The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
107
|
sequence length |
237
|
structure length |
237
|
Chain Sequence |
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Nostoc sp.
|
molecule keywords |
All3740 protein
|
total genus |
107
|
structure length |
237
|
sequence length |
237
|
ec nomenclature | |
pdb deposition date | 2008-07-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
X | PF00805 | Pentapeptide | Pentapeptide repeats (8 copies) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | 3 Solenoid | Pectate Lyase C-like | E3 ubiquitin-protein ligase SopA |
#chains in the Genus database with same CATH superfamily 3DU1 X; 3NB2 A; 2QZA A; 4YEI A; 3PSS A; 4YCQ A; 4YC5 A; 2O6W A; 2XTY A; 4YDT A; 3NAW A; 2XT2 A; 5DNS A; 3SQV A; 3SY2 A; 2J8K A; 2XTX A; 2QYU A; 2XT4 A; 3PSZ A; 2XTW A; 4YFO A; #chains in the Genus database with same CATH topology 2NTP A; 4W8R A; 2NT6 A; 3EQN A; 5AMV A; 1IDJ A; 2BM5 A; 4YZQ A; 1QCX A; 4OJL A; 2EWE A; 1TYW A; 4OJ6 A; 1OFM A; 3BH6 B; 4I84 A; 4XOT A; 3NAW A; 3FY3 A; 1RMG A; 5DNS A; 2V5I A; 2O0W A; 3GRH A; 1BN8 A; 1PE9 A; 4OM9 A; 2INV A; 1X0C A; 2IOU G; 3GQA A; 3T9G A; 2VFQ A; 2VFP A; 4W8T A; 4XLE A; 2XTX A; 1KCD A; 2VJI A; 1EE6 A; 4V02 C; 3ML3 A; 1QJV A; 1OFE A; 1OFL A; 3AK5 A; 3EQO A; 2X6W A; 2BM6 A; 1O8H A; 4JRA C; 4C2L A; 3GQ9 A; 4XN0 A; 4XON A; 1O8D A; 4EW9 A; 1TSP A; 3NB2 A; 1AIR A; 1OGO X; 2NZM A; 2INU A; 2B0R A; 1LM1 A; 2QZA A; 4OJO A; 3ZSC A; 2O6W A; 3N6Z A; 2UVE A; 4YDT A; 2G0Y A; 2BM4 A; 1PLU A; 1EA0 A; 1RU4 A; 3VSU A; 2XT2 A; 1DBG A; 4HWV A; 1CZF A; 4YZX A; 4Z06 A; 1O88 A; 3JX8 A; 1CLW A; 1IDK A; 2W7Z A; 1O8I A; 1OOC A; 3SUC A; 1QRB A; 2J8K A; 2QX3 A; 5C1E A; 2O04 A; 1O8F A; 1PXZ A; 2IQ7 A; 1EZG A; 1OGM X; 2VFM A; 3LMW A; 4OJ5 A; 4XLH A; 3TH0 A; 5JLV C; 2X85 A; 1K8F A; 4MXN A; 4PMH A; 1O8K A; 2NTQ A; 2BX6 A; 4XL9 A; 1O8L A; 3LYC A; 3LJY A; 2F3L A; 1K4Z A; 4XKW A; 3WWG A; 4YEJ A; 4OPW A; 1L1I A; 3B90 A; 1TYV A; 3H09 A; 4XLA A; 3GQ8 A; 3GQ7 A; 2VBM A; 4XR6 A; 2X6Y A; 1HG8 A; 1O8J A; 2QXZ A; 2O17 A; 4W8Q A; 2NTB A; 4Z05 A; 1TYU A; 4NK6 A; 4XMY A; 4XOR A; 3P4G A; 4URR A; 1QA1 A; 3N90 A; 4U4B A; 2NT9 A; 2PYG A; 3VSV A; 2J8I A; 1LLZ A; 4XLF A; 2VFN A; 1JRG A; 4OZY A; 3ZPP A; 1JTA A; 2PEC A; 1DBO A; 4KH3 A; 1HF2 A; 4MR0 A; 4XKV A; 1K5C A; 2ODL A; 2QY1 A; 2BM7 A; 2QYU A; 1VBL A; 4Z03 A; 3VST A; 1QA2 A; 3RIQ A; 3VMW A; 3SZE A; 1LLW A; 3DU1 X; 3UW0 A; 2VFO A; 4XN3 A; 1OFD A; 3BH7 B; 2NSP A; 4OJP A; 2BSP A; 3KRG A; 3PSS A; 1KTW A; 4YCQ A; 4NK8 A; 4U49 A; 4YC5 A; 4YEI A; 2VBK A; 4XNF A; 1IB4 A; 2VJJ A; 2X3H A; 2XTY A; 1TYX A; 1IA5 A; 3B8Y A; 1XG2 A; 4XQF A; 2VBE A; 3PET A; 1KQ5 A; 2O1D A; 1QA3 A; 3VMV A; 1NHC A; 5JMC B; 1WMR A; 4OZZ A; 3SQV A; 3SYJ A; 1WXR A; 3JUR A; 2NST A; 3SY2 A; 2XC1 A; 1KCC A; 1H80 A; 2UVF A; 2X6X A; 4AVZ A; 4YZ0 A; 1GQ8 A; 2PYH A; 4W8S A; 1O8G A; 2YUH A; 1BHE A; 1O8M A; 4YZA A; 2O0V A; 5C1C A; 2Z8G A; 4YEL A; 4XOP A; 2XT4 A; 3PSZ A; 4XM3 A; 1QQ1 A; 2XTW A; 1QRC A; 3B4N A; 1O8E A; 4YFO A; 4XLC A; 1DAB A; 1RWR A; #chains in the Genus database with same CATH homology 3DU1 X; 3NB2 A; 2QZA A; 4YEI A; 3PSS A; 4YCQ A; 4YC5 A; 2O6W A; 2XTY A; 4YDT A; 3NAW A; 2XT2 A; 5DNS A; 3SQV A; 3SY2 A; 2J8K A; 2XTX A; 2QYU A; 2XT4 A; 3PSZ A; 2XTW A; 4YFO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...