DA 3VMWA 2VJJA 4XORA 4OJOA 4Z06A 1BHEA 4OZYA 4NK6A 4I84A 2VBKA 1H80A 1JTAA 1PLUA 4W8RA 3GQ8A 1O8HA 3FY3A 1X0CA 4YELA 4PMHA 4OJ5A 1OOCA 2VBEA 4OZZA 2NT9A 1CZFA 2INVA 2NTBA 3GQAA 2UVEA 4W8SA 3UW0A 4XKWA 1O8IA 3JURA 4NK8A 4XL9A 4AVZA 2VJIA 3EQNA 1NHCA 4OJ6A 4YZQA 4XLFA 4XOPA 2QX3A 4EW9A 4W8QA 3VSUA 4Z05A 4URRA 5AMVA 2O17A 2PYHA 1O8LA 4XLHA 4XQFA 2INUA 2X6YA 1QCXA 4XOTA 1O8FA 1IA5A 2NT6A 1O88A 1JRGA 1O8KA 4XKVA 3VSVA 3LMWA 3ZPPA 1QJVA 2X3HA 1KCCA 2EWEA 1O8MA 3ZSCA 2NSTA 1OGOX 1IDKA 4W8TA 3VMVA 2VBMA 1PXZA 1RMGA 1WMRA 3B90A 4HWVA 5C1CA 2X6WA 1KCDA 1EE6A 3B8YA 1VBLA 1O8JA 2UVFA 4XN0A 3WWGA 4XLCA 2O0WA 3VSTA 2PYGA 1RU4A 4XR6A 4OJPA 2BSPA 4C2LA 3T9GA 2NSPA 1DBOA 1O8GA 4U49A 4Z03A 1IDJA 1O8EA 2ODLA 1IB4A 1XG2A 4XNFA 4YZAA 4YZ0A 4XN3A 2QY1A 4YZXA 3GQ9A 2X6XA 3GRHA 3KRGA 4U4BA 1PE9A 4XMYA 4MR0A 3B4NA 1K5CA 1KTWA 4OJLA 3EQOA 2PECA 4XM3A 1GQ8A
chains in the Genus database with same CATH superfamily
2Z8GA 3SUCA 2QXZA 4V02C 2O0VA 1OFDA 2VFOA 2O04A 1OFLA 1AIRA 2VFMA 4XLEA 1HG8A 2IQ7A 1HF2A 2NTQA 1OFEA 1OGMX 2NTPA 1TSPA 3GQ7A 1QRCA 2O1DA 2X85A 1DBGA 1LM1A 4XONA 5C1EA 1BN8A 1OFMA 1RWRA 1TYWA 2B0RA 4YEJA 4XLAA 4MXNA 2NZMA 1O8DA 1K8FA 1QRBA 2QZAA 2VJJA 4XORA 4OJOA 3VMWA 3PETA 1TYVA 2BM5A 5DNSA 4Z06A 2XT2A 1BHEA 3LYCA 2F3LA 2V5IA 4OZYA 4NK6A 4I84A 2VBKA 1H80A 1JTAA 1PLUA 4W8RA 3GQ8A 4JRAC 1QA3A 1O8HA 2XTWA 3FY3A 1X0CA 4YELA 4PMHA 3BH7B 4OJ5A 1L1IA 1OOCA 1TYUA 2VBEA 1K4ZA 2NT9A 4OZZA 4YEIA 1CZFA 2INVA 2NTBA 3SY2A 3GQAA 2UVEA 4W8SA 3UW0A 4KH3A 4XKWA 5JMCB 3SZEA 1O8IA 3JURA 3LJYA 2BM4A 4NK8A 4XL9A 4AVZA 2VJIA 3EQNA 2G0YA 1NHCA 4OJ6A 4YZQA 4XLFA 2XT4A 3PSZA 1QQ1A 4YCQA 4XOPA 2QX3A 4EW9A 2XTXA 4W8QA 3VSUA 4Z05A 1LLZA 4OPWA 4URRA 5AMVA 2J8KA 3NAWA 2O17A 1TYXA 2PYHA 1O8LA 4XLHA 3ML3A 1QA1A 1KQ5A 4XQFA 2INUA 2X6YA 1QCXA 3P4GA 4XOTA 1O8FA 2QYUA 1IA5A 2NT6A 2XC1A 1O88A 4YDTA 3DU1X 1QA2A 1JRGA 3SQVA 