1O8HA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 0.3mm ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8hA00
2O04A 2VBEA 3FY3A 4XLFA 3B4NA 2X6YA 3ZPPA 1O8EA 4Z06A 4XNFA 2X85A 1O8MA 4XR6A 1O8KA 1PXZA 1O8FA 3GQ8A 4MXNA 4XOPA 4MR0A 2QX3A 4XKWA 2EWEA 3EQNA 4XN0A 2UVFA 3UW0A 3KRGA 2O17A 4I84A 4YZAA 3GQ9A 4YZXA 2VJJA 3B90A 5C1EA 4HWVA 2X6WA 4C2LA 4AVZA 1KTWA 4W8SA 2NTPA 2X3HA 4XONA 1O8JA 4Z03A 1OGOX 1VBLA 2O1DA 4OZYA 1NHCA 4W8TA 1KCCA 4XL9A 1CZFA 4XN3A 2NZMA 4PMHA 2VBMA 3SUCA 3T9GA 2O0VA 2PYHA 3GQ7A 3LMWA 4YEJA 4XLAA 4XKVA 2IQ7A 1BN8A 4U49A 3GQAA 3VSVA 2VJIA 1O8GA 1PLUA 4W8QA 1IA5A 2PECA 1O88A 4YZ0A 2QY1A 1OFLA 1QCXA 1WMRA 3VMWA 2O0WA 4Z05A 1HG8A 1XG2A 2Z8GA 1IDKA 1K5CA 4OJ5A 1O8IA 2BSPA 4XLEA 4OJPA 4XOTA 1OGMX 2UVEA 1IB4A 4NK8A 4XMYA 2VBKA 2QXZA 1PE9A 2X6XA 4XLCA 3VMVA 3WWGA 1KCDA 4XM3A 3GRHA 1DBOA 1X0CA 2ODLA 3VSTA 5C1CA 2NT6A 4YELA 3B8YA 1GQ8A 4OJLA 4U4BA 1RMGA 1H80A 4YZQA 1O8LA 3JURA 1OOCA 5AMVA 3ZSCA 1EE6A 1RWRA 1JTAA 4URRA 3EQOA 4OZZA 1DBGA 2NTQA 4XORA 1AIRA 2NSTA 4XLHA 4W8RA 1O8HA 2NTBA 4OJ6A 4XQFA 1O8DA 1OFMA 1QJVA 2INUA 2NSPA 2INVA 1BHEA 4OJOA 4NK6A 3VSUA 2PYGA 2NT9A 1IDJA 4EW9A 1RU4A 1JRGA
chains in the Genus database with same CATH superfamily
2O04A 2VBEA 3FY3A 2W7ZA 3N90A 3P4GA 4XLFA 3B4NA 3SY2A 2X6YA 3ZPPA 1O8EA 4Z06A 4KH3A 4XNFA 2X85A 1O8MA 4XR6A 1O8KA 1PXZA 1O8FA 3GQ8A 4MXNA 4XOPA 4MR0A 2J8IA 2QX3A 1QRCA 2VFPA 2XT2A 4XKWA 2EWEA 1LM1A 3EQNA 2J8KA 2F3LA 2V5IA 4OPWA 4XN0A 2UVFA 2QYUA 5JMCB 1TYWA 3UW0A 3KRGA 3JX8A 2O17A 4I84A 1QRBA 4YZAA 1LLZA 3GQ9A 4YZXA 1EA0A 2VJJA 3B90A 5C1EA 4HWVA 2X6WA 5DNSA 3PSZA 3ML3A 4AVZA 4C2LA 2YUHA 1KTWA 2BM5A 4JRAC 4W8SA 2NTPA 2X3HA 1WXRA 1DABA 4XONA 2XTYA 1O8JA 4Z03A 1OGOX 1VBLA 2O1DA 2VFQA 2QZAA 4OZYA 1NHCA 1TSPA 4OM9A 4W8TA 1KCCA 4XL9A 1CZFA 4XN3A 2NZMA 4PMHA 2G0YA 2VBMA 2IOUG 1K4ZA 3SUCA 3NAWA 3T9GA 3LYCA 2O0VA 2XC1A 2PYHA 3AK5A 3GQ7A 3LMWA 4YEJA 4XLAA 4XKVA 2IQ7A 1BN8A 4U49A 