1O8HA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 0.3mm ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8hA00
1O8DA 4MXNA 1OOCA 2PYHA 4OJOA 4MR0A 1O88A 1IDJA 1RU4A 2X6WA 4OJ5A 4C2LA 1BN8A 1PLUA 4Z05A 1EE6A 3KRGA 4XN3A 3B8YA 2EWEA 1KTWA 4HWVA 4W8RA 4EW9A 1O8FA 1IDKA 2INVA 4XOPA 4YZ0A 4XL9A 1DBGA 4URRA 2BSPA 2O0WA 4W8TA 4Z03A 4NK8A 4AVZA 1KCDA 4YZXA 3GRHA 2Z8GA 1HG8A 2NZMA 4OJPA 4YZQA 4XLEA 3VSUA 1RMGA 2UVFA 1O8LA 3GQ7A 4PMHA 4XOTA 3JURA 3WWGA 4Z06A 4XMYA 3VMWA 1PE9A 4XR6A 4XKWA 3ZPPA 1O8MA 2X85A 4OJ6A 1NHCA 2VBKA 2ODLA 4XONA 2VJJA 1XG2A 3GQ9A 4OJLA 1JTAA 2PYGA 5C1CA 1IB4A 4XNFA 4XORA 1OGOX 3B90A 1GQ8A 1KCCA 1H80A 1WMRA 3GQAA 1X0CA 1QJVA 4XM3A 2O0VA 4NK6A 4W8SA 1O8HA 2NTQA 1O8GA 4U49A 3VMVA 4W8QA 2O1DA 3EQOA 1O8JA 3B4NA 2NTPA 4OZYA 1CZFA 1OFLA 2QX3A 4YEJA 3GQ8A 4XQFA 1QCXA 3EQNA 1OGMX 3VSTA 2NT6A 4XLFA 2IQ7A 3UW0A 2X6YA 2VJIA 1OFMA 4U4BA 1VBLA 2NSTA 2VBEA 4XLCA 2NTBA 2O17A 1O8EA 2O04A 2X3HA 1K5CA 2NT9A 3SUCA 4XKVA 4OZZA 2NSPA 3VSVA 2QY1A 5AMVA 3FY3A 4XLAA 3T9GA 4I84A 3LMWA 4XLHA 4XN0A 1DBOA 2PECA 2UVEA 1JRGA 2QXZA 1O8KA 1IA5A 3ZSCA 1BHEA 1PXZA 2INUA 4YZAA 1AIRA 1O8IA 1RWRA 4YELA 2X6XA 5C1EA 2VBMA
chains in the Genus database with same CATH superfamily
1O8DA 4MXNA 1OOCA 1TYVA 2PYHA 4OJOA 4MR0A 3SZEA 1O88A 1IDJA 1RU4A 2X6WA 3LYCA 4OJ5A 1BN8A 4C2LA 1PLUA 4Z05A 1EE6A 3KRGA 4XN3A 3B8YA 2XTXA 2EWEA 1KTWA 3PSZA 4HWVA 4W8RA 4EW9A 1O8FA 1IDKA 2INVA 2VFOA 4XOPA 4YZ0A 4XL9A 1DBGA 1LLWA 2BSPA 4URRA 1KQ5A 2O0WA 4W8TA 4NK8A 4Z03A 4AVZA 1KCDA 4YZXA 3GRHA 2Z8GA 2J8KA 4YDTA 1K8FA 1HG8A 2NZMA 4OJPA 2YUHA 4YZQA 3ML3A 4XLEA 3VSUA 3PSSA 1RMGA 2UVFA 1O8LA 3GQ7A 2O6WA 3N6ZA 2VFPA 1L1IA 4PMHA 1WXRA 4XOTA 3JURA 2BX6A 2J8IA 1HF2A 4Z06A 2XTYA 4XMYA 3WWGA 2VFNA 3VMWA 1LLZA 2BM7A 1PE9A 3N90A 4XR6A 1QQ1A 4XKWA 1O8MA 3ZPPA 3DU1X 2X85A 4OJ6A 1NHCA 2VBKA 2ODLA 4XONA 2VJJA 3JX8A 1CLWA 1XG2A 2BM6A 3GQ9A 2F3LA 2W7ZA 3RIQA 4OJLA 3NAWA 1QRCA 1JTAA 2PYGA 