3N90A 2BM7A 1O8KA 3N6ZA 4OM9A 4XKVA 3RIQA 3VSVA 3LMWA 3ZPPA 1QJVA 2X3HA 3NB2A 1KCCA 1LLWA 3SYJA 3AK5A 2EWEA 3BH6B 1O8MA 3ZSCA 2NSTA 3H09A 1OGOX 4YC5A 2VFQA 1IDKA 4W8TA 3VMVA 5JLVC 2VBMA 1PXZA 1CLWA 1RMGA 1WMRA 2IOUG 2O6WA 3B90A 4HWVA 2X6WA 5C1CA 2VFNA 4YFOA 1KCDA 1EE6A 2VFPA 2W7ZA 1VBLA 3B8YA 1O8JA 2UVFA 4XN0A 3WWGA 4XLCA 2O0WA 3VSTA 2PYGA 1RU4A 4XR6A 1WXRA 4OJPA 2BSPA 4C2LA 3T9GA 2NSPA 1DBOA 1O8GA 4U49A 4Z03A 1IDJA 1O8EA 2ODLA 1IB4A 1XG2A 1EZGA 4XNFA 1DABA 4YZAA 2J8IA 3TH0A 2XTYA 4YZ0A 3JX8A 4XN3A 2QY1A 4YZXA 2YUHA 3GQ9A 2X6XA 2BM6A 3GRHA 3KRGA 4U4BA 1PE9A 4XMYA 4MR0A 1EA0A 3B4NA 3PSSA 1K5CA 1KTWA 4OJLA 3EQOA 2PECA 4XM3A 1GQ8A 2BX6A
chains in the Genus database with same CATH topology
2Z8GA 3SUCA 2QXZA 2O0VA 2O04A 1OFLA 1AIRA 4XLEA 1HG8A 2IQ7A 2NTQA 2NTPA 1OGMX 3GQ7A 2O1DA 2X85A 1DBGA 4XONA 5C1EA 1BN8A 1OFMA 1RWRA 4YEJA 4XLAA 4MXNA 2NZMA 1O8DA 3VMWA 2VJJA 4XORA 4OJOA 4Z06A 1BHEA 4OZYA 4NK6A 4I84A 2VBKA 1H80A 1JTAA 1PLUA 4W8RA 3GQ8A 1O8HA 3FY3A 1X0CA 4YELA 4PMHA 4OJ5A 1OOCA 2VBEA 4OZZA 2NT9A 1CZFA 2INVA 2NTBA 3GQAA 2UVEA 4W8SA 3UW0A 4XKWA 1O8IA 3JURA 4NK8A 4XL9A 4AVZA 2VJIA 3EQNA 1NHCA 4OJ6A 4YZQA 4XLFA 4XOPA 2QX3A 4EW9A 4W8QA 3VSUA 4Z05A 4URRA 5AMVA 2O17A 2PYHA 1O8LA 4XLHA 4XQFA 2INUA 2X6YA 1QCXA 4XOTA 1O8FA 1IA5A 2NT6A 1O88A 1JRGA 1O8KA 4XKVA 3VSVA 3LMWA 3ZPPA 1QJVA 2X3HA 1KCCA 2EWEA 1O8MA 3ZSCA 2NSTA 1OGOX 1IDKA 4W8TA 3VMVA 2VBMA 1PXZA 1RMGA 1WMRA 3B90A 4HWVA 5C1CA 2X6WA 1KCDA 1EE6A 3B8YA 1VBLA 1O8JA 2UVFA 4XN0A 3WWGA 4XLCA 2O0WA 3VSTA 2PYGA 1RU4A 4XR6A 4OJPA 2BSPA 4C2LA 3T9GA 2NSPA 1DBOA 1O8GA 4U49A 4Z03A 1IDJA 1O8EA 2ODLA 1IB4A 1XG2A 4XNFA 4YZAA 4YZ0A 4XN3A 2QY1A 4YZXA 3GQ9A 2X6XA 3GRHA 3KRGA 4U4BA 1PE9A 4XMYA 4MR0A 3B4NA 1K5CA 1KTWA 4OJLA 3EQOA 2PECA 4XM3A 1GQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8G A;  3SUC A;  2QXZ A;  2O0V A;  2O04 A;  1OFL A;  1AIR