1BUSA

Solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
b'EGAQVDCAEFKDPKVYCTRESNPHCGSNGETYGNKCAFCKAVMKSGGKINLKHRGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE INHIBITOR IIA
publication title Solution conformation of proteinase inhibitor IIA from bull seminal plasma by 1H nuclear magnetic resonance and distance geometry.
pubmed doi rcsb
source organism Bos taurus
molecule tags Proteinase inhibitor
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1990-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1busA00
2BUSA 3OVOA 1BUSA 2SGEI 2JYYA 3HH2C 1LR7A 2SGQI 1PJUA 2LEOA 1CHOI 1CGII 1UUCA 2OVOA 1SGYI 2NU3I 4GI3C 1TIHA 1IW4A 1SGNI 2B0UC 3SEKC 3SGQI 2QQDA 1AN1I 2V53A 1OVOA 5DAEA 1HJAI 1CT0I 1SGRI 1CE3A 1UVGA 1LR8A 1H0ZA 1OMTA 2WCYA 1HPTA 1UVFA 2JXDA 1OYVI 1IY6A 2KMPA 1PPFI 2GKRI 1CSOI 1YTPA 2SGPI 1SGDI 2SGFI 1DS2I 1TUSA 1M8BA 1LR9A 2N71A 1FYBA 1TBRR 1NUBA 2GKTI 2N52A 1CT4I 1BMOA 1R0RI 2ARPF 1MT1A 2SGDI 1N13A 1CT2I 1HDLA 1PCEA 1Z7KB 1Y1BA 1SGEI 1CGJI 2KMRA 2M5XA 3TJQA 1SGQI 1TURA 2XRCA 2NU4I 4SGBI 1M8CA 3QTLD 3B4VC 1IY5A 5JHWC 2NU2I 2GKVA 2KMOA 2ERWA 1SGPI 1TBQR 1TGSI 3SGBI 4HGUA 2KMQA 1OMUA 1Y1CA 2KCXA 2P6AC 2F3CI 2JZMA 2N17A 1DS3I 4OVOA 2NU0I 2QQCA 2NU1I 1KMAA 1YU6C
chains in the Genus database with same CATH superfamily
2BUSA 2J87A 2QQEA 2LUYA 2YUUA 2J9RA 1TOTA 1FY7A 2YQPA 3OVOA 2E5RA 2ODDA 2SGEI 3UGIA 2OD1A 2X3TA 1ULKA 2JYYA 3UEYA 2W0TA 3HH2C 1WGTA 1LR7A 2SGQI 3VE5A 1MJBA 1PJUA 2LEOA 1CHOI 1CGII 4E1RA 3FSXA 2E73A 1KBFA 3QWPA 1UUCA 2QQ0A 3VDPA 2OVOA 1SGYI 3TO6A 2NU3I 4GI3C 2QPOA 1TIHA 2OU2A 3RU0A 2ORVA 1IW4A 1SGNI 1WGCA 3TO7A 2B0UC 3SEKC 3UEJA 1WKXA 3FC3A 1PTRA 5J8FA 3SGQI 2QQDA 1AN1I 2ENZA 2V1CA 5EX0A 5CCMA 2V53A 2WGCA 1OVOA 1ULMA 5DAEA 1UHAA 1HJAI 1WTJA 2Y0MA 1XBTA 4MPIA 5J8CA 3KY9A 5CCLA 1CT0I 3GOXA 1K7UA 1SGRI 3OXLA 4UXHA 3VDUA 3MEKA 1BUSA 1CE3A 1UVGA 2DKVA 2CWFA 1LR8A 1K7TA 1H0ZA 2A20A 1OMTA 2CWGA 5FUVA 2WCYA 1HPTA 1UVFA 2B8TA 2JXDA 2RC4A 4UXJA 2V1CC 3OXGA 1OYVI 2L8EA 1X4SA 1X74A 3OXFA 1W3SA 2KMPA 2UVOA 2WVJA 1IY6A 1K7VA 1PPFI 