4Z03A

C. bescii family 3 pectate lyase double mutant k108a in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 85
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z03A00
2INVA 2X6YA 4OJ6A 4XKWA 1GQ8A 1KCDA 1BN8A 3VSVA 1IB4A 2VJIA 1KTWA 1O8GA 2NTPA 4YEJA 3ZSCA 5AMVA 4HWVA 1EE6A 3UW0A 4URRA 1DBOA 2VBKA 4XLAA 4YZ0A 1OOCA 2PECA 2BSPA 1O8HA 2VJJA 5C1EA 1O8EA 2NTBA 3VMVA 4Z06A 4W8RA 3FY3A 1O8DA 4XORA 2NSPA 4XLHA 1DBGA 1O8LA 4MR0A 3WWGA 3JURA 2NSTA 4NK6A 4YZQA 4I84A 1KCCA 1XG2A 4YZAA 4XN3A 2O17A 3GQAA 4OJOA 2X6WA 4XNFA 4OJPA 1IDJA 1K5CA 1AIRA 4YELA 4U49A 4XKVA 1O8IA 5C1CA 1H80A 2PYGA 2NT6A 4YZXA 4Z03A 1O8KA 3GQ8A 3KRGA 4W8TA 1X0CA 1QCXA 3T9GA 2Z8GA 4XONA 1OFMA 2NTQA 1PLUA 4XQFA 4NK8A 3EQNA 1PE9A 1JTAA 2UVFA 3B4NA 1QJVA 4W8SA 4U4BA 4XLFA 4OJ5A 3VSUA 4W8QA 1PXZA 4XLEA 1JRGA 2QXZA 2VBEA 3LMWA 1VBLA 2O04A 3EQOA 1OGMX 4PMHA 4OZZA 1O8JA 2UVEA 1O8FA 4EW9A 1RU4A 2IQ7A 1WMRA 4OZYA 4XN0A 3B8YA 4XMYA 1NHCA 3B90A 4XM3A 1CZFA 4Z05A 2NZMA 2PYHA 3ZPPA 1O88A 2INUA 4XL9A 2X6XA 2O0WA 1IA5A 2EWEA 2ODLA 3GQ7A 4XR6A 3VSTA 3VMWA 2QY1A 3GRHA 2O1DA 1BHEA 1O8MA 1RWRA 1RMGA 1OFLA 2QX3A 4MXNA 2X3HA 3SUCA 4AVZA 4C2LA 1HG8A 1IDKA 2NT9A 2O0VA 4XLCA 2VBMA 4XOTA 1OGOX 3GQ9A 2X85A 4OJLA 4XOPA
chains in the Genus database with same CATH superfamily
2INVA 2X6YA 4OJ6A 4XKWA 3PSZA 5JLVC 1GQ8A 1KCDA 1BN8A 4YDTA 3VSVA 2VJIA 1EZGA 1KTWA 1O8GA 1TYVA 2NTPA 2B0RA 1IB4A 4YEJA 3ZSCA 5JMCB 5AMVA 4HWVA 1EE6A 3UW0A 2XTXA 4URRA 3AK5A 1DBOA 2VBKA 4XLAA 4YZ0A 1OOCA 1HF2A 2PECA 3LJYA 2BSPA 2XT4A 1O8HA 4YCQA 2VJJA 5C1EA 1O8EA 2W7ZA 4V02C 2NTBA 3VMVA 2VFQA 4Z06A 1QRCA 1LM1A 4W8RA 3FY3A 2J8KA 1O8DA 2V5IA 2VFOA 4XORA 2NSPA 4XLHA 1DBGA 1KQ5A 1O8LA 4MR0A 3WWGA 3JURA 3PSSA 2NSTA 4NK6A 3SYJA 1QA2A 4YZQA 2O6WA 1QRBA 4I84A 1KCCA 1XG2A 1OFEA 1K4ZA 4YZAA 3N6ZA 4XN3A 2O17A 2G0YA 3SZEA 1L1IA 3GQAA 4OJOA 1DABA 2X6WA 4XNFA 4OJPA 1IDJA 2XTWA 1K5CA 1AIRA 1QQ1A 4YELA 1WXRA 3PETA 4U49A 4XKVA 2XT2A 3TH0A 3LYCA 