4Z03A

C. bescii family 3 pectate lyase double mutant k108a in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 85
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z03A00
2NT9A 4OJ6A 5C1CA 2UVEA 4XLEA 4XOPA 4Z06A 5AMVA 4W8RA 3GQ8A 4XLFA 4AVZA 1DBOA 4XLHA 4U4BA 1X0CA 1IA5A 4XORA 3T9GA 2NTBA 2INVA 4YEJA 1OFMA 2NZMA 2X3HA 4W8SA 1NHCA 1EE6A 1OGMX 1VBLA 2Z8GA 4XM3A 4Z05A 4HWVA 2PYHA 3FY3A 3EQNA 3JURA 4URRA 1GQ8A 3WWGA 4Z03A 4EW9A 4W8QA 4XNFA 3KRGA 3GQAA 2BSPA 2NTQA 4XN0A 3B90A 3GQ7A 1IB4A 3VSUA 1QCXA 1PXZA 2ODLA 1K5CA 1H80A 2UVFA 2O1DA 4U49A 1KCDA 2X6XA 1O8DA 4YZ0A 4XR6A 3ZPPA 4XLCA 2NT6A 1HG8A 2VBMA 4OJLA 2O0VA 4MXNA 4YZXA 2QX3A 1RU4A 3LMWA 2PYGA 3VMWA 4XQFA 1AIRA 4OJ5A 1IDKA 3EQOA 2X6WA 1PE9A 1DBGA 2PECA 1O8LA 2VJJA 1KTWA 2X85A 1O8IA 2VBEA 2QXZA 1WMRA 1JRGA 1IDJA 4YZAA 4OZZA 4C2LA 2INUA 1QJVA 1O8JA 1OOCA 3B4NA 4OZYA 2IQ7A 2EWEA 2NTPA 1JTAA 1OGOX 3VMVA 1PLUA 1O8KA 1O8FA 1O8HA 2QY1A 3VSTA 1OFLA 2VJIA 2VBKA 2X6YA 1BHEA 1XG2A 4I84A 5C1EA 4XKVA 1CZFA 4OJOA 4YELA 2O0WA 3SUCA 4NK8A 4XKWA 1BN8A 3ZSCA 4XMYA 4NK6A 3B8YA 4PMHA 4XL9A 4XN3A 2NSPA 4W8TA 4XOTA 4YZQA 2O04A 1KCCA 1O8MA 1RMGA 1O8EA 1O8GA 4MR0A 2NSTA 4XLAA 3GRHA 1RWRA 4OJPA 3VSVA 2O17A 3GQ9A 1O88A 4XONA 3UW0A
chains in the Genus database with same CATH superfamily
2NT9A 4OJ6A 5C1CA 2UVEA 4XLEA 3NAWA 3ML3A 1K8FA 4YC5A 4XOPA 4Z06A 5AMVA 2J8KA 4W8RA 3GQ8A 4XLFA 2J8IA 1LM1A 4AVZA 1DBOA 4XLHA 3BH6B 4U4BA 2VFQA 1X0CA 5DNSA 1IA5A 1QRCA 2XTXA 4XORA 3T9GA 4YDTA 2XTYA 2YUHA 2XC1A 1K4ZA 2NTBA 4V02C 2INVA 4YEJA 1DABA 1OFMA 2NZMA 3SY2A 2X3HA 4W8SA 1NHCA 4YFOA 1EE6A 1OGMX 1EZGA 1VBLA 2Z8GA 3H09A 4XM3A 1QA3A 4Z05A 3PSZA 2PYHA 4HWVA 3FY3A 3EQNA 3JURA 4URRA 1GQ8A 3WWGA 4Z03A 3TH0A 4EW9A 1QA2A 4W8QA 3N6ZA 1CLWA 4XNFA 3KRGA 2XT4A 2BSPA 2NTQA 3GQAA 3LYCA 4XN0A 3B90A 4KH3A 3GQ7A 3AK5A 1IB4A 1TYWA 2BM5A 2BM7A 1LLWA 2XTWA 3VSUA 1QCXA 1PXZA 2ODLA 3NB2A 1K5CA 1H80A 3DU1X 2UVFA 3SQVA 2VFPA 2O1DA 3LJYA 3PSSA 4U49A 