4Z03A

C. bescii family 3 pectate lyase double mutant k108a in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 85
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z03A00
3GQ8A 2INUA 2X85A 2VBKA 2NSTA 2X3HA 3T9GA 3UW0A 3VSUA 4NK6A 1OOCA 4XLAA 1O8FA 3EQNA 1PXZA 3SUCA 2NT6A 4XLCA 1OFLA 4W8TA 1GQ8A 4XN0A 5C1CA 1KCDA 2QX3A 4XM3A 1O8HA 4XR6A 2VJIA 3GQ9A 4W8SA 4OZYA 2NTBA 4XMYA 1JTAA 2EWEA 1BN8A 4XORA 2NT9A 2NTPA 4XLHA 1RMGA 3GRHA 3ZPPA 2VBMA 1AIRA 1IDKA 2NZMA 4OJLA 1WMRA 1IA5A 1OGMX 1IDJA 3KRGA 4YEJA 1O88A 2O0WA 2VBEA 4XKVA 1PLUA 4YZ0A 2ODLA 1RWRA 1O8KA 4NK8A 1PE9A 2PECA 4XOPA 1O8IA 4PMHA 3EQOA 4XLEA 4MXNA 1VBLA 2PYGA 2Z8GA 3B4NA 1RU4A 4Z05A 3GQ7A 4OJ5A 1O8JA 1DBGA 3VSVA 2X6XA 3VMWA 4EW9A 4Z06A 4XQFA 4U4BA 2X6YA 1X0CA 1O8DA 1O8MA 1OGOX 2PYHA 4XOTA 3VMVA 4W8RA 2O0VA 4XNFA 5C1EA 1CZFA 2NSPA 4YZQA 4C2LA 2UVEA 4OJOA 4XLFA 1K5CA 4W8QA 2BSPA 3GQAA 4I84A 3B8YA 2IQ7A 4OZZA 1BHEA 1QCXA 3FY3A 1XG2A 1HG8A 2X6WA 4YELA 3B90A 4Z03A 1EE6A 1O8EA 3VSTA 4OJ6A 3WWGA 4MR0A 4URRA 5AMVA 1O8GA 3ZSCA 1KCCA 1NHCA 3LMWA 4AVZA 2O04A 2INVA 2QXZA 2QY1A 4XL9A 2VJJA 4XKWA 4XN3A 1H80A 1QJVA 1JRGA 1OFMA 1IB4A 4YZAA 1KTWA 1DBOA 2NTQA 4OJPA 2O1DA 2O17A 1O8LA 4U49A 4XONA 4YZXA 4HWVA 2UVFA 3JURA
chains in the Genus database with same CATH superfamily
2V5IA 2XT4A 3GQ8A 1KQ5A 2INUA 2X85A 2VBKA 2NSTA 2X3HA 3T9GA 2BM6A 3UW0A 2O6WA 1QRBA 1HF2A 3H09A 3VSUA 1L1IA 4NK6A 2BM4A 1OOCA 4YFOA 4XLAA 1O8FA 3EQNA 1PXZA 3SUCA 2NT6A 4XLCA 1OFLA 4W8TA 1GQ8A 2XT2A 2VFMA 3JX8A 4OPWA 2IOUG 1CLWA 2QX3A 4XN0A 5C1CA 4XM3A 1KCDA 1O8HA 4XR6A 2VJIA 3GQ9A 4W8SA 4OZYA 1QA3A 4KH3A 2NTBA 1LLZA 4XMYA 4YDTA 1LLWA 1JTAA 2EWEA 1BN8A 4XORA 2NT9A 2QYUA 3NB2A 3LYCA 2NTPA 4XLHA 1RMGA 3GRHA 1TYVA 2G0YA 3ZPPA 2VBMA 1AIRA 1IDKA 2NZMA 2VFPA 4OJLA 1WMRA 1IA5A 1OGMX 1IDJA 3KRGA 4V02C 1O88A 4YEJA 2O0WA 2VBEA 4XKVA 1PLUA 4YZ0A 2BM7A 2ODLA 1RWRA 3BH7B 1O8KA 1TSPA 2B0RA 4NK8A 1PE9A 2PECA 2VFOA 4XOPA 1O8IA 3DU1X 4PMHA 3EQOA 