4Z03A

C. bescii family 3 pectate lyase double mutant k108a in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 85
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z03A00
1JTAA 4EW9A 4I84A 3T9GA 4OJ6A 2PYHA 1DBGA 2PYGA 2NTBA 1O88A 2NTQA 4YELA 2NSPA 2VBMA 4XOPA 2VBKA 1OGOX 4XLCA 2QXZA 1OFLA 1X0CA 2X6YA 4YZXA 4XMYA 1O8FA 4YZQA 4AVZA 3B8YA 2EWEA 1PLUA 4URRA 2VJIA 2INVA 4NK6A 1O8JA 4PMHA 1HG8A 1RWRA 4W8RA 1OOCA 4YZ0A 2NT9A 1O8EA 4NK8A 4W8SA 3GQ9A 4XR6A 3VSVA 1OFMA 1CZFA 4OZYA 1RMGA 4XKWA 4XQFA 1O8LA 2O04A 3VMWA 2NSTA 4XN3A 4OJ5A 1DBOA 2NT6A 1O8KA 2UVEA 2IQ7A 1GQ8A 2QY1A 1JRGA 4XORA 3GRHA 4XN0A 1RU4A 2O17A 4XL9A 3UW0A 2NZMA 2UVFA 3WWGA 4XLEA 2BSPA 1OGMX 3SUCA 1KCDA 4Z03A 4YZAA 1WMRA 1AIRA 4HWVA 2VBEA 1QJVA 2NTPA 2O0WA 3VSTA 3ZPPA 1PXZA 4OJOA 3FY3A 4W8TA 2X3HA 2X6XA 3GQ7A 4XNFA 1H80A 1EE6A 5C1CA 2Z8GA 5AMVA 2O1DA 1O8IA 2INUA 1PE9A 4MR0A 1KTWA 1O8GA 1IDKA 2PECA 3B4NA 4XONA 1IDJA 4OZZA 3VSUA 3ZSCA 1QCXA 1VBLA 2O0VA 4XKVA 4XLFA 3B90A 1O8HA 3KRGA 1BHEA 3GQAA 4C2LA 4XLHA 3GQ8A 5C1EA 1IB4A 1NHCA 4U49A 1O8MA 2X6WA 1K5CA 2X85A 4XM3A 3JURA 1O8DA 3VMVA 4U4BA 4XLAA 4Z05A 4MXNA 1BN8A 4YEJA 1KCCA 2ODLA 3LMWA 4XOTA 2VJJA 3EQNA 4OJPA 2QX3A 4Z06A 4W8QA 1XG2A 1IA5A 3EQOA 4OJLA
chains in the Genus database with same CATH superfamily
1JTAA 5DNSA 4EW9A 2QYUA 4I84A 3T9GA 4OJ6A 2PYHA 2BM6A 1IA5A 3NB2A 1DBGA 1QRCA 2PYGA 2NTBA 1O88A 2NTQA 4YELA 3LYCA 2NSPA 2F3LA 4YDTA 2VBMA 4XOPA 2VBKA 1OGOX 4XLCA 2W7ZA 1TYWA 1HF2A 2QXZA 1OFLA 1X0CA 2X6YA 4YZXA 1L1IA 3TH0A 4XMYA 1KQ5A 1O8FA 4YZQA 4AVZA 1QRBA 2EWEA 1PLUA 3B8YA 4URRA 2VJIA 3BH6B 2INVA 4NK6A 1O8JA 2J8IA 4PMHA 1HG8A 1RWRA 4W8RA 1OOCA 3JX8A 4YZ0A 3N90A 2NT9A 4V02C 1O8EA 1LLZA 4NK8A 3GQ9A 4W8SA 4XR6A 3VSVA 1OFMA 1CZFA 1QA2A 4OZYA 3SQVA 1RMGA 4XKWA 4XQFA 1O8LA 2O04A 3VMWA 2NSTA 3PSZA 4XN3A 3P4GA 4OJ5A 1DBOA 2NT6A 1O8KA 1QQ1A 2V5IA 2UVEA 2VFOA 2IQ7A 1GQ8A 2G0YA 2QY1A 2XT4A 1JRGA 1QA1A 4XORA 4OM9A 3GRHA 4XN0A 2VFMA 1RU4A 