4Z03A

C. bescii family 3 pectate lyase double mutant k108a in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
195
structure length
195
Chain Sequence
b'GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 85
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z03A00
2O04A 1DBGA 4XNFA 4XL9A 1JRGA 4XORA 1OOCA 4YELA 4XQFA 5AMVA 4XLHA 1HG8A 2VJIA 3B90A 3VSTA 4MR0A 4W8SA 1PLUA 4HWVA 4XLAA 2QX3A 1O8GA 1CZFA 2ODLA 2NTBA 4Z06A 3UW0A 1GQ8A 1XG2A 4YZXA 2QXZA 4EW9A 4U49A 1PE9A 4AVZA 4NK6A 1VBLA 4URRA 2UVFA 1RU4A 5C1CA 1IDJA 3T9GA 1O88A 1BHEA 1EE6A 3GQ9A 4Z03A 4XKVA 2O0VA 1O8KA 1O8EA 3ZSCA 2IQ7A 1KTWA 4OJPA 2INUA 4Z05A 2PYHA 1O8MA 4XM3A 1O8LA 4XLCA 2UVEA 3GRHA 1OGMX 4XMYA 1O8IA 1OFLA 4OJOA 4W8TA 2NSPA 4XOTA 4OJ6A 3SUCA 4C2LA 4YEJA 3VSVA 3GQAA 1JTAA 4OZZA 3FY3A 1X0CA 4YZ0A 4YZAA 2VJJA 2O0WA 2EWEA 3B8YA 3EQOA 1BN8A 2PECA 2NT6A 2QY1A 1IDKA 1O8FA 4XOPA 1NHCA 1O8JA 3GQ7A 2O1DA 2NT9A 2X6WA 4W8RA 1RWRA 2PYGA 1QCXA 2NSTA 1QJVA 1OGOX 3VMVA 1IB4A 4W8QA 1IA5A 2X3HA 3VSUA 4PMHA 3LMWA 1PXZA 1AIRA 2X85A 1O8HA 2VBKA 4I84A 4XKWA 4U4BA 1KCCA 4XN3A 4OJ5A 3JURA 3GQ8A 1O8DA 4XONA 1OFMA 2NZMA 4XN0A 2VBEA 2Z8GA 1KCDA 4OZYA 3EQNA 3WWGA 2X6XA 2NTQA 4XLEA 4MXNA 2VBMA 5C1EA 1K5CA 1WMRA 3VMWA 3ZPPA 1H80A 1RMGA 4XLFA 3B4NA 2NTPA 4XR6A 2X6YA 1DBOA 3KRGA 2BSPA 4OJLA 4NK8A 4YZQA 2INVA 2O17A
chains in the Genus database with same CATH superfamily
2O04A 1DBGA 3TH0A 4XNFA 2G0YA 4XL9A 1JRGA 2XT4A 4XORA 1QRBA 1OOCA 4YELA 3SZEA 5AMVA 2BM6A 4XQFA 4XLHA 1HG8A 2VJIA 1K8FA 3B90A 3LYCA 3SQVA 3VSTA 4MR0A 2VFPA 3DU1X 4W8SA 1PLUA 4HWVA 4XLAA 3PSSA 2QX3A 1OFEA 1O8GA 2VFQA 1CZFA 2ODLA 2QZAA 2W7ZA 2J8KA 2NTBA 3JX8A 4Z06A 1LLWA 3UW0A 1QA1A 1GQ8A 1XG2A 3NAWA 4YZXA 2QXZA 4EW9A 1K4ZA 4YCQA 1OFDA 4U49A 1PE9A 4AVZA 4NK6A 3SYJA 1VBLA 2VFOA 1CLWA 2UVFA 4URRA 1RU4A 3PSZA 5C1CA 2BX6A 3SY2A 1IDJA 3T9GA 1O88A 2F3LA 1BHEA 1EE6A 3GQ9A 4XKVA 4Z03A 3AK5A 2O0VA 1KQ5A 1QA3A 1O8KA 1O8EA 4JRAC 3ZSCA 1TYUA 2IQ7A 4OPWA 2BM7A 2XT2A 