4XLEA 1K4ZA 3NAWA 3PSSA 4MXNA 1VBLA 2PYGA 2Z8GA 3PETA 3B4NA 2YUHA 3RIQA 1RU4A 4Z05A 3GQ7A 4OJ5A 1EZGA 1O8JA 1DBGA 2VFNA 3P4GA 3SZEA 3VSVA 3PSZA 2X6XA 3VMWA 4EW9A 2W7ZA 4Z06A 4XQFA 1TYUA 1QQ1A 4U4BA 2X6YA 1OFDA 3ML3A 1X0CA 1O8DA 1O8MA 1OGOX 1OFEA 2PYHA 4XOTA 2J8IA 4W8RA 2O0VA 4XNFA 3VMVA 5C1EA 1CZFA 2NSPA 4YZQA 2VFQA 3SY2A 2UVEA 4C2LA 1QA2A 2XTWA 4OJOA 4XLFA 1QA1A 1WXRA 1K5CA 4W8QA 3LJYA 1EA0A 1DABA 2BSPA 3GQAA 4I84A 3B8YA 2IQ7A 4JRAC 1BHEA 4OZZA 1QCXA 3FY3A 1QRCA 1XG2A 1HG8A 2X6WA 4YELA 3B90A 1LM1A 4YEIA 4Z03A 1EE6A 1K8FA 1O8EA 3VSTA 2BM5A 3N90A 4OJ6A 3WWGA 4MR0A 4URRA 5AMVA 1O8GA 2XTXA 3ZSCA 1KCCA 1NHCA 5JLVC 3LMWA 4AVZA 2BX6A 2O04A 3BH6B 5JMCB 1TYXA 2INVA 2QXZA 2QY1A 4OM9A 4XL9A 2VJJA 2F3LA 4XKWA 4XN3A 2XC1A 3AK5A 1H80A 1QJVA 4YC5A 1JRGA 1OFMA 1IB4A 4YZAA 1KTWA 1DBOA 1TYWA 2NTQA 2QZAA 4OJPA 2XTYA 3SYJA 2J8KA 2O1DA 3TH0A 2O17A 1O8LA 4U49A 3N6ZA 4XONA 5DNSA 3SQVA 4YZXA 4HWVA 2UVFA 4YCQA 3JURA
chains in the Genus database with same CATH topology
3GQ8A 2INUA 2X85A 2VBKA 2NSTA 2X3HA 3T9GA 3UW0A 3VSUA 4NK6A 1OOCA 4XLAA 1O8FA 3EQNA 1PXZA 3SUCA 2NT6A 4XLCA 1OFLA 4W8TA 1GQ8A 4XN0A 5C1CA 1KCDA 2QX3A 4XM3A 1O8HA 4XR6A 2VJIA 3GQ9A 4W8SA 4OZYA 2NTBA 4XMYA 1JTAA 2EWEA 1BN8A 4XORA 2NT9A 2NTPA 4XLHA 1RMGA 3GRHA 3ZPPA 2VBMA 1AIRA 1IDKA 2NZMA 4OJLA 1WMRA 1IA5A 1OGMX 1IDJA 3KRGA 4YEJA 1O88A 2O0WA 2VBEA 4XKVA 1PLUA 4YZ0A 2ODLA 1RWRA 1O8KA 4NK8A 1PE9A 2PECA 4XOPA 1O8IA 4PMHA 3EQOA 4XLEA 4MXNA 1VBLA 2PYGA 2Z8GA 3B4NA 1RU4A 4Z05A 3GQ7A 4OJ5A 1O8JA 1DBGA 3VSVA 2X6XA 3VMWA 4EW9A 4Z06A 4XQFA 4U4BA 2X6YA 1X0CA 1O8DA 1O8MA 1OGOX 2PYHA 4XOTA 3VMVA 4W8RA 2O0VA 4XNFA 5C1EA 1CZFA 2NSPA 4YZQA 4C2LA 2UVEA 4OJOA 4XLFA 1K5CA 4W8QA 2BSPA 3GQAA 4I84A 3B8YA 2IQ7A 4OZZA 1BHEA 1QCXA 3FY3A 1XG2A 1HG8A 2X6WA 4YELA 3B90A 4Z03A 1EE6A 1O8EA 3VSTA 4OJ6A 3WWGA 4MR0A 4URRA 5AMVA 1O8GA 3ZSCA 1KCCA 1NHCA 3LMWA 4AVZA 2O04A 2INVA 2QXZA 2QY1A 4XL9A 2VJJA 4XKWA 4XN3A 1H80A 1QJVA 1JRGA 1OFMA 