4JRAC 2O17A 4XL9A 2XTXA 2NZMA 2UVFA 1TSPA 3UW0A 4XLEA 2BSPA 1OGMX 1TYXA 3WWGA 3SUCA 1KCDA 1CLWA 2XTYA 3PETA 4YZAA 2BM4A 1WMRA 1AIRA 4HWVA 2VBEA 1QJVA 4YEIA 2NTPA 2O0WA 3SZEA 3VSTA 3AK5A 3ZPPA 1PXZA 1QA3A 4OJOA 1OFDA 4YFOA 3FY3A 4W8TA 2X3HA 2X6XA 3GQ7A 4XNFA 1H80A 2VFQA 1EE6A 5C1CA 2Z8GA 5AMVA 3SYJA 3ML3A 3DU1X 1LM1A 2O1DA 1O8IA 2XTWA 2INUA 1PE9A 4MR0A 3RIQA 5JLVC 1KTWA 4YC5A 2BM7A 2XT2A 1O8GA 4OPWA 1IDKA 2BX6A 2PECA 3B4NA 4KH3A 4XONA 1IDJA 2VFNA 3NAWA 4OZZA 2O6WA 3VSUA 3ZSCA 1QCXA 1TYVA 1VBLA 1K8FA 2O0VA 3BH7B 3PSSA 4XLFA 1OFEA 4XKVA 3B90A 1O8HA 3KRGA 3H09A 1DABA 1EA0A 1BHEA 1WXRA 3GQAA 4C2LA 3SY2A 4XLHA 3GQ8A 5C1EA 1IB4A 1NHCA 4U49A 1O8MA 2X6WA 1K5CA 2X85A 2VFPA 2IOUG 1EZGA 4XM3A 3JURA 1O8DA 1LLWA 4YCQA 3VMVA 4U4BA 4XLAA 4Z05A 2J8KA 4MXNA 1BN8A 2QZAA 4YEJA 1KCCA 2ODLA 3LJYA 3LMWA 4XOTA 4Z03A 2VJJA 1K4ZA 3EQNA 4OJPA 2QX3A 1TYUA 4Z06A 3N6ZA 2YUHA 4W8QA 2B0RA 2BM5A 1XG2A 2XC1A 3EQOA 4OJLA 5JMCB
chains in the Genus database with same CATH topology
1JTAA 4EW9A 4I84A 3T9GA 4OJ6A 2PYHA 1DBGA 2PYGA 2NTBA 1O88A 2NTQA 4YELA 2NSPA 2VBMA 4XOPA 2VBKA 1OGOX 4XLCA 2QXZA 1OFLA 1X0CA 2X6YA 4YZXA 4XMYA 1O8FA 4YZQA 4AVZA 3B8YA 2EWEA 1PLUA 4URRA 2VJIA 2INVA 4NK6A 1O8JA 4PMHA 1HG8A 1RWRA 4W8RA 1OOCA 4YZ0A 2NT9A 1O8EA 4NK8A 4W8SA 3GQ9A 4XR6A 3VSVA 1OFMA 1CZFA 4OZYA 1RMGA 4XKWA 4XQFA 1O8LA 2O04A 3VMWA 2NSTA 4XN3A 4OJ5A 1DBOA 2NT6A 1O8KA 2UVEA 2IQ7A 1GQ8A 2QY1A 1JRGA 4XORA 3GRHA 4XN0A 1RU4A 2O17A 4XL9A 3UW0A 2NZMA 2UVFA 3WWGA 4XLEA 2BSPA 1OGMX 3SUCA 1KCDA 4Z03A 4YZAA 1WMRA 1AIRA 4HWVA 2VBEA 1QJVA 2NTPA 2O0WA 3VSTA 3ZPPA 1PXZA 4OJOA 3FY3A 4W8TA 2X3HA 2X6XA 3GQ7A 4XNFA 1H80A 1EE6A 5C1CA 2Z8GA 5AMVA 2O1DA 1O8IA 2INUA 1PE9A 4MR0A 1KTWA 1O8GA 1IDKA 2PECA 3B4NA 4XONA 1IDJA 4OZZA 3VSUA 3ZSCA 1QCXA 1VBLA 2O0VA 4XKVA 4XLFA 3B90A 1O8HA 3KRGA 1BHEA 3GQAA 4C2LA 4XLHA 3GQ8A 5C1EA 1IB4A 1NHCA 4U49A 1O8MA 2X6WA 1K5CA 2X85A 4XM3A 3JURA 1O8DA 3VMVA 4U4BA 4XLAA 4Z05A 4MXNA 1BN8A 