3GQAA 3SYJA 3VSVA 2VJIA 1LLWA 1O8GA 1PLUA 4V02C 4W8QA 1IA5A 2PECA 3NB2A 1O88A 3DU1X 4YZ0A 2QY1A 1QA3A 1OFLA 1QCXA 1WMRA 2BM6A 4YFOA 3SQVA 2O6WA 3VMWA 2O0WA 4Z05A 4YEIA 2B0RA 3N6ZA 1HG8A 1XG2A 2Z8GA 1QQ1A 1IDKA 1HF2A 4OJ5A 1O8IA 1K5CA 2BSPA 4XLEA 4OJPA 3LJYA 4XOTA 2XT4A 3BH7B 1TYVA 1OGMX 2UVEA 1IB4A 4NK8A 4YC5A 4XMYA 4YDTA 2VFNA 2VBKA 2QXZA 1PE9A 2X6XA 4XLCA 3VMVA 3WWGA 1KCDA 4XM3A 3GRHA 1DBOA 1TYXA 1X0CA 1QA1A 2ODLA 3PSSA 3VSTA 5C1CA 2NT6A 4YELA 2VFOA 3H09A 3B8YA 1QA2A 1GQ8A 4OJLA 3SZEA 2BX6A 4U4BA 1RMGA 1H80A 4YZQA 1O8LA 3JURA 1OOCA 5AMVA 3ZSCA 5JLVC 1EE6A 1TYUA 1RWRA 1JTAA 3BH6B 4URRA 3EQOA 4OZZA 1DBGA 1L1IA 1OFDA 2NTQA 4EW9A 1K8FA 1CLWA 4XORA 1AIRA 2BM4A 2NSTA 4XLHA 4W8RA 1O8HA 2NTBA 1EZGA 4OJ6A 4XQFA 3PETA 1OFEA 1O8DA 1OFMA 2XTXA 2VFMA 1QJVA 2INUA 2NSPA 3RIQA 2INVA 1BHEA 4OJOA 4NK6A 3VSUA 3TH0A 2PYGA 2BM7A 2XTWA 2NT9A 4YCQA 1IDJA 1KQ5A 1RU4A 1JRGA
chains in the Genus database with same CATH topology
2O04A 2VBEA 3FY3A 4XLFA 3B4NA 2X6YA 3ZPPA 1O8EA 4Z06A 4XNFA 2X85A 1O8MA 4XR6A 1O8KA 1PXZA 1O8FA 3GQ8A 4MXNA 4XOPA 4MR0A 2QX3A 4XKWA 2EWEA 3EQNA 4XN0A 2UVFA 3UW0A 3KRGA 2O17A 4I84A 4YZAA 3GQ9A 4YZXA 2VJJA 3B90A 5C1EA 4HWVA 2X6WA 4C2LA 4AVZA 1KTWA 4W8SA 2NTPA 2X3HA 4XONA 1O8JA 4Z03A 1OGOX 1VBLA 2O1DA 4OZYA 1NHCA 4W8TA 1KCCA 4XL9A 1CZFA 4XN3A 2NZMA 4PMHA 2VBMA 3SUCA 3T9GA 2O0VA 2PYHA 3GQ7A 3LMWA 4YEJA 4XLAA 4XKVA 2IQ7A 1BN8A 4U49A 3GQAA 3VSVA 2VJIA 1O8GA 1PLUA 4W8QA 1IA5A 2PECA 1O88A 4YZ0A 2QY1A 1OFLA 1QCXA 1WMRA 3VMWA 2O0WA 4Z05A 1HG8A 1XG2A 2Z8GA 1IDKA 1K5CA 4OJ5A 1O8IA 2BSPA 4XLEA 4OJPA 4XOTA 1OGMX 2UVEA 1IB4A 4NK8A 4XMYA 2VBKA 2QXZA 1PE9A 2X6XA 4XLCA 3VMVA 3WWGA 1KCDA 4XM3A 3GRHA 1DBOA 1X0CA 2ODLA 3VSTA 5C1CA 2NT6A 4YELA 3B8YA 1GQ8A 4OJLA 4U4BA 1RMGA 1H80A 4YZQA 1O8LA 3JURA 1OOCA 5AMVA 3ZSCA 1EE6A 1RWRA 1JTAA 4URRA 3EQOA 4OZZA 1DBGA 2NTQA 4XORA 1AIRA 2NSTA 4XLHA 4W8RA 1O8HA 2NTBA 4OJ6A 4XQFA 1O8DA 1OFMA 1QJVA 2INUA 2NSPA 2INVA 