1IB4A 4YZAA 1KTWA 1DBOA 2NTQA 4OJPA 2O1DA 2O17A 1O8LA 4U49A 4XONA 4YZXA 4HWVA 2UVFA 3JURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ8 A;  2INU A;  2X85 A;  2VBK A;  2NST A;  2X3H A;  3T9G A;  3UW0 A;  3VSU A;  4NK6 A;  1OOC A;  4XLA A;  1O8F A;  3EQN A;  1PXZ A;  3SUC A;  2NT6 A;  4XLC A;  1OFL A;  4W8T A;  1GQ8 A;  4XN0 A;  5C1C A;  1KCD A;  2QX3 A;  4XM3 A;  1O8H A;  4XR6 A;  2VJI A;  3GQ9 A;  4W8S A;  4OZY A;  2NTB A;  4XMY A;  1JTA A;  2EWE A;  1BN8 A;  4XOR A;  2NT9 A;  2NTP A;  4XLH A;  1RMG A;  3GRH A;  3ZPP A;  2VBM A;  1AIR A;  1IDK A;  2NZM A;  4OJL A;  1WMR A;  1IA5 A;  1OGM X;  1IDJ A;  3KRG A;  4YEJ A;  1O88 A;  2O0W A;  2VBE A;  4XKV A;  1PLU A;  4YZ0 A;  2ODL A;  1RWR A;  1O8K A;  4NK8 A;  1PE9 A;  2PEC A;  4XOP A;  1O8I A;  4PMH A;  3EQO A;  4XLE A;  4MXN A;  1VBL A;  2PYG A;  2Z8G A;  3B4N A;  1RU4 A;  4Z05 A;  3GQ7 A;  4OJ5 A;  1O8J A;  1DBG A;  3VSV A;  2X6X A;  3VMW A;  4EW9 A;  4Z06 A;  4XQF A;  4U4B A;  2X6Y A;  1X0C A;  1O8D A;  1O8M A;  1OGO X;  2PYH A;  4XOT A;  3VMV A;  4W8R A;  2O0V A;  4XNF A;  5C1E A;  1CZF A;  2NSP A;  4YZQ A;  4C2L A;  2UVE A;  4OJO A;  4XLF A;  1K5C A;  4W8Q A;  2BSP A;  3GQA A;  4I84 A;  3B8Y A;  2IQ7 A;  4OZZ A;  1BHE A;  1QCX A;  3FY3 A;  1XG2 A;  1HG8 A;  2X6W A;  4YEL A;  3B90 A;  4Z03 A;  1EE6 A;  1O8E A;  3VST A;  4OJ6 A;  3WWG A;  4MR0 A;  4URR A;  5AMV A;  1O8G A;  3ZSC A;  1KCC A;  1NHC A;  3LMW A;  4AVZ A;  2O04 A;  2INV A;  2QXZ A;  2QY1 A;  4XL9 A;  2VJJ A;  4XKW A;  4XN3 A;  1H80 A;  1QJV A;  1JRG A;  1OFM A;  1IB4 A;  4YZA A;  1KTW A;  1DBO A;  2NTQ A;  4OJP A;  2O1D A;  2O17 A;  1O8L A;  4U49 A;  4XON A;  4YZX A;  4HWV A;  2UVF A;  3JUR A; 
#chains in the Genus database with same CATH topology