4YC5A 1O8IA 3NB2A 2F3LA 5C1CA 1H80A 2PYGA 1QA1A 2NT6A 2QZAA 3SY2A 3ML3A 4YZXA 4Z03A 1O8KA 2YUHA 4OPWA 3GQ8A 3KRGA 4W8TA 5DNSA 1X0CA 4YFOA 3NAWA 2VFMA 1QCXA 4KH3A 3BH7B 2Z8GA 3T9GA 4YEIA 4XONA 1OFMA 2NTQA 1PLUA 4XQFA 4NK8A 3EQNA 1PE9A 1JTAA 2UVFA 1CLWA 1OFDA 3B4NA 1QJVA 4JRAC 3RIQA 1QA3A 1LLZA 4W8SA 4U4BA 4XLFA 3N90A 4OJ5A 4OJLA 3VSUA 2VFNA 1PXZA 4W8QA 4XLEA 1JRGA 2QXZA 2VBEA 3P4GA 3LMWA 1VBLA 2O04A 2XTYA 2XC1A 2J8IA 3EQOA 1OGMX 4PMHA 4OM9A 4OZZA 1O8JA 1TYXA 3JX8A 2UVEA 1O8FA 1TYUA 4EW9A 2BM6A 1RU4A 2IQ7A 2VFPA 1WMRA 4OZYA 4XN0A 3B8YA 4XMYA 1NHCA 3B90A 4XM3A 1CZFA 4Z05A 2NZMA 2BM7A 2PYHA 3ZPPA 1O88A 2INUA 4XL9A 2X6XA 2O0WA 3DU1X 1IA5A 1LLWA 1EA0A 2EWEA 2ODLA 2BX6A 1K8FA 3GQ7A 4XR6A 3VSTA 3VMWA 2QY1A 3GRHA 2O1DA 1BHEA 1O8MA 1RWRA 1RMGA 1OFLA 2BM4A 2QX3A 2X3HA 1TYWA 4MXNA 3SUCA 4AVZA 4C2LA 2BM5A 1HG8A 1IDKA 2NT9A 2O0VA 3H09A 4XLCA 2VBMA 4XOTA 1OGOX 3SQVA 3BH6B 3GQ9A 2X85A 1TSPA 2QYUA 2IOUG 4XOPA
chains in the Genus database with same CATH topology
2INVA 2X6YA 4OJ6A 4XKWA 1GQ8A 1KCDA 1BN8A 3VSVA 1IB4A 2VJIA 1KTWA 1O8GA 2NTPA 4YEJA 3ZSCA 5AMVA 4HWVA 1EE6A 3UW0A 4URRA 1DBOA 2VBKA 4XLAA 4YZ0A 1OOCA 2PECA 2BSPA 1O8HA 2VJJA 5C1EA 1O8EA 2NTBA 3VMVA 4Z06A 4W8RA 3FY3A 1O8DA 4XORA 2NSPA 4XLHA 1DBGA 1O8LA 4MR0A 3WWGA 3JURA 2NSTA 4NK6A 4YZQA 4I84A 1KCCA 1XG2A 4YZAA 4XN3A 2O17A 3GQAA 4OJOA 2X6WA 4XNFA 4OJPA 1IDJA 1K5CA 1AIRA 4YELA 4U49A 4XKVA 1O8IA 5C1CA 1H80A 2PYGA 2NT6A 4YZXA 4Z03A 1O8KA 3GQ8A 3KRGA 4W8TA 1X0CA 1QCXA 3T9GA 2Z8GA 4XONA 1OFMA 2NTQA 1PLUA 4XQFA 4NK8A 3EQNA 1PE9A 1JTAA 2UVFA 3B4NA 1QJVA 4W8SA 4U4BA 4XLFA 4OJ5A 3VSUA 4W8QA 1PXZA 4XLEA 1JRGA 2QXZA 2VBEA 3LMWA 1VBLA 2O04A 3EQOA 1OGMX 4PMHA 4OZZA 1O8JA 2UVEA 1O8FA 4EW9A 1RU4A 2IQ7A 1WMRA 4OZYA 4XN0A 3B8YA 4XMYA 1NHCA 3B90A 4XM3A 1CZFA 4Z05A 2NZMA 2PYHA 3ZPPA 1O88A 2INUA 4XL9A 2X6XA 2O0WA 1IA5A 2EWEA 2ODLA 3GQ7A 4XR6A 3VSTA 3VMWA 2QY1A 3GRHA 2O1DA 1BHEA 1O8MA 1RWRA 1RMGA 1OFLA 2QX3A 4MXNA 2X3HA 