1KCDA 2X6XA 1O8DA 4YZ0A 1HF2A 4XR6A 3N90A 3ZPPA 4XLCA 2NT6A 1HG8A 2VBMA 4OJLA 2O0VA 4MXNA 4YZXA 3RIQA 2QX3A 4OM9A 1RU4A 3PETA 3LMWA 1TYUA 2PYGA 3VMWA 4XQFA 5JMCB 1OFEA 1AIRA 1L1IA 4OJ5A 2W7ZA 3BH7B 1IDKA 3EQOA 2X6WA 1PE9A 4JRAC 4YCQA 1DBGA 2PECA 1O8LA 4YEIA 2VJJA 1KTWA 2V5IA 2X85A 1O8IA 2VBEA 2QXZA 1WMRA 1JRGA 3JX8A 1IDJA 4YZAA 3SZEA 4OZZA 2VFNA 4C2LA 2INUA 1QJVA 3P4GA 2G0YA 1O8JA 1OOCA 3SYJA 2B0RA 3B4NA 4OZYA 2IQ7A 1EA0A 1QQ1A 2VFMA 2EWEA 1QA1A 2IOUG 1JTAA 2NTPA 2O6WA 2VFOA 1OGOX 1KQ5A 1PLUA 3VMVA 1O8KA 1O8FA 1TYVA 5JLVC 1WXRA 1O8HA 2QY1A 3VSTA 1OFLA 2QYUA 1TSPA 2XT2A 4OPWA 2VJIA 1TYXA 2VBKA 2X6YA 1BHEA 1XG2A 2BM6A 4I84A 5C1EA 4XKVA 1CZFA 4OJOA 4YELA 2O0WA 3SUCA 1OFDA 4NK8A 1QRBA 4XKWA 1BN8A 3ZSCA 4XMYA 4NK6A 2BM4A 3B8YA 4PMHA 4XL9A 4XN3A 2NSPA 2BX6A 4W8TA 4XOTA 4YZQA 2O04A 1KCCA 1O8MA 1RMGA 1O8EA 1O8GA 4MR0A 2NSTA 1LLZA 3GRHA 2F3LA 4XLAA 1RWRA 4OJPA 2QZAA 3VSVA 2O17A 3GQ9A 1O88A 4XONA 3UW0A
chains in the Genus database with same CATH topology
2NT9A 4OJ6A 5C1CA 2UVEA 4XLEA 4XOPA 4Z06A 5AMVA 4W8RA 3GQ8A 4XLFA 4AVZA 1DBOA 4XLHA 4U4BA 1X0CA 1IA5A 4XORA 3T9GA 2NTBA 2INVA 4YEJA 1OFMA 2NZMA 2X3HA 4W8SA 1NHCA 1EE6A 1OGMX 1VBLA 2Z8GA 4XM3A 4Z05A 4HWVA 2PYHA 3FY3A 3EQNA 3JURA 4URRA 1GQ8A 3WWGA 4Z03A 4EW9A 4W8QA 4XNFA 3KRGA 3GQAA 2BSPA 2NTQA 4XN0A 3B90A 3GQ7A 1IB4A 3VSUA 1QCXA 1PXZA 2ODLA 1K5CA 1H80A 2UVFA 2O1DA 4U49A 1KCDA 2X6XA 1O8DA 4YZ0A 4XR6A 3ZPPA 4XLCA 2NT6A 1HG8A 2VBMA 4OJLA 2O0VA 4MXNA 4YZXA 2QX3A 1RU4A 3LMWA 2PYGA 3VMWA 4XQFA 1AIRA 4OJ5A 1IDKA 3EQOA 2X6WA 1PE9A 1DBGA 2PECA 1O8LA 2VJJA 1KTWA 2X85A 1O8IA 2VBEA 2QXZA 1WMRA 1JRGA 1IDJA 4YZAA 4OZZA 4C2LA 2INUA 1QJVA 1O8JA 1OOCA 3B4NA 4OZYA 2IQ7A 2EWEA 2NTPA 1JTAA 1OGOX 3VMVA 1PLUA 1O8KA 1O8FA 1O8HA 2QY1A 3VSTA 1OFLA 2VJIA 2VBKA 2X6YA 1BHEA 1XG2A 4I84A 5C1EA 4XKVA 1CZFA 4OJOA 4YELA 2O0WA 3SUCA 4NK8A 4XKWA 1BN8A 3ZSCA 4XMYA 4NK6A 3B8YA 4PMHA 4XL9A 4XN3A 2NSPA 4W8TA 4XOTA 4YZQA 2O04A 1KCCA 1O8MA 