 2V5I A;  2XT4 A;  3GQ8 A;  1KQ5 A;  2INU A;  2X85 A;  2VBK A;  2NST A;  2X3H A;  3T9G A;  2BM6 A;  3UW0 A;  2O6W A;  1QRB A;  1HF2 A;  3H09 A;  3VSU A;  1L1I A;  4NK6 A;  2BM4 A;  1OOC A;  4YFO A;  4XLA A;  1O8F A;  3EQN A;  1PXZ A;  3SUC A;  2NT6 A;  4XLC A;  1OFL A;  4W8T A;  1GQ8 A;  2XT2 A;  2VFM A;  3JX8 A;  4OPW A;  2IOU G;  1CLW A;  2QX3 A;  4XN0 A;  5C1C A;  4XM3 A;  1KCD A;  1O8H A;  4XR6 A;  2VJI A;  3GQ9 A;  4W8S A;  4OZY A;  1QA3 A;  4KH3 A;  2NTB A;  1LLZ A;  4XMY A;  4YDT A;  1LLW A;  1JTA A;  2EWE A;  1BN8 A;  4XOR A;  2NT9 A;  2QYU A;  3NB2 A;  3LYC A;  2NTP A;  4XLH A;  1RMG A;  3GRH A;  1TYV A;  2G0Y A;  3ZPP A;  2VBM A;  1AIR A;  1IDK A;  2NZM A;  2VFP A;  4OJL A;  1WMR A;  1IA5 A;  1OGM X;  1IDJ A;  3KRG A;  4V02 C;  1O88 A;  4YEJ A;  2O0W A;  2VBE A;  4XKV A;  1PLU A;  4YZ0 A;  2BM7 A;  2ODL A;  1RWR A;  3BH7 B;  1O8K A;  1TSP A;  2B0R A;  4NK8 A;  1PE9 A;  2PEC A;  2VFO A;  4XOP A;  1O8I A;  3DU1 X;  4PMH A;  3EQO A;  4XLE A;  1K4Z A;  3NAW A;  3PSS A;  4MXN A;  1VBL A;  2PYG A;  2Z8G A;  3PET A;  3B4N A;  2YUH A;  3RIQ A;  1RU4 A;  4Z05 A;  3GQ7 A;  4OJ5 A;  1EZG A;  1O8J A;  1DBG A;  2VFN A;  3P4G A;  3SZE A;  3VSV A;  3PSZ A;  2X6X A;  3VMW A;  4EW9 A;  2W7Z A;  4Z06 A;  4XQF A;  1TYU A;  1QQ1 A;  4U4B A;  2X6Y A;  1OFD A;  3ML3 A;  1X0C A;  1O8D A;  1O8M A;  1OGO X;  1OFE A;  2PYH A;  4XOT A;  2J8I A;  4W8R A;  2O0V A;  4XNF A;  3VMV A;  5C1E A;  1CZF A;  2NSP A;  4YZQ A;  2VFQ A;  3SY2 A;  2UVE A;  4C2L A;  1QA2 A;  2XTW A;  4OJO A;  4XLF A;  1QA1 A;  1WXR A;  1K5C A;  4W8Q A;  3LJY A;  1EA0 A;  1DAB A;  2BSP A;  3GQA A;  4I84 A;  3B8Y A;  2IQ7 A;  4JRA C;  1BHE A;  4OZZ A;  1QCX A;  3FY3 A;  1QRC A;  1XG2 A;  1HG8 A;  2X6W A;  4YEL A;  3B90 A;  1LM1 A;  4YEI A;  4Z03 A;  1EE6 A;  1K8F A;  1O8E A;  3VST A;  2BM5 A;  3N90 A;  4OJ6 A;  3WWG A;  4MR0 A;  4URR A;  5AMV A;  1O8G A;  2XTX A;  3ZSC A;  1KCC A;  1NHC A;  5JLV C;  3LMW A;  4AVZ A;  2BX6 A;  2O04 A;  3BH6 B;  5JMC B;  1TYX A;  2INV A;  2QXZ A;  2QY1 A;  4OM9 A;  4XL9 A;  2VJJ A;  2F3L A;  4XKW A;  4XN3 A;  2XC1 A;  3AK5 A;  1H80 A;  1QJV A;  4YC5 A;  1JRG A;  1OFM A;  1IB4 A;  4YZA A;  1KTW A;  1DBO A;  1TYW A;  2NTQ A;  2QZA A;  4OJP A;  2XTY A;  3SYJ A;  2J8K A;  2O1D A;  3TH0 A;  2O17 A;  1O8L A;  4U49 A;  3N6Z A;  4XON A;  5DNS A;  3SQV A;  4YZX A;  4HWV A;  2UVF A;  4YCQ A;  3JUR A; 