A;  4XLE A;  1HG8 A;  2IQ7 A;  2NTQ A;  2NTP A;  1OGM X;  3GQ7 A;  2O1D A;  2X85 A;  1DBG A;  4XON A;  5C1E A;  1BN8 A;  1OFM A;  1RWR A;  4YEJ A;  4XLA A;  4MXN A;  2NZM A;  1O8D A;  3VMW A;  2VJJ A;  4XOR A;  4OJO A;  4Z06 A;  1BHE A;  4OZY A;  4NK6 A;  4I84 A;  2VBK A;  1H80 A;  1JTA A;  1PLU A;  4W8R A;  3GQ8 A;  1O8H A;  3FY3 A;  1X0C A;  4YEL A;  4PMH A;  4OJ5 A;  1OOC A;  2VBE A;  4OZZ A;  2NT9 A;  1CZF A;  2INV A;  2NTB A;  3GQA A;  2UVE A;  4W8S A;  3UW0 A;  4XKW A;  1O8I A;  3JUR A;  4NK8 A;  4XL9 A;  4AVZ A;  2VJI A;  3EQN A;  1NHC A;  4OJ6 A;  4YZQ A;  4XLF A;  4XOP A;  2QX3 A;  4EW9 A;  4W8Q A;  3VSU A;  4Z05 A;  4URR A;  5AMV A;  2O17 A;  2PYH A;  1O8L A;  4XLH A;  4XQF A;  2INU A;  2X6Y A;  1QCX A;  4XOT A;  1O8F A;  1IA5 A;  2NT6 A;  1O88 A;  1JRG A;  1O8K A;  4XKV A;  3VSV A;  3LMW A;  3ZPP A;  1QJV A;  2X3H A;  1KCC A;  2EWE A;  1O8M A;  3ZSC A;  2NST A;  1OGO X;  1IDK A;  4W8T A;  3VMV A;  2VBM A;  1PXZ A;  1RMG A;  1WMR A;  3B90 A;  4HWV A;  5C1C A;  2X6W A;  1KCD A;  1EE6 A;  3B8Y A;  1VBL A;  1O8J A;  2UVF A;  4XN0 A;  3WWG A;  4XLC A;  2O0W A;  3VST A;  2PYG A;  1RU4 A;  4XR6 A;  4OJP A;  2BSP A;  4C2L A;  3T9G A;  2NSP A;  1DBO A;  1O8G A;  4U49 A;  4Z03 A;  1IDJ A;  1O8E A;  2ODL A;  1IB4 A;  1XG2 A;  4XNF A;  4YZA A;  4YZ0 A;  4XN3 A;  2QY1 A;  4YZX A;  3GQ9 A;  2X6X A;  3GRH A;  3KRG A;  4U4B A;  1PE9 A;  4XMY A;  4MR0 A;  3B4N A;  1K5C A;  1KTW A;  4OJL A;  3EQO A;  2PEC A;  4XM3 A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 2Z8G A;  3SUC A;  2QXZ A;  4V02 C;  2O0V A;  1OFD A;  2VFO A;  2O04 A;  1OFL A;  1AIR A;  2VFM A;  4XLE A;  1HG8 A;  2IQ7 A;  1HF2 A;  2NTQ A;  1OFE A;  1OGM X;  2NTP A;  1TSP A;  3GQ7 A;  1QRC A;  2O1D A;  2X85 A;  1DBG A;  1LM1 A;  4XON A;  5C1E A;  1BN8 A;  1OFM A;  1RWR A;  1TYW A;  2B0R A;  4YEJ A;  4XLA A;  