4YEJA 1KCCA 2ODLA 3LMWA 4XOTA 2VJJA 3EQNA 4OJPA 2QX3A 4Z06A 4W8QA 1XG2A 1IA5A 3EQOA 4OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTA A;  4EW9 A;  4I84 A;  3T9G A;  4OJ6 A;  2PYH A;  1DBG A;  2PYG A;  2NTB A;  1O88 A;  2NTQ A;  4YEL A;  2NSP A;  2VBM A;  4XOP A;  2VBK A;  1OGO X;  4XLC A;  2QXZ A;  1OFL A;  1X0C A;  2X6Y A;  4YZX A;  4XMY A;  1O8F A;  4YZQ A;  4AVZ A;  3B8Y A;  2EWE A;  1PLU A;  4URR A;  2VJI A;  2INV A;  4NK6 A;  1O8J A;  4PMH A;  1HG8 A;  1RWR A;  4W8R A;  1OOC A;  4YZ0 A;  2NT9 A;  1O8E A;  4NK8 A;  4W8S A;  3GQ9 A;  4XR6 A;  3VSV A;  1OFM A;  1CZF A;  4OZY A;  1RMG A;  4XKW A;  4XQF A;  1O8L A;  2O04 A;  3VMW A;  2NST A;  4XN3 A;  4OJ5 A;  1DBO A;  2NT6 A;  1O8K A;  2UVE A;  2IQ7 A;  1GQ8 A;  2QY1 A;  1JRG A;  4XOR A;  3GRH A;  4XN0 A;  1RU4 A;  2O17 A;  4XL9 A;  3UW0 A;  2NZM A;  2UVF A;  3WWG A;  4XLE A;  2BSP A;  1OGM X;  3SUC A;  1KCD A;  4Z03 A;  4YZA A;  1WMR A;  1AIR A;  4HWV A;  2VBE A;  1QJV A;  2NTP A;  2O0W A;  3VST A;  3ZPP A;  1PXZ A;  4OJO A;  3FY3 A;  4W8T A;  2X3H A;  2X6X A;  3GQ7 A;  4XNF A;  1H80 A;  1EE6 A;  5C1C A;  2Z8G A;  5AMV A;  2O1D A;  1O8I A;  2INU A;  1PE9 A;  4MR0 A;  1KTW A;  1O8G A;  1IDK A;  2PEC A;  3B4N A;  4XON A;  1IDJ A;  4OZZ A;  3VSU A;  3ZSC A;  1QCX A;  1VBL A;  2O0V A;  4XKV A;  4XLF A;  3B90 A;  1O8H A;  3KRG A;  1BHE A;  3GQA A;  4C2L A;  4XLH A;  3GQ8 A;  5C1E A;  1IB4 A;  1NHC A;  4U49 A;  1O8M A;  2X6W A;  1K5C A;  2X85 A;  4XM3 A;  3JUR A;  1O8D A;  3VMV A;  4U4B A;  4XLA A;  4Z05 A;  4MXN A;  1BN8 A;  4YEJ A;  1KCC A;  2ODL A;  3LMW A;  4XOT A;  2VJJ A;  3EQN A;  4OJP A;  2QX3 A;  4Z06 A;  4W8Q A;  1XG2 A;  1IA5 A;  3EQO A;  4OJL A; 
#chains in the Genus database with same CATH topology