1TBNA 1XX6A 1CSOI 1YTPA 2GKRI 3UOEA 2SGPI 1SGDI 2SGFI 5FUYA 2DB6A 1DS2I 4JCVE 1TUSA 1P9ZA 4DNCA 1FAQA 1M8BA 1LR9A 3R5AA 5FUWA 1U5KA 2N71A 1FYBA 4B6DA 1TBRR 3UFFA 1NUBA 2GKTI 2OZUA 2N52A 3TOBA 1CT4I 3R5BA 2CJSC 1BMOA 1R0RI 2ARPF 2CWHA 1MT1A 2DIPA 2ROWA 2SGDI 2ENNA 9WGAA 4UXIA 1N13A 2GVIA 3R5DA 2X52A 1CT2I 1TBOA 1HDLA 1PCEA 1Z7KB 1KBEA 1Y1BA 4AMLA 4A24A 1Y8FA 4WP4A 2N1AB 3R5CA 1PTQA 1P9GA 1SGEI 3UGDA 1CGJI 5EX3A 2KMRA 1RFHA 1S20A 2PQ8A 2JW6A 2L7XA 1VDDA 1MJ9A 1R79A 1XA6A 2M5XA 3TJQA 1SGQI 2LB7A 2ORWA 1TURA 2XRCA 4E1PA 1MJAA 2VRWB 2NU4I 3CXLA 3OL0A 4SGBI 5FUXA 1M8CA 3QTLD 4L9MA 3B4VC 5HQ8A 1NXUA 1IY5A 7WGAA 5JHWC 2NU2I 1Q9BA 2GKVA 1FARA 1V1IA 2KMOA 2JA1A 2ELIA 3UGLA 2FNFX 1V1HA 3TOAA 2ERWA 2UZ3A 1SGPI 1TBQR 3PDNA 5E3PA 1TGSI 1Z2IA 3SGBI 2GIVA 1W4RA 4HGUA 3E59A 3E2IA 4FKDA 5E3RA 2RIJA 2KMQA 3BJIA 1OMUA 1Y1CA 2KCXA 2P6AC 2F3CI 2JZMA 1ULNA 3TO9A 2N17A 1DS3I 3QAHA 2K9HA 4OVOA 5E3QA 2NU0I 2QQCA 1HEVA 5HI7A 3FSYA 2NU1I 1KMAA 1YU6C 3D00A
chains in the Genus database with same CATH topology
2BUSA 2J87A 2QQEA 2LUYA 2YUUA 2J9RA 1TOTA 2YQPA 3OVOA 2E5RA 2ODDA 2SGEI 3UGIA 2OD1A 3UEYA 1BUSA 2JYYA 2W0TA 3HH2C 1LR7A 2SGQI 3VE5A 1PJUA 2LEOA 1CHOI 1CGII 4E1RA 1KBFA 2E73A 3QWPA 1UUCA 2QQ0A 3VDPA 2OVOA 1SGYI 2NU3I 4GI3C 2QPOA 1TIHA 1IW4A 3RU0A 2ORVA 1SGNI 3UEJA 2B0UC 3SEKC 3FC3A 1PTRA 3SGQI 2QQDA 1AN1I 2ENZA 2V1CA 5EX0A 5CCMA 2V53A 1OVOA 5DAEA 1HJAI 1XBTA 3KY9A 5CCLA 1CT0I 3GOXA 3OXLA 1SGRI 4UXHA 3VDUA 3MEKA 1CE3A 1UVGA 1LR8A 1H0ZA 2A20A 1OMTA 5FUVA 2WCYA 1HPTA 1UVFA 2B8TA 2JXDA 4UXJA 2V1CC 3OXGA 1OYVI 2L8EA 1X4SA 1X74A 3OXFA 1W3SA 2KMPA 1IY6A 2WVJA 1TBNA 1PPFI 1XX6A 2GKRI 1CSOI 1YTPA 2SGPI 1SGDI 2SGFI 5FUYA 2DB6A 1DS2I 4JCVE 1TUSA 1FAQA 1M8BA 1LR9A 5FUWA 1U5KA 2N71A 1FYBA 4B6DA 1TBRR 3UFFA 1NUBA 2GKTI 2N52A 1CT4I 2CJSC 1BMOA 1R0RI 2ARPF 2ROWA 1MT1A 2DIPA 2SGDI 2ENNA 4UXIA 1N13A 2GVIA 1CT2I 1TBOA 1HDLA 1PCEA 1Z7KB 1KBEA 1Y1BA 4A24A 1Y8FA 2N1AB 3UGDA 1PTQA 1SGEI 1CGJI 5EX3A 2KMRA 1RFHA 2JW6A 2L7XA 1VDDA 1R79A 1XA6A 2M5XA 3TJQA 1SGQI 2ORWA 1TURA 2XRCA 4E1PA 2VRWB 3CXLA 2NU4I 