5JMCB 1KTWA 4OJPA 2INUA 4Z05A 2PYHA 1O8MA 4XM3A 1QA2A 1O8LA 4XLCA 2UVEA 3GRHA 1OGMX 4XMYA 1O8IA 3H09A 1OFLA 4OJOA 4W8TA 2NSPA 3N6ZA 4XOTA 3NB2A 1EZGA 1TSPA 4OJ6A 3SUCA 3BH6B 4C2LA 2XTYA 4YEJA 2XTXA 3VSVA 3GQAA 1JTAA 4OZZA 3FY3A 1X0CA 4YZ0A 4YZAA 2VJJA 3BH7B 2O0WA 2EWEA 3B8YA 3EQOA 1BN8A 4YC5A 2NT6A 1IDKA 2PECA 2QY1A 1O8FA 4XOPA 1NHCA 1O8JA 2VFNA 3GQ7A 2O1DA 4YEIA 1QQ1A 1L1IA 2NT9A 2X6WA 1HF2A 2XC1A 4W8RA 1RWRA 2PYGA 4YDTA 5DNSA 1QCXA 2NSTA 1QJVA 1OGOX 3VMVA 1IB4A 2YUHA 4W8QA 1IA5A 2X3HA 4YFOA 1TYWA 4PMHA 3VSUA 3LMWA 1PXZA 2B0RA 1AIRA 5JLVC 2X85A 1O8HA 2VBKA 4I84A 1LLZA 3PETA 4XKWA 4U4BA 1KCCA 4XN3A 4OJ5A 2XTWA 3JURA 3GQ8A 1O8DA 1DABA 3LJYA 2VFMA 1TYVA 4XONA 4OM9A 1OFMA 2NZMA 4XN0A 2VBEA 2Z8GA 1KCDA 4OZYA 1QRCA 2O6WA 3EQNA 1TYXA 2BM4A 3WWGA 2X6XA 2NTQA 4XLEA 4MXNA 1LM1A 1EA0A 2QYUA 3RIQA 2V5IA 2J8IA 2VBMA 5C1EA 1K5CA 1WMRA 3VMWA 3ZPPA 1H80A 1RMGA 4V02C 4XLFA 2BM5A 3N90A 1WXRA 4KH3A 3B4NA 2NTPA 4XR6A 2X6YA 1DBOA 3KRGA 3ML3A 2BSPA 4OJLA 4NK8A 3P4GA 4YZQA 2INVA 2IOUG 2O17A
chains in the Genus database with same CATH topology
2O04A 1DBGA 4XNFA 4XL9A 1JRGA 4XORA 1OOCA 4YELA 4XQFA 5AMVA 4XLHA 1HG8A 2VJIA 3B90A 3VSTA 4MR0A 4W8SA 1PLUA 4HWVA 4XLAA 2QX3A 1O8GA 1CZFA 2ODLA 2NTBA 4Z06A 3UW0A 1GQ8A 1XG2A 4YZXA 2QXZA 4EW9A 4U49A 1PE9A 4AVZA 4NK6A 1VBLA 4URRA 2UVFA 1RU4A 5C1CA 1IDJA 3T9GA 1O88A 1BHEA 1EE6A 3GQ9A 4Z03A 4XKVA 2O0VA 1O8KA 1O8EA 3ZSCA 2IQ7A 1KTWA 4OJPA 2INUA 4Z05A 2PYHA 1O8MA 4XM3A 1O8LA 4XLCA 2UVEA 3GRHA 1OGMX 4XMYA 1O8IA 1OFLA 4OJOA 4W8TA 2NSPA 4XOTA 4OJ6A 3SUCA 4C2LA 4YEJA 3VSVA 3GQAA 1JTAA 4OZZA 3FY3A 1X0CA 4YZ0A 4YZAA 2VJJA 2O0WA 2EWEA 3B8YA 3EQOA 1BN8A 2PECA 2NT6A 2QY1A 1IDKA 1O8FA 4XOPA 1NHCA 1O8JA 3GQ7A 2O1DA 2NT9A 2X6WA 4W8RA 1RWRA 2PYGA 1QCXA 2NSTA 1QJVA 1OGOX 3VMVA 1IB4A 4W8QA 1IA5A 2X3HA 3VSUA 4PMHA 3LMWA 1PXZA 1AIRA 2X85A 1O8HA 2VBKA 4I84A 4XKWA 4U4BA 1KCCA 4XN3A 4OJ5A 3JURA 3GQ8A 1O8DA 4XONA 1OFMA 2NZMA 4XN0A 2VBEA 2Z8GA 1KCDA 4OZYA 3EQNA 3WWGA 