 1JTA A;  5DNS A;  4EW9 A;  2QYU A;  4I84 A;  3T9G A;  4OJ6 A;  2PYH A;  2BM6 A;  1IA5 A;  3NB2 A;  1DBG A;  1QRC A;  2PYG A;  2NTB A;  1O88 A;  2NTQ A;  4YEL A;  3LYC A;  2NSP A;  2F3L A;  4YDT A;  2VBM A;  4XOP A;  2VBK A;  1OGO X;  4XLC A;  2W7Z A;  1TYW A;  1HF2 A;  2QXZ A;  1OFL A;  1X0C A;  2X6Y A;  4YZX A;  1L1I A;  3TH0 A;  4XMY A;  1KQ5 A;  1O8F A;  4YZQ A;  4AVZ A;  1QRB A;  2EWE A;  1PLU A;  3B8Y A;  4URR A;  2VJI A;  3BH6 B;  2INV A;  4NK6 A;  1O8J A;  2J8I A;  4PMH A;  1HG8 A;  1RWR A;  4W8R A;  1OOC A;  3JX8 A;  4YZ0 A;  3N90 A;  2NT9 A;  4V02 C;  1O8E A;  1LLZ A;  4NK8 A;  3GQ9 A;  4W8S A;  4XR6 A;  3VSV A;  1OFM A;  1CZF A;  1QA2 A;  4OZY A;  3SQV A;  1RMG A;  4XKW A;  4XQF A;  1O8L A;  2O04 A;  3VMW A;  2NST A;  3PSZ A;  4XN3 A;  3P4G A;  4OJ5 A;  1DBO A;  2NT6 A;  1O8K A;  1QQ1 A;  2V5I A;  2UVE A;  2VFO A;  2IQ7 A;  1GQ8 A;  2G0Y A;  2QY1 A;  2XT4 A;  1JRG A;  1QA1 A;  4XOR A;  4OM9 A;  3GRH A;  4XN0 A;  2VFM A;  1RU4 A;  4JRA C;  2O17 A;  4XL9 A;  2XTX A;  2NZM A;  2UVF A;  1TSP A;  3UW0 A;  4XLE A;  2BSP A;  1OGM X;  1TYX A;  3WWG A;  3SUC A;  1KCD A;  1CLW A;  2XTY A;  3PET A;  4YZA A;  2BM4 A;  1WMR A;  1AIR A;  4HWV A;  2VBE A;  1QJV A;  4YEI A;  2NTP A;  2O0W A;  3SZE A;  3VST A;  3AK5 A;  3ZPP A;  1PXZ A;  1QA3 A;  4OJO A;  1OFD A;  4YFO A;  3FY3 A;  4W8T A;  2X3H A;  2X6X A;  3GQ7 A;  4XNF A;  1H80 A;  2VFQ A;  1EE6 A;  5C1C A;  2Z8G A;  5AMV A;  3SYJ A;  3ML3 A;  3DU1 X;  1LM1 A;  2O1D A;  1O8I A;  2XTW A;  2INU A;  1PE9 A;  4MR0 A;  3RIQ A;  5JLV C;  1KTW A;  4YC5 A;  2BM7 A;  2XT2 A;  1O8G A;  4OPW A;  1IDK A;  2BX6 A;  2PEC A;  3B4N A;  4KH3 A;  4XON A;  1IDJ A;  2VFN A;  3NAW A;  4OZZ A;  2O6W A;  3VSU A;  3ZSC A;  1QCX A;  1TYV A;  1VBL A;  1K8F A;  2O0V A;  3BH7 B;  3PSS A;  4XLF A;  1OFE A;  4XKV A;  3B90 A;  1O8H A;  3KRG A;  3H09 A;  1DAB A;  1EA0 A;  1BHE A;  1WXR A;  3GQA A;  4C2L A;  3SY2 A;  4XLH A;  3GQ8 A;  5C1E A;  1IB4 A;  1NHC A;  4U49 A;  1O8M A;  2X6W A;  1K5C A;  2X85 A;  2VFP A;  2IOU G;  1EZG A;  4XM3 A;  3JUR A;  1O8D A;  1LLW A;  4YCQ A;  3VMV A;  4U4B A;  4XLA A;  4Z05 A;  2J8K A;  4MXN A;  1BN8 A;  2QZA A;  4YEJ A;  1KCC A;  2ODL A;  3LJY A;  3LMW A;  4XOT A;  4Z03 A;  2VJJ A;  1K4Z A;  3EQN A;  4OJP A;  2QX3 A;  1TYU A;  4Z06 A;  3N6Z A;  2YUH A;  4W8Q A;  2B0R A;  2BM5 A;  1XG2 A;  2XC1 A;  3EQO A;  4OJL A;  5JMC B; 