5C1CA 1IB4A 5JMCB 2XT4A 4XNFA 4XORA 3BH6B 4JRAC 1OFEA 1OGOX 3B90A 5JLVC 3SQVA 1GQ8A 1KCCA 4OPWA 1H80A 1WMRA 1OFDA 1TSPA 2XC1A 3H09A 1QA1A 3GQAA 1QRBA 2QYUA 1X0CA 2XT2A 1QJVA 4XM3A 2O0VA 4NK6A 4W8SA 1O8HA 2NTQA 2V5IA 1O8GA 2VBMA 4U49A 3VMVA 4W8QA 2O1DA 3EQOA 1O8JA 3B4NA 2NTPA 4OZYA 1CZFA 1OFLA 2QZAA 2QX3A 3NB2A 4YEJA 2VFQA 3GQ8A 4XQFA 1QCXA 2BM4A 3EQNA 1OGMX 4YCQA 2NT6A 3VSTA 4XLFA 1K4ZA 2IQ7A 1LM1A 2IOUG 3TH0A 3UW0A 2X6YA 2VJIA 3PETA 1OFMA 4U4BA 1VBLA 2NSTA 2VBEA 4XLCA 4V02C 5DNSA 1QA2A 4YFOA 2O17A 1O8EA 2O04A 2X3HA 3SY2A 3SYJA 1K5CA 2NT9A 3SUCA 4XKVA 4KH3A 4OZZA 2NSPA 3BH7B 3VSVA 2QY1A 5AMVA 3FY3A 3AK5A 4YEIA 4XLAA 1QA3A 1TYUA 3T9GA 1TYWA 1EA0A 4I84A 3LMWA 4XLHA 4XN0A 2XTWA 3LJYA 1DBOA 2PECA 2UVEA 1JRGA 4YC5A 2QXZA 2G0YA 1O8KA 1IA5A 2VFMA 3P4GA 3ZSCA 1BHEA 1TYXA 1PXZA 2INUA 4YZAA 2B0RA 1AIRA 1EZGA 2BM5A 1O8IA 1RWRA 4OM9A 4YELA 1DABA 2X6XA 5C1EA 2NTBA
chains in the Genus database with same CATH topology
1O8DA 4MXNA 1OOCA 2PYHA 4OJOA 4MR0A 1O88A 1IDJA 1RU4A 2X6WA 4OJ5A 4C2LA 1BN8A 1PLUA 4Z05A 1EE6A 3KRGA 4XN3A 3B8YA 2EWEA 1KTWA 4HWVA 4W8RA 4EW9A 1O8FA 1IDKA 2INVA 4XOPA 4YZ0A 4XL9A 1DBGA 4URRA 2BSPA 2O0WA 4W8TA 4Z03A 4NK8A 4AVZA 1KCDA 4YZXA 3GRHA 2Z8GA 1HG8A 2NZMA 4OJPA 4YZQA 4XLEA 3VSUA 1RMGA 2UVFA 1O8LA 3GQ7A 4PMHA 4XOTA 3JURA 3WWGA 4Z06A 4XMYA 3VMWA 1PE9A 4XR6A 4XKWA 3ZPPA 1O8MA 2X85A 4OJ6A 1NHCA 2VBKA 2ODLA 4XONA 2VJJA 1XG2A 3GQ9A 4OJLA 1JTAA 2PYGA 5C1CA 1IB4A 4XNFA 4XORA 1OGOX 3B90A 1GQ8A 1KCCA 1H80A 1WMRA 3GQAA 1X0CA 1QJVA 4XM3A 2O0VA 4NK6A 4W8SA 1O8HA 2NTQA 1O8GA 4U49A 3VMVA 4W8QA 2O1DA 3EQOA 1O8JA 3B4NA 2NTPA 4OZYA 1CZFA 1OFLA 2QX3A 4YEJA 3GQ8A 4XQFA 1QCXA 3EQNA 1OGMX 3VSTA 2NT6A 4XLFA 2IQ7A 3UW0A 2X6YA 2VJIA 1OFMA 4U4BA 1VBLA 2NSTA 2VBEA 4XLCA 2NTBA 2O17A 1O8EA 2O04A 2X3HA 1K5CA 2NT9A 3SUCA 4XKVA 4OZZA 2NSPA 3VSVA 2QY1A 5AMVA 3FY3A 4XLAA 3T9GA 4I84A 3LMWA 4XLHA 4XN0A 1DBOA 2PECA 2UVEA 1JRGA 2QXZA 1O8KA 1IA5A 3ZSCA 1BHEA 1PXZA 