4MXN A;  2NZM A;  1O8D A;  1K8F A;  1QRB A;  2QZA A;  2VJJ A;  4XOR A;  4OJO A;  3VMW A;  3PET A;  1TYV A;  2BM5 A;  5DNS A;  4Z06 A;  2XT2 A;  1BHE A;  3LYC A;  2F3L A;  2V5I A;  4OZY A;  4NK6 A;  4I84 A;  2VBK A;  1H80 A;  1JTA A;  1PLU A;  4W8R A;  3GQ8 A;  4JRA C;  1QA3 A;  1O8H A;  2XTW A;  3FY3 A;  1X0C A;  4YEL A;  4PMH A;  3BH7 B;  4OJ5 A;  1L1I A;  1OOC A;  1TYU A;  2VBE A;  1K4Z A;  2NT9 A;  4OZZ A;  4YEI A;  1CZF A;  2INV A;  2NTB A;  3SY2 A;  3GQA A;  2UVE A;  4W8S A;  3UW0 A;  4KH3 A;  4XKW A;  5JMC B;  3SZE A;  1O8I A;  3JUR A;  3LJY A;  2BM4 A;  4NK8 A;  4XL9 A;  4AVZ A;  2VJI A;  3EQN A;  2G0Y A;  1NHC A;  4OJ6 A;  4YZQ A;  4XLF A;  2XT4 A;  3PSZ A;  1QQ1 A;  4YCQ A;  4XOP A;  2QX3 A;  4EW9 A;  2XTX A;  4W8Q A;  3VSU A;  4Z05 A;  1LLZ A;  4OPW A;  4URR A;  5AMV A;  2J8K A;  3NAW A;  2O17 A;  1TYX A;  2PYH A;  1O8L A;  4XLH A;  3ML3 A;  1QA1 A;  1KQ5 A;  4XQF A;  2INU A;  2X6Y A;  1QCX A;  3P4G A;  4XOT A;  1O8F A;  2QYU A;  1IA5 A;  2NT6 A;  2XC1 A;  1O88 A;  4YDT A;  3DU1 X;  1QA2 A;  1JRG A;  3SQV A;  3N90 A;  2BM7 A;  1O8K A;  3N6Z A;  4OM9 A;  4XKV A;  3RIQ A;  3VSV A;  3LMW A;  3ZPP A;  1QJV A;  2X3H A;  3NB2 A;  1KCC A;  1LLW A;  3SYJ A;  3AK5 A;  2EWE A;  3BH6 B;  1O8M A;  3ZSC A;  2NST A;  3H09 A;  1OGO X;  4YC5 A;  2VFQ A;  1IDK A;  4W8T A;  3VMV A;  5JLV C;  2VBM A;  1PXZ A;  1CLW A;  1RMG A;  1WMR A;  2IOU G;  2O6W A;  3B90 A;  4HWV A;  2X6W A;  5C1C A;  2VFN A;  4YFO A;  1KCD A;  1EE6 A;  2VFP A;  2W7Z A;  1VBL A;  3B8Y A;  1O8J A;  2UVF A;  4XN0 A;  3WWG A;  4XLC A;  2O0W A;  3VST A;  2PYG A;  1RU4 A;  4XR6 A;  1WXR A;  4OJP A;  2BSP A;  4C2L A;  3T9G A;  2NSP A;  1DBO A;  1O8G A;  4U49 A;  4Z03 A;  1IDJ A;  1O8E A;  2ODL A;  1IB4 A;  1XG2 A;  1EZG A;  4XNF A;  1DAB A;  4YZA A;  2J8I A;  3TH0 A;  2XTY A;  4YZ0 A;  3JX8 A;  4XN3 A;  2QY1 A;  4YZX A;  2YUH A;  3GQ9 A;  2X6X A;  2BM6 A;  3GRH A;  3KRG A;  4U4B A;  1PE9 A;  4XMY A;  4MR0 A;  1EA0 A;  3B4N A;  3PSS A;  1K5C A;  1KTW A;  4OJL A;  3EQO A;  2PEC A;  4XM3 A;  1GQ8 A;  2BX6 A; 