2X6XA 2NTQA 4XLEA 4MXNA 2VBMA 5C1EA 1K5CA 1WMRA 3VMWA 3ZPPA 1H80A 1RMGA 4XLFA 3B4NA 2NTPA 4XR6A 2X6YA 1DBOA 3KRGA 2BSPA 4OJLA 4NK8A 4YZQA 2INVA 2O17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  1DBG A;  4XNF A;  4XL9 A;  1JRG A;  4XOR A;  1OOC A;  4YEL A;  4XQF A;  5AMV A;  4XLH A;  1HG8 A;  2VJI A;  3B90 A;  3VST A;  4MR0 A;  4W8S A;  1PLU A;  4HWV A;  4XLA A;  2QX3 A;  1O8G A;  1CZF A;  2ODL A;  2NTB A;  4Z06 A;  3UW0 A;  1GQ8 A;  1XG2 A;  4YZX A;  2QXZ A;  4EW9 A;  4U49 A;  1PE9 A;  4AVZ A;  4NK6 A;  1VBL A;  4URR A;  2UVF A;  1RU4 A;  5C1C A;  1IDJ A;  3T9G A;  1O88 A;  1BHE A;  1EE6 A;  3GQ9 A;  4Z03 A;  4XKV A;  2O0V A;  1O8K A;  1O8E A;  3ZSC A;  2IQ7 A;  1KTW A;  4OJP A;  2INU A;  4Z05 A;  2PYH A;  1O8M A;  4XM3 A;  1O8L A;  4XLC A;  2UVE A;  3GRH A;  1OGM X;  4XMY A;  1O8I A;  1OFL A;  4OJO A;  4W8T A;  2NSP A;  4XOT A;  4OJ6 A;  3SUC A;  4C2L A;  4YEJ A;  3VSV A;  3GQA A;  1JTA A;  4OZZ A;  3FY3 A;  1X0C A;  4YZ0 A;  4YZA A;  2VJJ A;  2O0W A;  2EWE A;  3B8Y A;  3EQO A;  1BN8 A;  2PEC A;  2NT6 A;  2QY1 A;  1IDK A;  1O8F A;  4XOP A;  1NHC A;  1O8J A;  3GQ7 A;  2O1D A;  2NT9 A;  2X6W A;  4W8R A;  1RWR A;  2PYG A;  1QCX A;  2NST A;  1QJV A;  1OGO X;  3VMV A;  1IB4 A;  4W8Q A;  1IA5 A;  2X3H A;  3VSU A;  4PMH A;  3LMW A;  1PXZ A;  1AIR A;  2X85 A;  1O8H A;  2VBK A;  4I84 A;  4XKW A;  4U4B A;  1KCC A;  4XN3 A;  4OJ5 A;  3JUR A;  3GQ8 A;  1O8D A;  4XON A;  1OFM A;  2NZM A;  4XN0 A;  2VBE A;  2Z8G A;  1KCD A;  4OZY A;  3EQN A;  3WWG A;  2X6X A;  2NTQ A;  4XLE A;  4MXN A;  2VBM A;  5C1E A;  1K5C A;  1WMR A;  3VMW A;  3ZPP A;  1H80 A;  1RMG A;  4XLF A;  3B4N A;  2NTP A;  4XR6 A;  2X6Y A;  1DBO A;  3KRG A;  2BSP A;  4OJL A;  4NK8 A;  4YZQ A;  2INV A;  2O17 A; 
#chains in the Genus database with same CATH topology