1RMGA 1O8EA 1O8GA 4MR0A 2NSTA 4XLAA 3GRHA 1RWRA 4OJPA 3VSVA 2O17A 3GQ9A 1O88A 4XONA 3UW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NT9 A;  4OJ6 A;  5C1C A;  2UVE A;  4XLE A;  4XOP A;  4Z06 A;  5AMV A;  4W8R A;  3GQ8 A;  4XLF A;  4AVZ A;  1DBO A;  4XLH A;  4U4B A;  1X0C A;  1IA5 A;  4XOR A;  3T9G A;  2NTB A;  2INV A;  4YEJ A;  1OFM A;  2NZM A;  2X3H A;  4W8S A;  1NHC A;  1EE6 A;  1OGM X;  1VBL A;  2Z8G A;  4XM3 A;  4Z05 A;  4HWV A;  2PYH A;  3FY3 A;  3EQN A;  3JUR A;  4URR A;  1GQ8 A;  3WWG A;  4Z03 A;  4EW9 A;  4W8Q A;  4XNF A;  3KRG A;  3GQA A;  2BSP A;  2NTQ A;  4XN0 A;  3B90 A;  3GQ7 A;  1IB4 A;  3VSU A;  1QCX A;  1PXZ A;  2ODL A;  1K5C A;  1H80 A;  2UVF A;  2O1D A;  4U49 A;  1KCD A;  2X6X A;  1O8D A;  4YZ0 A;  4XR6 A;  3ZPP A;  4XLC A;  2NT6 A;  1HG8 A;  2VBM A;  4OJL A;  2O0V A;  4MXN A;  4YZX A;  2QX3 A;  1RU4 A;  3LMW A;  2PYG A;  3VMW A;  4XQF A;  1AIR A;  4OJ5 A;  1IDK A;  3EQO A;  2X6W A;  1PE9 A;  1DBG A;  2PEC A;  1O8L A;  2VJJ A;  1KTW A;  2X85 A;  1O8I A;  2VBE A;  2QXZ A;  1WMR A;  1JRG A;  1IDJ A;  4YZA A;  4OZZ A;  4C2L A;  2INU A;  1QJV A;  1O8J A;  1OOC A;  3B4N A;  4OZY A;  2IQ7 A;  2EWE A;  2NTP A;  1JTA A;  1OGO X;  3VMV A;  1PLU A;  1O8K A;  1O8F A;  1O8H A;  2QY1 A;  3VST A;  1OFL A;  2VJI A;  2VBK A;  2X6Y A;  1BHE A;  1XG2 A;  4I84 A;  5C1E A;  4XKV A;  1CZF A;  4OJO A;  4YEL A;  2O0W A;  3SUC A;  4NK8 A;  4XKW A;  1BN8 A;  3ZSC A;  4XMY A;  4NK6 A;  3B8Y A;  4PMH A;  4XL9 A;  4XN3 A;  2NSP A;  4W8T A;  4XOT A;  4YZQ A;  2O04 A;  1KCC A;  1O8M A;  1RMG A;  1O8E A;  1O8G A;  4MR0 A;  2NST A;  4XLA A;  3GRH A;  1RWR A;  4OJP A;  3VSV A;  2O17 A;  3GQ9 A;  1O88 A;  4XON A;  3UW0 A; 
#chains in the Genus database with same CATH topology