#chains in the Genus database with same CATH homology
 3GQ8 A;  2INU A;  2X85 A;  2VBK A;  2NST A;  2X3H A;  3T9G A;  3UW0 A;  3VSU A;  4NK6 A;  1OOC A;  4XLA A;  1O8F A;  3EQN A;  1PXZ A;  3SUC A;  2NT6 A;  4XLC A;  1OFL A;  4W8T A;  1GQ8 A;  4XN0 A;  5C1C A;  1KCD A;  2QX3 A;  4XM3 A;  1O8H A;  4XR6 A;  2VJI A;  3GQ9 A;  4W8S A;  4OZY A;  2NTB A;  4XMY A;  1JTA A;  2EWE A;  1BN8 A;  4XOR A;  2NT9 A;  2NTP A;  4XLH A;  1RMG A;  3GRH A;  3ZPP A;  2VBM A;  1AIR A;  1IDK A;  2NZM A;  4OJL A;  1WMR A;  1IA5 A;  1OGM X;  1IDJ A;  3KRG A;  4YEJ A;  1O88 A;  2O0W A;  2VBE A;  4XKV A;  1PLU A;  4YZ0 A;  2ODL A;  1RWR A;  1O8K A;  4NK8 A;  1PE9 A;  2PEC A;  4XOP A;  1O8I A;  4PMH A;  3EQO A;  4XLE A;  4MXN A;  1VBL A;  2PYG A;  2Z8G A;  3B4N A;  1RU4 A;  4Z05 A;  3GQ7 A;  4OJ5 A;  1O8J A;  1DBG A;  3VSV A;  2X6X A;  3VMW A;  4EW9 A;  4Z06 A;  4XQF A;  4U4B A;  2X6Y A;  1X0C A;  1O8D A;  1O8M A;  1OGO X;  2PYH A;  4XOT A;  3VMV A;  4W8R A;  2O0V A;  4XNF A;  5C1E A;  1CZF A;  2NSP A;  4YZQ A;  4C2L A;  2UVE A;  4OJO A;  4XLF A;  1K5C A;  4W8Q A;  2BSP A;  3GQA A;  4I84 A;  3B8Y A;  2IQ7 A;  4OZZ A;  1BHE A;  1QCX A;  3FY3 A;  1XG2 A;  1HG8 A;  2X6W A;  4YEL A;  3B90 A;  4Z03 A;  1EE6 A;  1O8E A;  3VST A;  4OJ6 A;  3WWG A;  4MR0 A;  4URR A;  5AMV A;  1O8G A;  3ZSC A;  1KCC A;  1NHC A;  3LMW A;  4AVZ A;  2O04 A;  2INV A;  2QXZ A;  2QY1 A;  4XL9 A;  2VJJ A;  4XKW A;  4XN3 A;  1H80 A;  1QJV A;  1JRG A;  1OFM A;  1IB4 A;  4YZA A;  1KTW A;  1DBO A;  2NTQ A;  4OJP A;  2O1D A;  2O17 A;  1O8L A;  4U49 A;  4XON A;  4YZX A;  4HWV A;  2UVF A;  3JUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...