 2O04 A;  1DBG A;  3TH0 A;  4XNF A;  2G0Y A;  4XL9 A;  1JRG A;  2XT4 A;  4XOR A;  1QRB A;  1OOC A;  4YEL A;  3SZE A;  5AMV A;  2BM6 A;  4XQF A;  4XLH A;  1HG8 A;  2VJI A;  1K8F A;  3B90 A;  3LYC A;  3SQV A;  3VST A;  4MR0 A;  2VFP A;  3DU1 X;  4W8S A;  1PLU A;  4HWV A;  4XLA A;  3PSS A;  2QX3 A;  1OFE A;  1O8G A;  2VFQ A;  1CZF A;  2ODL A;  2QZA A;  2W7Z A;  2J8K A;  2NTB A;  3JX8 A;  4Z06 A;  1LLW A;  3UW0 A;  1QA1 A;  1GQ8 A;  1XG2 A;  3NAW A;  4YZX A;  2QXZ A;  4EW9 A;  1K4Z A;  4YCQ A;  1OFD A;  4U49 A;  1PE9 A;  4AVZ A;  4NK6 A;  3SYJ A;  1VBL A;  2VFO A;  1CLW A;  2UVF A;  4URR A;  1RU4 A;  3PSZ A;  5C1C A;  2BX6 A;  3SY2 A;  1IDJ A;  3T9G A;  1O88 A;  2F3L A;  1BHE A;  1EE6 A;  3GQ9 A;  4XKV A;  4Z03 A;  3AK5 A;  2O0V A;  1KQ5 A;  1QA3 A;  1O8K A;  1O8E A;  4JRA C;  3ZSC A;  1TYU A;  2IQ7 A;  4OPW A;  2BM7 A;  2XT2 A;  5JMC B;  1KTW A;  4OJP A;  2INU A;  4Z05 A;  2PYH A;  1O8M A;  4XM3 A;  1QA2 A;  1O8L A;  4XLC A;  2UVE A;  3GRH A;  1OGM X;  4XMY A;  1O8I A;  3H09 A;  1OFL A;  4OJO A;  4W8T A;  2NSP A;  3N6Z A;  4XOT A;  3NB2 A;  1EZG A;  1TSP A;  4OJ6 A;  3SUC A;  3BH6 B;  4C2L A;  2XTY A;  4YEJ A;  2XTX A;  3VSV A;  3GQA A;  1JTA A;  4OZZ A;  3FY3 A;  1X0C A;  4YZ0 A;  4YZA A;  2VJJ A;  3BH7 B;  2O0W A;  2EWE A;  3B8Y A;  3EQO A;  1BN8 A;  4YC5 A;  2NT6 A;  1IDK A;  2PEC A;  2QY1 A;  1O8F A;  4XOP A;  1NHC A;  1O8J A;  2VFN A;  3GQ7 A;  2O1D A;  4YEI A;  1QQ1 A;  1L1I A;  2NT9 A;  2X6W A;  1HF2 A;  2XC1 A;  4W8R A;  1RWR A;  2PYG A;  4YDT A;  5DNS A;  1QCX A;  2NST A;  1QJV A;  1OGO X;  3VMV A;  1IB4 A;  2YUH A;  4W8Q A;  1IA5 A;  2X3H A;  4YFO A;  1TYW A;  4PMH A;  3VSU A;  3LMW A;  1PXZ A;  2B0R A;  1AIR A;  5JLV C;  2X85 A;  1O8H A;  2VBK A;  4I84 A;  1LLZ A;  3PET A;  4XKW A;  4U4B A;  1KCC A;  4XN3 A;  4OJ5 A;  2XTW A;  3JUR A;  3GQ8 A;  1O8D A;  1DAB A;  3LJY A;  2VFM A;  1TYV A;  4XON A;  4OM9 A;  1OFM A;  2NZM A;  4XN0 A;  2VBE A;  2Z8G A;  1KCD A;  4OZY A;  1QRC A;  2O6W A;  3EQN A;  1TYX A;  2BM4 A;  3WWG A;  2X6X A;  2NTQ A;  4XLE A;  4MXN A;  1LM1 A;  1EA0 A;  2QYU A;  3RIQ A;  2V5I A;  2J8I A;  2VBM A;  5C1E A;  1K5C A;  1WMR A;  3VMW A;  3ZPP A;  1H80 A;  1RMG A;  4V02 C;  4XLF A;  2BM5 A;  3N90 A;  1WXR A;  4KH3 A;  3B4N A;  2NTP A;  4XR6 A;  2X6Y A;  1DBO A;  3KRG A;  3ML3 A;  2BSP A;  4OJL A;  4NK8 A;  3P4G A;  4YZQ A;  2INV A;  2IOU G;  2O17 A; 