#chains in the Genus database with same CATH homology
 1JTA A;  4EW9 A;  4I84 A;  3T9G A;  4OJ6 A;  2PYH A;  1DBG A;  2PYG A;  2NTB A;  1O88 A;  2NTQ A;  4YEL A;  2NSP A;  2VBM A;  4XOP A;  2VBK A;  1OGO X;  4XLC A;  2QXZ A;  1OFL A;  1X0C A;  2X6Y A;  4YZX A;  4XMY A;  1O8F A;  4YZQ A;  4AVZ A;  3B8Y A;  2EWE A;  1PLU A;  4URR A;  2VJI A;  2INV A;  4NK6 A;  1O8J A;  4PMH A;  1HG8 A;  1RWR A;  4W8R A;  1OOC A;  4YZ0 A;  2NT9 A;  1O8E A;  4NK8 A;  4W8S A;  3GQ9 A;  4XR6 A;  3VSV A;  1OFM A;  1CZF A;  4OZY A;  1RMG A;  4XKW A;  4XQF A;  1O8L A;  2O04 A;  3VMW A;  2NST A;  4XN3 A;  4OJ5 A;  1DBO A;  2NT6 A;  1O8K A;  2UVE A;  2IQ7 A;  1GQ8 A;  2QY1 A;  1JRG A;  4XOR A;  3GRH A;  4XN0 A;  1RU4 A;  2O17 A;  4XL9 A;  3UW0 A;  2NZM A;  2UVF A;  3WWG A;  4XLE A;  2BSP A;  1OGM X;  3SUC A;  1KCD A;  4Z03 A;  4YZA A;  1WMR A;  1AIR A;  4HWV A;  2VBE A;  1QJV A;  2NTP A;  2O0W A;  3VST A;  3ZPP A;  1PXZ A;  4OJO A;  3FY3 A;  4W8T A;  2X3H A;  2X6X A;  3GQ7 A;  4XNF A;  1H80 A;  1EE6 A;  5C1C A;  2Z8G A;  5AMV A;  2O1D A;  1O8I A;  2INU A;  1PE9 A;  4MR0 A;  1KTW A;  1O8G A;  1IDK A;  2PEC A;  3B4N A;  4XON A;  1IDJ A;  4OZZ A;  3VSU A;  3ZSC A;  1QCX A;  1VBL A;  2O0V A;  4XKV A;  4XLF A;  3B90 A;  1O8H A;  3KRG A;  1BHE A;  3GQA A;  4C2L A;  4XLH A;  3GQ8 A;  5C1E A;  1IB4 A;  1NHC A;  4U49 A;  1O8M A;  2X6W A;  1K5C A;  2X85 A;  4XM3 A;  3JUR A;  1O8D A;  3VMV A;  4U4B A;  4XLA A;  4Z05 A;  4MXN A;  1BN8 A;  4YEJ A;  1KCC A;  2ODL A;  3LMW A;  4XOT A;  2VJJ A;  3EQN A;  4OJP A;  2QX3 A;  4Z06 A;  4W8Q A;  1XG2 A;  1IA5 A;  3EQO A;  4OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...