 2NT9 A;  4OJ6 A;  5C1C A;  2UVE A;  4XLE A;  3NAW A;  3ML3 A;  1K8F A;  4YC5 A;  4XOP A;  4Z06 A;  5AMV A;  2J8K A;  4W8R A;  3GQ8 A;  4XLF A;  2J8I A;  1LM1 A;  4AVZ A;  1DBO A;  4XLH A;  3BH6 B;  4U4B A;  2VFQ A;  1X0C A;  5DNS A;  1IA5 A;  1QRC A;  2XTX A;  4XOR A;  3T9G A;  4YDT A;  2XTY A;  2YUH A;  2XC1 A;  1K4Z A;  2NTB A;  4V02 C;  2INV A;  4YEJ A;  1DAB A;  1OFM A;  2NZM A;  3SY2 A;  2X3H A;  4W8S A;  1NHC A;  4YFO A;  1EE6 A;  1OGM X;  1EZG A;  1VBL A;  2Z8G A;  3H09 A;  4XM3 A;  1QA3 A;  4Z05 A;  3PSZ A;  2PYH A;  4HWV A;  3FY3 A;  3EQN A;  3JUR A;  4URR A;  1GQ8 A;  3WWG A;  4Z03 A;  3TH0 A;  4EW9 A;  1QA2 A;  4W8Q A;  3N6Z A;  1CLW A;  4XNF A;  3KRG A;  2XT4 A;  2BSP A;  2NTQ A;  3GQA A;  3LYC A;  4XN0 A;  3B90 A;  4KH3 A;  3GQ7 A;  3AK5 A;  1IB4 A;  1TYW A;  2BM5 A;  2BM7 A;  1LLW A;  2XTW A;  3VSU A;  1QCX A;  1PXZ A;  2ODL A;  3NB2 A;  1K5C A;  1H80 A;  3DU1 X;  2UVF A;  3SQV A;  2VFP A;  2O1D A;  3LJY A;  3PSS A;  4U49 A;  1KCD A;  2X6X A;  1O8D A;  4YZ0 A;  1HF2 A;  4XR6 A;  3N90 A;  3ZPP A;  4XLC A;  2NT6 A;  1HG8 A;  2VBM A;  4OJL A;  2O0V A;  4MXN A;  4YZX A;  3RIQ A;  2QX3 A;  4OM9 A;  1RU4 A;  3PET A;  3LMW A;  1TYU A;  2PYG A;  3VMW A;  4XQF A;  5JMC B;  1OFE A;  1AIR A;  1L1I A;  4OJ5 A;  2W7Z A;  3BH7 B;  1IDK A;  3EQO A;  2X6W A;  1PE9 A;  4JRA C;  4YCQ A;  1DBG A;  2PEC A;  1O8L A;  4YEI A;  2VJJ A;  1KTW A;  2V5I A;  2X85 A;  1O8I A;  2VBE A;  2QXZ A;  1WMR A;  1JRG A;  3JX8 A;  1IDJ A;  4YZA A;  3SZE A;  4OZZ A;  2VFN A;  4C2L A;  2INU A;  1QJV A;  3P4G A;  2G0Y A;  1O8J A;  1OOC A;  3SYJ A;  2B0R A;  3B4N A;  4OZY A;  2IQ7 A;  1EA0 A;  1QQ1 A;  2VFM A;  2EWE A;  1QA1 A;  2IOU G;  1JTA A;  2NTP A;  2O6W A;  2VFO A;  1OGO X;  1KQ5 A;  1PLU A;  3VMV A;  1O8K A;  1O8F A;  1TYV A;  5JLV C;  1WXR A;  1O8H A;  2QY1 A;  3VST A;  1OFL A;  2QYU A;  1TSP A;  2XT2 A;  4OPW A;  2VJI A;  1TYX A;  2VBK A;  2X6Y A;  1BHE A;  1XG2 A;  2BM6 A;  4I84 A;  5C1E A;  4XKV A;  1CZF A;  4OJO A;  4YEL A;  2O0W A;  3SUC A;  1OFD A;  4NK8 A;  1QRB A;  4XKW A;  1BN8 A;  3ZSC A;  4XMY A;  4NK6 A;  2BM4 A;  3B8Y A;  4PMH A;  4XL9 A;  4XN3 A;  2NSP A;  2BX6 A;  4W8T A;  4XOT A;  4YZQ A;  2O04 A;  1KCC A;  1O8M A;  1RMG A;  1O8E A;  1O8G A;  4MR0 A;  2NST A;  1LLZ A;  3GRH A;  2F3L A;  4XLA A;  1RWR A;  4OJP A;  2QZA A;  3VSV A;  2O17 A;  3GQ9 A;  1O88 A;  4XON A;  3UW0 A; 