1BHEA 4OJOA 4NK6A 3VSUA 2PYGA 2NT9A 1IDJA 4EW9A 1RU4A 1JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  2VBE A;  3FY3 A;  4XLF A;  3B4N A;  2X6Y A;  3ZPP A;  1O8E A;  4Z06 A;  4XNF A;  2X85 A;  1O8M A;  4XR6 A;  1O8K A;  1PXZ A;  1O8F A;  3GQ8 A;  4MXN A;  4XOP A;  4MR0 A;  2QX3 A;  4XKW A;  2EWE A;  3EQN A;  4XN0 A;  2UVF A;  3UW0 A;  3KRG A;  2O17 A;  4I84 A;  4YZA A;  3GQ9 A;  4YZX A;  2VJJ A;  3B90 A;  5C1E A;  4HWV A;  2X6W A;  4C2L A;  4AVZ A;  1KTW A;  4W8S A;  2NTP A;  2X3H A;  4XON A;  1O8J A;  4Z03 A;  1OGO X;  1VBL A;  2O1D A;  4OZY A;  1NHC A;  4W8T A;  1KCC A;  4XL9 A;  1CZF A;  4XN3 A;  2NZM A;  4PMH A;  2VBM A;  3SUC A;  3T9G A;  2O0V A;  2PYH A;  3GQ7 A;  3LMW A;  4YEJ A;  4XLA A;  4XKV A;  2IQ7 A;  1BN8 A;  4U49 A;  3GQA A;  3VSV A;  2VJI A;  1O8G A;  1PLU A;  4W8Q A;  1IA5 A;  2PEC A;  1O88 A;  4YZ0 A;  2QY1 A;  1OFL A;  1QCX A;  1WMR A;  3VMW A;  2O0W A;  4Z05 A;  1HG8 A;  1XG2 A;  2Z8G A;  1IDK A;  1K5C A;  4OJ5 A;  1O8I A;  2BSP A;  4XLE A;  4OJP A;  4XOT A;  1OGM X;  2UVE A;  1IB4 A;  4NK8 A;  4XMY A;  2VBK A;  2QXZ A;  1PE9 A;  2X6X A;  4XLC A;  3VMV A;  3WWG A;  1KCD A;  4XM3 A;  3GRH A;  1DBO A;  1X0C A;  2ODL A;  3VST A;  5C1C A;  2NT6 A;  4YEL A;  3B8Y A;  1GQ8 A;  4OJL A;  4U4B A;  1RMG A;  1H80 A;  4YZQ A;  1O8L A;  3JUR A;  1OOC A;  5AMV A;  3ZSC A;  1EE6 A;  1RWR A;  1JTA A;  4URR A;  3EQO A;  4OZZ A;  1DBG A;  2NTQ A;  4XOR A;  1AIR A;  2NST A;  4XLH A;  4W8R A;  1O8H A;  2NTB A;  4OJ6 A;  4XQF A;  1O8D A;  1OFM A;  1QJV A;  2INU A;  2NSP A;  2INV A;  1BHE A;  4OJO A;  4NK6 A;  3VSU A;  2PYG A;  2NT9 A;  1IDJ A;  4EW9 A;  1RU4 A;  1JRG A; 
#chains in the Genus database with same CATH topology