3OL0A 4SGBI 5FUXA 1M8CA 3QTLD 4L9MA 3B4VC 5HQ8A 1IY5A 5JHWC 2NU2I 2GKVA 1FARA 1V1IA 2KMOA 2JA1A 2ELIA 3UGLA 2FNFX 1V1HA 2ERWA 2UZ3A 1SGPI 1TBQR 3PDNA 1TGSI 3SGBI 1W4RA 4HGUA 3E59A 3E2IA 4FKDA 2KMQA 3BJIA 1OMUA 1Y1CA 2KCXA 2P6AC 2F3CI 2JZMA 2N17A 1DS3I 2K9HA 4OVOA 2NU0I 2QQCA 5HI7A 2NU1I 1KMAA 1YU6C 3D00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUS A;  3OVO A;  1BUS A;  2SGE I;  2JYY A;  3HH2 C;  1LR7 A;  2SGQ I;  1PJU A;  2LEO A;  1CHO I;  1CGI I;  1UUC A;  2OVO A;  1SGY I;  2NU3 I;  4GI3 C;  1TIH A;  1IW4 A;  1SGN I;  2B0U C;  3SEK C;  3SGQ I;  2QQD A;  1AN1 I;  2V53 A;  1OVO A;  5DAE A;  1HJA I;  1CT0 I;  1SGR I;  1CE3 A;  1UVG A;  1LR8 A;  1H0Z A;  1OMT A;  2WCY A;  1HPT A;  1UVF A;  2JXD A;  1OYV I;  1IY6 A;  2KMP A;  1PPF I;  2GKR I;  1CSO I;  1YTP A;  2SGP I;  1SGD I;  2SGF I;  1DS2 I;  1TUS A;  1M8B A;  1LR9 A;  2N71 A;  1FYB A;  1TBR R;  1NUB A;  2GKT I;  2N52 A;  1CT4 I;  1BMO A;  1R0R I;  2ARP F;  1MT1 A;  2SGD I;  1N13 A;  1CT2 I;  1HDL A;  1PCE A;  1Z7K B;  1Y1B A;  1SGE I;  1CGJ I;  2KMR A;  2M5X A;  3TJQ A;  1SGQ I;  1TUR A;  2XRC A;  2NU4 I;  4SGB I;  1M8C A;  3QTL D;  3B4V C;  1IY5 A;  5JHW C;  2NU2 I;  2GKV A;  2KMO A;  2ERW A;  1SGP I;  1TBQ R;  1TGS I;  3SGB I;  4HGU A;  2KMQ A;  1OMU A;  1Y1C A;  2KCX A;  2P6A C;  2F3C I;  2JZM A;  2N17 A;  1DS3 I;  4OVO A;  2NU0 I;  2QQC A;  2NU1 I;  1KMA A;  1YU6 C; 
#chains in the Genus database with same CATH topology
 2BUS A;  2J87 A;  2QQE A;  2LUY A;  2YUU A;  2J9R A;  1TOT A;  1FY7 A;  2YQP A;  3OVO A;  2E5R A;  2ODD A;  2SGE I;  3UGI A;  2OD1 A;  2X3T A;  1ULK A;  2JYY A;  3UEY A;  2W0T A;  3HH2 C;  1WGT A;  1LR7 A;  2SGQ I;  3VE5 A;  1MJB A;  1PJU A;  2LEO A;  1CHO I;  1CGI I;  4E1R A;  3FSX A;  2E73 A;  1KBF A;  3QWP A;  1UUC A;  2QQ0 A;  3VDP A;  2OVO A;  1SGY I;  3TO6 A;  2NU3 I;  4GI3 C;  2QPO A;  1TIH A;  2OU2 A;  3RU0 A;  2ORV A;  1IW4 A;  1SGN I;  1WGC A;  3TO7 A;  2B0U C;  3SEK C;  3UEJ A;  1WKX A;  3FC3 A;  1PTR A;  5J8F A;  3SGQ I;  2QQD A;  1AN1 I;  2ENZ A;  2V1C A;  5EX0 