3SUCA 4AVZA 4C2LA 1HG8A 1IDKA 2NT9A 2O0VA 4XLCA 2VBMA 4XOTA 1OGOX 3GQ9A 2X85A 4OJLA 4XOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INV A;  2X6Y A;  4OJ6 A;  4XKW A;  1GQ8 A;  1KCD A;  1BN8 A;  3VSV A;  1IB4 A;  2VJI A;  1KTW A;  1O8G A;  2NTP A;  4YEJ A;  3ZSC A;  5AMV A;  4HWV A;  1EE6 A;  3UW0 A;  4URR A;  1DBO A;  2VBK A;  4XLA A;  4YZ0 A;  1OOC A;  2PEC A;  2BSP A;  1O8H A;  2VJJ A;  5C1E A;  1O8E A;  2NTB A;  3VMV A;  4Z06 A;  4W8R A;  3FY3 A;  1O8D A;  4XOR A;  2NSP A;  4XLH A;  1DBG A;  1O8L A;  4MR0 A;  3WWG A;  3JUR A;  2NST A;  4NK6 A;  4YZQ A;  4I84 A;  1KCC A;  1XG2 A;  4YZA A;  4XN3 A;  2O17 A;  3GQA A;  4OJO A;  2X6W A;  4XNF A;  4OJP A;  1IDJ A;  1K5C A;  1AIR A;  4YEL A;  4U49 A;  4XKV A;  1O8I A;  5C1C A;  1H80 A;  2PYG A;  2NT6 A;  4YZX A;  4Z03 A;  1O8K A;  3GQ8 A;  3KRG A;  4W8T A;  1X0C A;  1QCX A;  3T9G A;  2Z8G A;  4XON A;  1OFM A;  2NTQ A;  1PLU A;  4XQF A;  4NK8 A;  3EQN A;  1PE9 A;  1JTA A;  2UVF A;  3B4N A;  1QJV A;  4W8S A;  4U4B A;  4XLF A;  4OJ5 A;  3VSU A;  4W8Q A;  1PXZ A;  4XLE A;  1JRG A;  2QXZ A;  2VBE A;  3LMW A;  1VBL A;  2O04 A;  3EQO A;  1OGM X;  4PMH A;  4OZZ A;  1O8J A;  2UVE A;  1O8F A;  4EW9 A;  1RU4 A;  2IQ7 A;  1WMR A;  4OZY A;  4XN0 A;  3B8Y A;  4XMY A;  1NHC A;  3B90 A;  4XM3 A;  1CZF A;  4Z05 A;  2NZM A;  2PYH A;  3ZPP A;  1O88 A;  2INU A;  4XL9 A;  2X6X A;  2O0W A;  1IA5 A;  2EWE A;  2ODL A;  3GQ7 A;  4XR6 A;  3VST A;  3VMW A;  2QY1 A;  3GRH A;  2O1D A;  1BHE A;  1O8M A;  1RWR A;  1RMG A;  1OFL A;  2QX3 A;  4MXN A;  2X3H A;  3SUC A;  4AVZ A;  4C2L A;  1HG8 A;  1IDK A;  2NT9 A;  2O0V A;  4XLC A;  2VBM A;  4XOT A;  1OGO X;  3GQ9 A;  2X85 A;  4OJL A;  4XOP A; 
#chains in the Genus database with same CATH topology