#chains in the Genus database with same CATH homology
 2Z8G A;  3SUC A;  2QXZ A;  2O0V A;  2O04 A;  1OFL A;  1AIR A;  4XLE A;  1HG8 A;  2IQ7 A;  2NTQ A;  2NTP A;  1OGM X;  3GQ7 A;  2O1D A;  2X85 A;  1DBG A;  4XON A;  5C1E A;  1BN8 A;  1OFM A;  1RWR A;  4YEJ A;  4XLA A;  4MXN A;  2NZM A;  1O8D A;  3VMW A;  2VJJ A;  4XOR A;  4OJO A;  4Z06 A;  1BHE A;  4OZY A;  4NK6 A;  4I84 A;  2VBK A;  1H80 A;  1JTA A;  1PLU A;  4W8R A;  3GQ8 A;  1O8H A;  3FY3 A;  1X0C A;  4YEL A;  4PMH A;  4OJ5 A;  1OOC A;  2VBE A;  4OZZ A;  2NT9 A;  1CZF A;  2INV A;  2NTB A;  3GQA A;  2UVE A;  4W8S A;  3UW0 A;  4XKW A;  1O8I A;  3JUR A;  4NK8 A;  4XL9 A;  4AVZ A;  2VJI A;  3EQN A;  1NHC A;  4OJ6 A;  4YZQ A;  4XLF A;  4XOP A;  2QX3 A;  4EW9 A;  4W8Q A;  3VSU A;  4Z05 A;  4URR A;  5AMV A;  2O17 A;  2PYH A;  1O8L A;  4XLH A;  4XQF A;  2INU A;  2X6Y A;  1QCX A;  4XOT A;  1O8F A;  1IA5 A;  2NT6 A;  1O88 A;  1JRG A;  1O8K A;  4XKV A;  3VSV A;  3LMW A;  3ZPP A;  1QJV A;  2X3H A;  1KCC A;  2EWE A;  1O8M A;  3ZSC A;  2NST A;  1OGO X;  1IDK A;  4W8T A;  3VMV A;  2VBM A;  1PXZ A;  1RMG A;  1WMR A;  3B90 A;  4HWV A;  5C1C A;  2X6W A;  1KCD A;  1EE6 A;  3B8Y A;  1VBL A;  1O8J A;  2UVF A;  4XN0 A;  3WWG A;  4XLC A;  2O0W A;  3VST A;  2PYG A;  1RU4 A;  4XR6 A;  4OJP A;  2BSP A;  4C2L A;  3T9G A;  2NSP A;  1DBO A;  1O8G A;  4U49 A;  4Z03 A;  1IDJ A;  1O8E A;  2ODL A;  1IB4 A;  1XG2 A;  4XNF A;  4YZA A;  4YZ0 A;  4XN3 A;  2QY1 A;  4YZX A;  3GQ9 A;  2X6X A;  3GRH A;  3KRG A;  4U4B A;  1PE9 A;  4XMY A;  4MR0 A;  3B4N A;  1K5C A;  1KTW A;  4OJL A;  3EQO A;  2PEC A;  4XM3 A;  1GQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...