2INUA 4YZAA 1AIRA 1O8IA 1RWRA 4YELA 2X6XA 5C1EA 2VBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8D A;  4MXN A;  1OOC A;  2PYH A;  4OJO A;  4MR0 A;  1O88 A;  1IDJ A;  1RU4 A;  2X6W A;  4OJ5 A;  4C2L A;  1BN8 A;  1PLU A;  4Z05 A;  1EE6 A;  3KRG A;  4XN3 A;  3B8Y A;  2EWE A;  1KTW A;  4HWV A;  4W8R A;  4EW9 A;  1O8F A;  1IDK A;  2INV A;  4XOP A;  4YZ0 A;  4XL9 A;  1DBG A;  4URR A;  2BSP A;  2O0W A;  4W8T A;  4Z03 A;  4NK8 A;  4AVZ A;  1KCD A;  4YZX A;  3GRH A;  2Z8G A;  1HG8 A;  2NZM A;  4OJP A;  4YZQ A;  4XLE A;  3VSU A;  1RMG A;  2UVF A;  1O8L A;  3GQ7 A;  4PMH A;  4XOT A;  3JUR A;  3WWG A;  4Z06 A;  4XMY A;  3VMW A;  1PE9 A;  4XR6 A;  4XKW A;  3ZPP A;  1O8M A;  2X85 A;  4OJ6 A;  1NHC A;  2VBK A;  2ODL A;  4XON A;  2VJJ A;  1XG2 A;  3GQ9 A;  4OJL A;  1JTA A;  2PYG A;  5C1C A;  1IB4 A;  4XNF A;  4XOR A;  1OGO X;  3B90 A;  1GQ8 A;  1KCC A;  1H80 A;  1WMR A;  3GQA A;  1X0C A;  1QJV A;  4XM3 A;  2O0V A;  4NK6 A;  4W8S A;  1O8H A;  2NTQ A;  1O8G A;  4U49 A;  3VMV A;  4W8Q A;  2O1D A;  3EQO A;  1O8J A;  3B4N A;  2NTP A;  4OZY A;  1CZF A;  1OFL A;  2QX3 A;  4YEJ A;  3GQ8 A;  4XQF A;  1QCX A;  3EQN A;  1OGM X;  3VST A;  2NT6 A;  4XLF A;  2IQ7 A;  3UW0 A;  2X6Y A;  2VJI A;  1OFM A;  4U4B A;  1VBL A;  2NST A;  2VBE A;  4XLC A;  2NTB A;  2O17 A;  1O8E A;  2O04 A;  2X3H A;  1K5C A;  2NT9 A;  3SUC A;  4XKV A;  4OZZ A;  2NSP A;  3VSV A;  2QY1 A;  5AMV A;  3FY3 A;  4XLA A;  3T9G A;  4I84 A;  3LMW A;  4XLH A;  4XN0 A;  1DBO A;  2PEC A;  2UVE A;  1JRG A;  2QXZ A;  1O8K A;  1IA5 A;  3ZSC A;  1BHE A;  1PXZ A;  2INU A;  4YZA A;  1AIR A;  1O8I A;  1RWR A;  4YEL A;  2X6X A;  5C1E A;  2VBM A; 
#chains in the Genus database with same CATH topology