 2INV A;  2X6Y A;  4OJ6 A;  4XKW A;  3PSZ A;  5JLV C;  1GQ8 A;  1KCD A;  1BN8 A;  4YDT A;  3VSV A;  2VJI A;  1EZG A;  1KTW A;  1O8G A;  1TYV A;  2NTP A;  2B0R A;  1IB4 A;  4YEJ A;  3ZSC A;  5JMC B;  5AMV A;  4HWV A;  1EE6 A;  3UW0 A;  2XTX A;  4URR A;  3AK5 A;  1DBO A;  2VBK A;  4XLA A;  4YZ0 A;  1OOC A;  1HF2 A;  2PEC A;  3LJY A;  2BSP A;  2XT4 A;  1O8H A;  4YCQ A;  2VJJ A;  5C1E A;  1O8E A;  2W7Z A;  4V02 C;  2NTB A;  3VMV A;  2VFQ A;  4Z06 A;  1QRC A;  1LM1 A;  4W8R A;  3FY3 A;  2J8K A;  1O8D A;  2V5I A;  2VFO A;  4XOR A;  2NSP A;  4XLH A;  1DBG A;  1KQ5 A;  1O8L A;  4MR0 A;  3WWG A;  3JUR A;  3PSS A;  2NST A;  4NK6 A;  3SYJ A;  1QA2 A;  4YZQ A;  2O6W A;  1QRB A;  4I84 A;  1KCC A;  1XG2 A;  1OFE A;  1K4Z A;  4YZA A;  3N6Z A;  4XN3 A;  2O17 A;  2G0Y A;  3SZE A;  1L1I A;  3GQA A;  4OJO A;  1DAB A;  2X6W A;  4XNF A;  4OJP A;  1IDJ A;  2XTW A;  1K5C A;  1AIR A;  1QQ1 A;  4YEL A;  1WXR A;  3PET A;  4U49 A;  4XKV A;  2XT2 A;  3TH0 A;  3LYC A;  4YC5 A;  1O8I A;  3NB2 A;  2F3L A;  5C1C A;  1H80 A;  2PYG A;  1QA1 A;  2NT6 A;  2QZA A;  3SY2 A;  3ML3 A;  4YZX A;  4Z03 A;  1O8K A;  2YUH A;  4OPW A;  3GQ8 A;  3KRG A;  4W8T A;  5DNS A;  1X0C A;  4YFO A;  3NAW A;  2VFM A;  1QCX A;  4KH3 A;  3BH7 B;  2Z8G A;  3T9G A;  4YEI A;  4XON A;  1OFM A;  2NTQ A;  1PLU A;  4XQF A;  4NK8 A;  3EQN A;  1PE9 A;  1JTA A;  2UVF A;  1CLW A;  1OFD A;  3B4N A;  1QJV A;  4JRA C;  3RIQ A;  1QA3 A;  1LLZ A;  4W8S A;  4U4B A;  4XLF A;  3N90 A;  4OJ5 A;  4OJL A;  3VSU A;  2VFN A;  1PXZ A;  4W8Q A;  4XLE A;  1JRG A;  2QXZ A;  2VBE A;  3P4G A;  3LMW A;  1VBL A;  2O04 A;  2XTY A;  2XC1 A;  2J8I A;  3EQO A;  1OGM X;  4PMH A;  4OM9 A;  4OZZ A;  1O8J A;  1TYX A;  3JX8 A;  2UVE A;  1O8F A;  1TYU A;  4EW9 A;  2BM6 A;  1RU4 A;  2IQ7 A;  2VFP A;  1WMR A;  4OZY A;  4XN0 A;  3B8Y A;  4XMY A;  1NHC A;  3B90 A;  4XM3 A;  1CZF A;  4Z05 A;  2NZM A;  2BM7 A;  2PYH A;  3ZPP A;  1O88 A;  2INU A;  4XL9 A;  2X6X A;  2O0W A;  3DU1 X;  1IA5 A;  1LLW A;  1EA0 A;  2EWE A;  2ODL A;  2BX6 A;  1K8F A;  3GQ7 A;  4XR6 A;  3VST A;  3VMW A;  2QY1 A;  3GRH A;  2O1D A;  1BHE A;  1O8M A;  1RWR A;  1RMG A;  1OFL A;  2BM4 A;  2QX3 A;  2X3H A;  1TYW A;  4MXN A;  3SUC A;  4AVZ A;  4C2L A;  2BM5 A;  1HG8 A;  1IDK A;  2NT9 A;  2O0V A;  3H09 A;  4XLC A;  2VBM A;  4XOT A;  1OGO X;  3SQV A;  3BH6 B;  3GQ9 A;  2X85 A;  1TSP A;  2QYU A;  2IOU G;  4XOP A; 