 2O04 A;  2VBE A;  3FY3 A;  2W7Z A;  3N90 A;  3P4G A;  4XLF A;  3B4N A;  3SY2 A;  2X6Y A;  3ZPP A;  1O8E A;  4Z06 A;  4KH3 A;  4XNF A;  2X85 A;  1O8M A;  4XR6 A;  1O8K A;  1PXZ A;  1O8F A;  3GQ8 A;  4MXN A;  4XOP A;  4MR0 A;  2J8I A;  2QX3 A;  1QRC A;  2VFP A;  2XT2 A;  4XKW A;  2EWE A;  1LM1 A;  3EQN A;  2J8K A;  2F3L A;  2V5I A;  4OPW A;  4XN0 A;  2UVF A;  2QYU A;  5JMC B;  1TYW A;  3UW0 A;  3KRG A;  3JX8 A;  2O17 A;  4I84 A;  1QRB A;  4YZA A;  1LLZ A;  3GQ9 A;  4YZX A;  1EA0 A;  2VJJ A;  3B90 A;  5C1E A;  4HWV A;  2X6W A;  5DNS A;  3PSZ A;  3ML3 A;  4AVZ A;  4C2L A;  2YUH A;  1KTW A;  2BM5 A;  4JRA C;  4W8S A;  2NTP A;  2X3H A;  1WXR A;  1DAB A;  4XON A;  2XTY A;  1O8J A;  4Z03 A;  1OGO X;  1VBL A;  2O1D A;  2VFQ A;  2QZA A;  4OZY A;  1NHC A;  1TSP A;  4OM9 A;  4W8T A;  1KCC A;  4XL9 A;  1CZF A;  4XN3 A;  2NZM A;  4PMH A;  2G0Y A;  2VBM A;  2IOU G;  1K4Z A;  3SUC A;  3NAW A;  3T9G A;  3LYC A;  2O0V A;  2XC1 A;  2PYH A;  3AK5 A;  3GQ7 A;  3LMW A;  4YEJ A;  4XLA A;  4XKV A;  2IQ7 A;  1BN8 A;  4U49 A;  3GQA A;  3SYJ A;  3VSV A;  2VJI A;  1LLW A;  1O8G A;  1PLU A;  4V02 C;  4W8Q A;  1IA5 A;  2PEC A;  3NB2 A;  1O88 A;  3DU1 X;  4YZ0 A;  2QY1 A;  1QA3 A;  1OFL A;  1QCX A;  1WMR A;  2BM6 A;  4YFO A;  3SQV A;  2O6W A;  3VMW A;  2O0W A;  4Z05 A;  4YEI A;  2B0R A;  3N6Z A;  1HG8 A;  1XG2 A;  2Z8G A;  1QQ1 A;  1IDK A;  1HF2 A;  4OJ5 A;  1O8I A;  1K5C A;  2BSP A;  4XLE A;  4OJP A;  3LJY A;  4XOT A;  2XT4 A;  3BH7 B;  1TYV A;  1OGM X;  2UVE A;  1IB4 A;  4NK8 A;  4YC5 A;  4XMY A;  4YDT A;  2VFN A;  2VBK A;  2QXZ A;  1PE9 A;  2X6X A;  4XLC A;  3VMV A;  3WWG A;  1KCD A;  4XM3 A;  3GRH A;  1DBO A;  1TYX A;  1X0C A;  1QA1 A;  2ODL A;  3PSS A;  3VST A;  5C1C A;  2NT6 A;  4YEL A;  2VFO A;  3H09 A;  3B8Y A;  1QA2 A;  1GQ8 A;  4OJL A;  3SZE A;  2BX6 A;  4U4B A;  1RMG A;  1H80 A;  4YZQ A;  1O8L A;  3JUR A;  1OOC A;  5AMV A;  3ZSC A;  5JLV C;  1EE6 A;  1TYU A;  1RWR A;  1JTA A;  3BH6 B;  4URR A;  3EQO A;  4OZZ A;  1DBG A;  1L1I A;  1OFD A;  2NTQ A;  4EW9 A;  1K8F A;  1CLW A;  4XOR A;  1AIR A;  2BM4 A;  2NST A;  4XLH A;  4W8R A;  1O8H A;  2NTB A;  1EZG A;  4OJ6 A;  4XQF A;  3PET A;  1OFE A;  1O8D A;  1OFM A;  2XTX A;  2VFM A;  1QJV A;  2INU A;  2NSP A;  3RIQ A;  2INV A;  1BHE A;  4OJO A;  4NK6 A;  3VSU A;  3TH0 A;  2PYG A;  2BM7 A;  2XTW A;  2NT9 A;  4YCQ A;  1IDJ A;  1KQ5 A;  1RU4 A;  1JRG A; 