 1O8D A;  4MXN A;  1OOC A;  1TYV A;  2PYH A;  4OJO A;  4MR0 A;  3SZE A;  1O88 A;  1IDJ A;  1RU4 A;  2X6W A;  3LYC A;  4OJ5 A;  1BN8 A;  4C2L A;  1PLU A;  4Z05 A;  1EE6 A;  3KRG A;  4XN3 A;  3B8Y A;  2XTX A;  2EWE A;  1KTW A;  3PSZ A;  4HWV A;  4W8R A;  4EW9 A;  1O8F A;  1IDK A;  2INV A;  2VFO A;  4XOP A;  4YZ0 A;  4XL9 A;  1DBG A;  1LLW A;  2BSP A;  4URR A;  1KQ5 A;  2O0W A;  4W8T A;  4NK8 A;  4Z03 A;  4AVZ A;  1KCD A;  4YZX A;  3GRH A;  2Z8G A;  2J8K A;  4YDT A;  1K8F A;  1HG8 A;  2NZM A;  4OJP A;  2YUH A;  4YZQ A;  3ML3 A;  4XLE A;  3VSU A;  3PSS A;  1RMG A;  2UVF A;  1O8L A;  3GQ7 A;  2O6W A;  3N6Z A;  2VFP A;  1L1I A;  4PMH A;  1WXR A;  4XOT A;  3JUR A;  2BX6 A;  2J8I A;  1HF2 A;  4Z06 A;  2XTY A;  4XMY A;  3WWG A;  2VFN A;  3VMW A;  1LLZ A;  2BM7 A;  1PE9 A;  3N90 A;  4XR6 A;  1QQ1 A;  4XKW A;  1O8M A;  3ZPP A;  3DU1 X;  2X85 A;  4OJ6 A;  1NHC A;  2VBK A;  2ODL A;  4XON A;  2VJJ A;  3JX8 A;  1CLW A;  1XG2 A;  2BM6 A;  3GQ9 A;  2F3L A;  2W7Z A;  3RIQ A;  4OJL A;  3NAW A;  1QRC A;  1JTA A;  2PYG A;  5C1C A;  1IB4 A;  5JMC B;  2XT4 A;  4XNF A;  4XOR A;  3BH6 B;  4JRA C;  1OFE A;  1OGO X;  3B90 A;  5JLV C;  3SQV A;  1GQ8 A;  1KCC A;  4OPW A;  1H80 A;  1WMR A;  1OFD A;  1TSP A;  2XC1 A;  3H09 A;  1QA1 A;  3GQA A;  1QRB A;  2QYU A;  1X0C A;  2XT2 A;  1QJV A;  4XM3 A;  2O0V A;  4NK6 A;  4W8S A;  1O8H A;  2NTQ A;  2V5I A;  1O8G A;  2VBM A;  4U49 A;  3VMV A;  4W8Q A;  2O1D A;  3EQO A;  1O8J A;  3B4N A;  2NTP A;  4OZY A;  1CZF A;  1OFL A;  2QZA A;  2QX3 A;  3NB2 A;  4YEJ A;  2VFQ A;  3GQ8 A;  4XQF A;  1QCX A;  2BM4 A;  3EQN A;  1OGM X;  4YCQ A;  2NT6 A;  3VST A;  4XLF A;  1K4Z A;  2IQ7 A;  1LM1 A;  2IOU G;  3TH0 A;  3UW0 A;  2X6Y A;  2VJI A;  3PET A;  1OFM A;  4U4B A;  1VBL A;  2NST A;  2VBE A;  4XLC A;  4V02 C;  5DNS A;  1QA2 A;  4YFO A;  2O17 A;  1O8E A;  2O04 A;  2X3H A;  3SY2 A;  3SYJ A;  1K5C A;  2NT9 A;  3SUC A;  4XKV A;  4KH3 A;  4OZZ A;  2NSP A;  3BH7 B;  3VSV A;  2QY1 A;  5AMV A;  3FY3 A;  3AK5 A;  4YEI A;  4XLA A;  1QA3 A;  1TYU A;  3T9G A;  1TYW A;  1EA0 A;  4I84 A;  3LMW A;  4XLH A;  4XN0 A;  2XTW A;  3LJY A;  1DBO A;  2PEC A;  2UVE A;  1JRG A;  4YC5 A;  2QXZ A;  2G0Y A;  1O8K A;  1IA5 A;  2VFM A;  3P4G A;  3ZSC A;  1BHE A;  1TYX A;  1PXZ A;  2INU A;  4YZA A;  2B0R A;  1AIR A;  1EZG A;  2BM5 A;  1O8I A;  1RWR A;  4OM9 A;  4YEL A;  1DAB A;  2X6X A;  5C1E A;  2NTB A; 