#chains in the Genus database with same CATH homology
 2NT9 A;  4OJ6 A;  5C1C A;  2UVE A;  4XLE A;  4XOP A;  4Z06 A;  5AMV A;  4W8R A;  3GQ8 A;  4XLF A;  4AVZ A;  1DBO A;  4XLH A;  4U4B A;  1X0C A;  1IA5 A;  4XOR A;  3T9G A;  2NTB A;  2INV A;  4YEJ A;  1OFM A;  2NZM A;  2X3H A;  4W8S A;  1NHC A;  1EE6 A;  1OGM X;  1VBL A;  2Z8G A;  4XM3 A;  4Z05 A;  4HWV A;  2PYH A;  3FY3 A;  3EQN A;  3JUR A;  4URR A;  1GQ8 A;  3WWG A;  4Z03 A;  4EW9 A;  4W8Q A;  4XNF A;  3KRG A;  3GQA A;  2BSP A;  2NTQ A;  4XN0 A;  3B90 A;  3GQ7 A;  1IB4 A;  3VSU A;  1QCX A;  1PXZ A;  2ODL A;  1K5C A;  1H80 A;  2UVF A;  2O1D A;  4U49 A;  1KCD A;  2X6X A;  1O8D A;  4YZ0 A;  4XR6 A;  3ZPP A;  4XLC A;  2NT6 A;  1HG8 A;  2VBM A;  4OJL A;  2O0V A;  4MXN A;  4YZX A;  2QX3 A;  1RU4 A;  3LMW A;  2PYG A;  3VMW A;  4XQF A;  1AIR A;  4OJ5 A;  1IDK A;  3EQO A;  2X6W A;  1PE9 A;  1DBG A;  2PEC A;  1O8L A;  2VJJ A;  1KTW A;  2X85 A;  1O8I A;  2VBE A;  2QXZ A;  1WMR A;  1JRG A;  1IDJ A;  4YZA A;  4OZZ A;  4C2L A;  2INU A;  1QJV A;  1O8J A;  1OOC A;  3B4N A;  4OZY A;  2IQ7 A;  2EWE A;  2NTP A;  1JTA A;  1OGO X;  3VMV A;  1PLU A;  1O8K A;  1O8F A;  1O8H A;  2QY1 A;  3VST A;  1OFL A;  2VJI A;  2VBK A;  2X6Y A;  1BHE A;  1XG2 A;  4I84 A;  5C1E A;  4XKV A;  1CZF A;  4OJO A;  4YEL A;  2O0W A;  3SUC A;  4NK8 A;  4XKW A;  1BN8 A;  3ZSC A;  4XMY A;  4NK6 A;  3B8Y A;  4PMH A;  4XL9 A;  4XN3 A;  2NSP A;  4W8T A;  4XOT A;  4YZQ A;  2O04 A;  1KCC A;  1O8M A;  1RMG A;  1O8E A;  1O8G A;  4MR0 A;  2NST A;  4XLA A;  3GRH A;  1RWR A;  4OJP A;  3VSV A;  2O17 A;  3GQ9 A;  1O88 A;  4XON A;  3UW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...