#chains in the Genus database with same CATH homology
 2INV A;  2X6Y A;  4OJ6 A;  4XKW A;  1GQ8 A;  1KCD A;  1BN8 A;  3VSV A;  1IB4 A;  2VJI A;  1KTW A;  1O8G A;  2NTP A;  4YEJ A;  3ZSC A;  5AMV A;  4HWV A;  1EE6 A;  3UW0 A;  4URR A;  1DBO A;  2VBK A;  4XLA A;  4YZ0 A;  1OOC A;  2PEC A;  2BSP A;  1O8H A;  2VJJ A;  5C1E A;  1O8E A;  2NTB A;  3VMV A;  4Z06 A;  4W8R A;  3FY3 A;  1O8D A;  4XOR A;  2NSP A;  4XLH A;  1DBG A;  1O8L A;  4MR0 A;  3WWG A;  3JUR A;  2NST A;  4NK6 A;  4YZQ A;  4I84 A;  1KCC A;  1XG2 A;  4YZA A;  4XN3 A;  2O17 A;  3GQA A;  4OJO A;  2X6W A;  4XNF A;  4OJP A;  1IDJ A;  1K5C A;  1AIR A;  4YEL A;  4U49 A;  4XKV A;  1O8I A;  5C1C A;  1H80 A;  2PYG A;  2NT6 A;  4YZX A;  4Z03 A;  1O8K A;  3GQ8 A;  3KRG A;  4W8T A;  1X0C A;  1QCX A;  3T9G A;  2Z8G A;  4XON A;  1OFM A;  2NTQ A;  1PLU A;  4XQF A;  4NK8 A;  3EQN A;  1PE9 A;  1JTA A;  2UVF A;  3B4N A;  1QJV A;  4W8S A;  4U4B A;  4XLF A;  4OJ5 A;  3VSU A;  4W8Q A;  1PXZ A;  4XLE A;  1JRG A;  2QXZ A;  2VBE A;  3LMW A;  1VBL A;  2O04 A;  3EQO A;  1OGM X;  4PMH A;  4OZZ A;  1O8J A;  2UVE A;  1O8F A;  4EW9 A;  1RU4 A;  2IQ7 A;  1WMR A;  4OZY A;  4XN0 A;  3B8Y A;  4XMY A;  1NHC A;  3B90 A;  4XM3 A;  1CZF A;  4Z05 A;  2NZM A;  2PYH A;  3ZPP A;  1O88 A;  2INU A;  4XL9 A;  2X6X A;  2O0W A;  1IA5 A;  2EWE A;  2ODL A;  3GQ7 A;  4XR6 A;  3VST A;  3VMW A;  2QY1 A;  3GRH A;  2O1D A;  1BHE A;  1O8M A;  1RWR A;  1RMG A;  1OFL A;  2QX3 A;  4MXN A;  2X3H A;  3SUC A;  4AVZ A;  4C2L A;  1HG8 A;  1IDK A;  2NT9 A;  2O0V A;  4XLC A;  2VBM A;  4XOT A;  1OGO X;  3GQ9 A;  2X85 A;  4OJL A;  4XOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...