A;  5CCM A;  2V53 A;  2WGC A;  1OVO A;  1ULM A;  5DAE A;  1UHA A;  1HJA I;  1WTJ A;  2Y0M A;  1XBT A;  4MPI A;  5J8C A;  3KY9 A;  5CCL A;  1CT0 I;  3GOX A;  1K7U A;  1SGR I;  3OXL A;  4UXH A;  3VDU A;  3MEK A;  1BUS A;  1CE3 A;  1UVG A;  2DKV A;  2CWF A;  1LR8 A;  1K7T A;  1H0Z A;  2A20 A;  1OMT A;  2CWG A;  5FUV A;  2WCY A;  1HPT A;  1UVF A;  2B8T A;  2JXD A;  2RC4 A;  4UXJ A;  2V1C C;  3OXG A;  1OYV I;  2L8E A;  1X4S A;  1X74 A;  3OXF A;  1W3S A;  2KMP A;  2UVO A;  2WVJ A;  1IY6 A;  1K7V A;  1PPF I;  1TBN A;  1XX6 A;  1CSO I;  1YTP A;  2GKR I;  3UOE A;  2SGP I;  1SGD I;  2SGF I;  5FUY A;  2DB6 A;  1DS2 I;  4JCV E;  1TUS A;  1P9Z A;  4DNC A;  1FAQ A;  1M8B A;  1LR9 A;  3R5A A;  5FUW A;  1U5K A;  2N71 A;  1FYB A;  4B6D A;  1TBR R;  3UFF A;  1NUB A;  2GKT I;  2OZU A;  2N52 A;  3TOB A;  1CT4 I;  3R5B A;  2CJS C;  1BMO A;  1R0R I;  2ARP F;  2CWH A;  1MT1 A;  2DIP A;  2ROW A;  2SGD I;  2ENN A;  9WGA A;  4UXI A;  1N13 A;  2GVI A;  3R5D A;  2X52 A;  1CT2 I;  1TBO A;  1HDL A;  1PCE A;  1Z7K B;  1KBE A;  1Y1B A;  4AML A;  4A24 A;  1Y8F A;  4WP4 A;  2N1A B;  3R5C A;  1PTQ A;  1P9G A;  1SGE I;  3UGD A;  1CGJ I;  5EX3 A;  2KMR A;  1RFH A;  1S20 A;  2PQ8 A;  2JW6 A;  2L7X A;  1VDD A;  1MJ9 A;  1R79 A;  1XA6 A;  2M5X A;  3TJQ A;  1SGQ I;  2LB7 A;  2ORW A;  1TUR A;  2XRC A;  4E1P A;  1MJA A;  2VRW B;  2NU4 I;  3CXL A;  3OL0 A;  4SGB I;  5FUX A;  1M8C A;  3QTL D;  4L9M A;  3B4V C;  5HQ8 A;  1NXU A;  1IY5 A;  7WGA A;  5JHW C;  2NU2 I;  1Q9B A;  2GKV A;  1FAR A;  1V1I A;  2KMO A;  2JA1 A;  2ELI A;  3UGL A;  2FNF X;  1V1H A;  3TOA A;  2ERW A;  2UZ3 A;  1SGP I;  1TBQ R;  3PDN A;  5E3P A;  1TGS I;  1Z2I A;  3SGB I;  2GIV A;  1W4R A;  4HGU A;  3E59 A;  3E2I A;  4FKD A;  5E3R A;  2RIJ A;  2KMQ A;  3BJI A;  1OMU A;  1Y1C A;  2KCX A;  2P6A C;  2F3C I;  2JZM A;  1ULN A;  3TO9 A;  2N17 A;  1DS3 I;  3QAH A;  2K9H A;  4OVO A;  5E3Q A;  2NU0 I;  2QQC A;  1HEV A;  5HI7 A;  3FSY A;  2NU1 I;  1KMA A;  1YU6 C;  3D00 A; 
#chains in the Genus database with same CATH homology