#chains in the Genus database with same CATH homology
 2O04 A;  2VBE A;  3FY3 A;  4XLF A;  3B4N A;  2X6Y A;  3ZPP A;  1O8E A;  4Z06 A;  4XNF A;  2X85 A;  1O8M A;  4XR6 A;  1O8K A;  1PXZ A;  1O8F A;  3GQ8 A;  4MXN A;  4XOP A;  4MR0 A;  2QX3 A;  4XKW A;  2EWE A;  3EQN A;  4XN0 A;  2UVF A;  3UW0 A;  3KRG A;  2O17 A;  4I84 A;  4YZA A;  3GQ9 A;  4YZX A;  2VJJ A;  3B90 A;  5C1E A;  4HWV A;  2X6W A;  4C2L A;  4AVZ A;  1KTW A;  4W8S A;  2NTP A;  2X3H A;  4XON A;  1O8J A;  4Z03 A;  1OGO X;  1VBL A;  2O1D A;  4OZY A;  1NHC A;  4W8T A;  1KCC A;  4XL9 A;  1CZF A;  4XN3 A;  2NZM A;  4PMH A;  2VBM A;  3SUC A;  3T9G A;  2O0V A;  2PYH A;  3GQ7 A;  3LMW A;  4YEJ A;  4XLA A;  4XKV A;  2IQ7 A;  1BN8 A;  4U49 A;  3GQA A;  3VSV A;  2VJI A;  1O8G A;  1PLU A;  4W8Q A;  1IA5 A;  2PEC A;  1O88 A;  4YZ0 A;  2QY1 A;  1OFL A;  1QCX A;  1WMR A;  3VMW A;  2O0W A;  4Z05 A;  1HG8 A;  1XG2 A;  2Z8G A;  1IDK A;  1K5C A;  4OJ5 A;  1O8I A;  2BSP A;  4XLE A;  4OJP A;  4XOT A;  1OGM X;  2UVE A;  1IB4 A;  4NK8 A;  4XMY A;  2VBK A;  2QXZ A;  1PE9 A;  2X6X A;  4XLC A;  3VMV A;  3WWG A;  1KCD A;  4XM3 A;  3GRH A;  1DBO A;  1X0C A;  2ODL A;  3VST A;  5C1C A;  2NT6 A;  4YEL A;  3B8Y A;  1GQ8 A;  4OJL A;  4U4B A;  1RMG A;  1H80 A;  4YZQ A;  1O8L A;  3JUR A;  1OOC A;  5AMV A;  3ZSC A;  1EE6 A;  1RWR A;  1JTA A;  4URR A;  3EQO A;  4OZZ A;  1DBG A;  2NTQ A;  4XOR A;  1AIR A;  2NST A;  4XLH A;  4W8R A;  1O8H A;  2NTB A;  4OJ6 A;  4XQF A;  1O8D A;  1OFM A;  1QJV A;  2INU A;  2NSP A;  2INV A;  1BHE A;  4OJO A;  4NK6 A;  3VSU A;  2PYG A;  2NT9 A;  1IDJ A;  4EW9 A;  1RU4 A;  1JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...