#chains in the Genus database with same CATH homology
 1O8D A;  4MXN A;  1OOC A;  2PYH A;  4OJO A;  4MR0 A;  1O88 A;  1IDJ A;  1RU4 A;  2X6W A;  4OJ5 A;  4C2L A;  1BN8 A;  1PLU A;  4Z05 A;  1EE6 A;  3KRG A;  4XN3 A;  3B8Y A;  2EWE A;  1KTW A;  4HWV A;  4W8R A;  4EW9 A;  1O8F A;  1IDK A;  2INV A;  4XOP A;  4YZ0 A;  4XL9 A;  1DBG A;  4URR A;  2BSP A;  2O0W A;  4W8T A;  4Z03 A;  4NK8 A;  4AVZ A;  1KCD A;  4YZX A;  3GRH A;  2Z8G A;  1HG8 A;  2NZM A;  4OJP A;  4YZQ A;  4XLE A;  3VSU A;  1RMG A;  2UVF A;  1O8L A;  3GQ7 A;  4PMH A;  4XOT A;  3JUR A;  3WWG A;  4Z06 A;  4XMY A;  3VMW A;  1PE9 A;  4XR6 A;  4XKW A;  3ZPP A;  1O8M A;  2X85 A;  4OJ6 A;  1NHC A;  2VBK A;  2ODL A;  4XON A;  2VJJ A;  1XG2 A;  3GQ9 A;  4OJL A;  1JTA A;  2PYG A;  5C1C A;  1IB4 A;  4XNF A;  4XOR A;  1OGO X;  3B90 A;  1GQ8 A;  1KCC A;  1H80 A;  1WMR A;  3GQA A;  1X0C A;  1QJV A;  4XM3 A;  2O0V A;  4NK6 A;  4W8S A;  1O8H A;  2NTQ A;  1O8G A;  4U49 A;  3VMV A;  4W8Q A;  2O1D A;  3EQO A;  1O8J A;  3B4N A;  2NTP A;  4OZY A;  1CZF A;  1OFL A;  2QX3 A;  4YEJ A;  3GQ8 A;  4XQF A;  1QCX A;  3EQN A;  1OGM X;  3VST A;  2NT6 A;  4XLF A;  2IQ7 A;  3UW0 A;  2X6Y A;  2VJI A;  1OFM A;  4U4B A;  1VBL A;  2NST A;  2VBE A;  4XLC A;  2NTB A;  2O17 A;  1O8E A;  2O04 A;  2X3H A;  1K5C A;  2NT9 A;  3SUC A;  4XKV A;  4OZZ A;  2NSP A;  3VSV A;  2QY1 A;  5AMV A;  3FY3 A;  4XLA A;  3T9G A;  4I84 A;  3LMW A;  4XLH A;  4XN0 A;  1DBO A;  2PEC A;  2UVE A;  1JRG A;  2QXZ A;  1O8K A;  1IA5 A;  3ZSC A;  1BHE A;  1PXZ A;  2INU A;  4YZA A;  1AIR A;  1O8I A;  1RWR A;  4YEL A;  2X6X A;  5C1E A;  2VBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...