#chains in the Genus database with same CATH homology
 2O04 A;  1DBG A;  4XNF A;  4XL9 A;  1JRG A;  4XOR A;  1OOC A;  4YEL A;  4XQF A;  5AMV A;  4XLH A;  1HG8 A;  2VJI A;  3B90 A;  3VST A;  4MR0 A;  4W8S A;  1PLU A;  4HWV A;  4XLA A;  2QX3 A;  1O8G A;  1CZF A;  2ODL A;  2NTB A;  4Z06 A;  3UW0 A;  1GQ8 A;  1XG2 A;  4YZX A;  2QXZ A;  4EW9 A;  4U49 A;  1PE9 A;  4AVZ A;  4NK6 A;  1VBL A;  4URR A;  2UVF A;  1RU4 A;  5C1C A;  1IDJ A;  3T9G A;  1O88 A;  1BHE A;  1EE6 A;  3GQ9 A;  4Z03 A;  4XKV A;  2O0V A;  1O8K A;  1O8E A;  3ZSC A;  2IQ7 A;  1KTW A;  4OJP A;  2INU A;  4Z05 A;  2PYH A;  1O8M A;  4XM3 A;  1O8L A;  4XLC A;  2UVE A;  3GRH A;  1OGM X;  4XMY A;  1O8I A;  1OFL A;  4OJO A;  4W8T A;  2NSP A;  4XOT A;  4OJ6 A;  3SUC A;  4C2L A;  4YEJ A;  3VSV A;  3GQA A;  1JTA A;  4OZZ A;  3FY3 A;  1X0C A;  4YZ0 A;  4YZA A;  2VJJ A;  2O0W A;  2EWE A;  3B8Y A;  3EQO A;  1BN8 A;  2PEC A;  2NT6 A;  2QY1 A;  1IDK A;  1O8F A;  4XOP A;  1NHC A;  1O8J A;  3GQ7 A;  2O1D A;  2NT9 A;  2X6W A;  4W8R A;  1RWR A;  2PYG A;  1QCX A;  2NST A;  1QJV A;  1OGO X;  3VMV A;  1IB4 A;  4W8Q A;  1IA5 A;  2X3H A;  3VSU A;  4PMH A;  3LMW A;  1PXZ A;  1AIR A;  2X85 A;  1O8H A;  2VBK A;  4I84 A;  4XKW A;  4U4B A;  1KCC A;  4XN3 A;  4OJ5 A;  3JUR A;  3GQ8 A;  1O8D A;  4XON A;  1OFM A;  2NZM A;  4XN0 A;  2VBE A;  2Z8G A;  1KCD A;  4OZY A;  3EQN A;  3WWG A;  2X6X A;  2NTQ A;  4XLE A;  4MXN A;  2VBM A;  5C1E A;  1K5C A;  1WMR A;  3VMW A;  3ZPP A;  1H80 A;  1RMG A;  4XLF A;  3B4N A;  2NTP A;  4XR6 A;  2X6Y A;  1DBO A;  3KRG A;  2BSP A;  4OJL A;  4NK8 A;  4YZQ A;  2INV A;  2O17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...