 2BUS A;  2J87 A;  2QQE A;  2LUY A;  2YUU A;  2J9R A;  1TOT A;  2YQP A;  3OVO A;  2E5R A;  2ODD A;  2SGE I;  3UGI A;  2OD1 A;  3UEY A;  1BUS A;  2JYY A;  2W0T A;  3HH2 C;  1LR7 A;  2SGQ I;  3VE5 A;  1PJU A;  2LEO A;  1CHO I;  1CGI I;  4E1R A;  1KBF A;  2E73 A;  3QWP A;  1UUC A;  2QQ0 A;  3VDP A;  2OVO A;  1SGY I;  2NU3 I;  4GI3 C;  2QPO A;  1TIH A;  1IW4 A;  3RU0 A;  2ORV A;  1SGN I;  3UEJ A;  2B0U C;  3SEK C;  3FC3 A;  1PTR A;  3SGQ I;  2QQD A;  1AN1 I;  2ENZ A;  2V1C A;  5EX0 A;  5CCM A;  2V53 A;  1OVO A;  5DAE A;  1HJA I;  1XBT A;  3KY9 A;  5CCL A;  1CT0 I;  3GOX A;  3OXL A;  1SGR I;  4UXH A;  3VDU A;  3MEK A;  1CE3 A;  1UVG A;  1LR8 A;  1H0Z A;  2A20 A;  1OMT A;  5FUV A;  2WCY A;  1HPT A;  1UVF A;  2B8T A;  2JXD A;  4UXJ A;  2V1C C;  3OXG A;  1OYV I;  2L8E A;  1X4S A;  1X74 A;  3OXF A;  1W3S A;  2KMP A;  1IY6 A;  2WVJ A;  1TBN A;  1PPF I;  1XX6 A;  2GKR I;  1CSO I;  1YTP A;  2SGP I;  1SGD I;  2SGF I;  5FUY A;  2DB6 A;  1DS2 I;  4JCV E;  1TUS A;  1FAQ A;  1M8B A;  1LR9 A;  5FUW A;  1U5K A;  2N71 A;  1FYB A;  4B6D A;  1TBR R;  3UFF A;  1NUB A;  2GKT I;  2N52 A;  1CT4 I;  2CJS C;  1BMO A;  1R0R I;  2ARP F;  2ROW A;  1MT1 A;  2DIP A;  2SGD I;  2ENN A;  4UXI A;  1N13 A;  2GVI A;  1CT2 I;  1TBO A;  1HDL A;  1PCE A;  1Z7K B;  1KBE A;  1Y1B A;  4A24 A;  1Y8F A;  2N1A B;  3UGD A;  1PTQ A;  1SGE I;  1CGJ I;  5EX3 A;  2KMR A;  1RFH A;  2JW6 A;  2L7X A;  1VDD A;  1R79 A;  1XA6 A;  2M5X A;  3TJQ A;  1SGQ I;  2ORW A;  1TUR A;  2XRC A;  4E1P A;  2VRW B;  3CXL A;  2NU4 I;  3OL0 A;  4SGB I;  5FUX A;  1M8C A;  3QTL D;  4L9M A;  3B4V C;  5HQ8 A;  1IY5 A;  5JHW C;  2NU2 I;  2GKV A;  1FAR A;  1V1I A;  2KMO A;  2JA1 A;  2ELI A;  3UGL A;  2FNF X;  1V1H A;  2ERW A;  2UZ3 A;  1SGP I;  1TBQ R;  3PDN A;  1TGS I;  3SGB I;  1W4R A;  4HGU A;  3E59 A;  3E2I A;  4FKD A;  2KMQ A;  3BJI A;  1OMU A;  1Y1C A;  2KCX A;  2P6A C;  2F3C I;  2JZM A;  2N17 A;  1DS3 I;  2K9H A;  4OVO A;  2NU0 I;  2QQC A;  5HI7 A;  2NU1 I;  1KMA A;  1YU6 C;  3D00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...