1K7UA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,4glcnac complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
total genus 45
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA04
1ULNA 4WP4A 1K7VA 2UVOA 1UHAA 2X3TA 9WGAA 1Q9BA 4MPIA 2WGCA 1ULKA 2X52A 4AMLA 2DKVA 1P9GA 1HEVA 1WKXA 1K7TA 2CWGA 1K7UA 7WGAA 1P9ZA 1WGCA 1WGTA 2LB7A 1ULMA
chains in the Genus database with same CATH superfamily
3GOXA 1SGQI 1ULNA 4WP4A 2F3CI 1X74A 2ROWA 4HGUA 4L9MA 1DS2I 1TBRR 2GIVA 3VE5A 2PQ8A 2N71A 1TOTA 4DNCA 1FYBA 5E3RA 5HI7A 2SGQI 2Y0MA 3MEKA 1FAQA 5HQ8A 1U5KA 2B8TA 3D00A 1SGDI 1KBFA 1Y8FA 4UXHA 2K9HA 3TOBA 1V1IA 1CE3A 5E3PA 3UEYA 1OMTA 2CWGA 2OU2A 3PDNA 2WVJA 1BMOA 2CWHA 3TJQA 3RU0A 2N17A 1M8BA 1XA6A 2V53A 2N1AB 2JA1A 1CGII 1SGNI 4A24A 1R79A 1WGCA 2XRCA 1TBNA 1MT1A 1TIHA 1MJBA 2UZ3A 1CHOI 2P6AC 1TBOA 2RC4A 2RIJA 3OVOA 3R5AA 4JCVE 1NXUA 5JHWC 1X4SA 2ENNA 2YUUA 4FKDA 1Y1CA 1W4RA 2BUSA 2V1CA 3TO9A 2L8EA 1IY5A 2WCYA 2NU3I 1S20A 2B0UC 4AMLA 2DIPA 1OVOA 2JW6A 5DAEA 3UEJA 1Y1BA 2DKVA 1P9GA 1TURA 1PPFI 1TGSI 1Z7KB 2ORWA 3TO7A 3SEKC 3TO6A 1N13A 1TBQR 2QPOA 1XX6A 2ERWA 2SGPI 2KMRA 3UOEA 2QQ0A 1YTPA 3BJIA 2E5RA 5CCMA 2J87A 5EX0A 3FSYA 1CGJI 3CXLA 1P9ZA 1CT4I 2NU1I 2L7XA 1WGTA 4B6DA 3TOAA 2A20A 1ULMA 2E73A 2GKTI 1KBEA 1NUBA 1LR7A 5J8CA 1CSOI 1IY6A 5FUYA 3OXLA 1FY7A 1FARA 1UVGA 2QQEA 2UVOA 5FUWA 1HPTA 3VDPA 2ARPF 1IW4A 3OXFA 2FNFX 3B4VC 3OL0A 9WGAA 5FUVA 1V1HA 2SGDI 3E2IA 1DS3I 1LR8A 1LR9A 1SGPI 1SGRI 2DB6A 2JXDA 3E59A 3UGIA 1BUSA 1Z2IA 3SGBI 1KMAA 3FSXA 2KMQA 3VDUA 2KMPA 5CCLA 2SGEI 1MJ9A 1YU6C 2ENZA 5E3QA 2CJSC 3R5BA 3UGLA 2J9RA 3FC3A 2LEOA 1PJUA 2ODDA 4E1RA 1SGYI 1PCEA 2SGFI 7WGAA 2M5XA 3OXGA 4OVOA 2LB7A 4UXIA 4SGBI 1CT0I 1PTQA 2GKVA 2JZMA 2VRWB 1K7VA 2V1CC 2W0TA 3HH2C 5EX3A 1MJAA 1TUSA 4GI3C 1AN1I 2ORVA 1HDLA 1XBTA 1R0RI 1HJAI 1SGEI 2CWFA 2GVIA 1CT2I 1W3SA 1UHAA 2YQPA 3QTLD 1WTJA 2X3TA 1RFHA 3QAHA 2QQDA 5FUXA 2LUYA 2JYYA 2OZUA 4MPIA 2WGCA 1ULKA 2X52A 1UUCA 2KCXA 3R5DA 1M8CA 3UGDA 1VDDA 2GKRI 2KMOA 3R5CA 1HEVA 4UXJA 2NU0I 2NU2I 2QQCA 5J8FA 1WKXA 1UVFA 1K7TA 4E1PA 1OYVI 1K7UA 2ELIA 2OVOA 3UFFA 1PTRA 2N52A 3KY9A 3QWPA 1H0ZA 2NU4I 1OMUA 3SGQI 2OD1A 1Q9BA
chains in the Genus database with same CATH topology
1ULNA 4WP4A 1K7VA 2UVOA 1UHAA 2X3TA 9WGAA 1Q9BA 4MPIA 2WGCA 1ULKA 2X52A 4AMLA 2DKVA 1P9GA 1HEVA 1WKXA 1K7TA 2CWGA 1K7UA 7WGAA 1P9ZA 1WGCA 1WGTA 2LB7A 1ULMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULN A;  4WP4 A;  1K7V A;  2UVO A;  1UHA A;  2X3T A;  9WGA A;  1Q9B A;  4MPI A;  2WGC A;  1ULK A;  2X52 A;  4AML A;  2DKV A;  1P9G A;  1HEV A;  1WKX A;  1K7T A;  2CWG A;  1K7U A;  7WGA A;  1P9Z A;  1WGC A;  1WGT A;  2LB7 A;  1ULM A; 
#chains in the Genus database with same CATH topology
 3GOX A;  1SGQ I;  1ULN A;  4WP4 A;  2F3C I;  1X74 A;  2ROW A;  4HGU A;  4L9M A;  1DS2 I;  1TBR R;  2GIV A;  3VE5 A;  2PQ8 A;  2N71 A;  1TOT A;  4DNC A;  1FYB A;  5E3R A;  5HI7 A;  2SGQ I;  2Y0M A;  3MEK A;  1FAQ A;  5HQ8 A;  1U5K A;  2B8T A;  3D00 A;  1SGD I;  1KBF A;  1Y8F A;  4UXH A;  2K9H A;  3TOB A;  1V1I A;  1CE3 A;  5E3P A;  3UEY A;  1OMT A;  2CWG A;  2OU2 A;  3PDN A;  2WVJ A;  1BMO A;  2CWH A;  3TJQ A;  3RU0 A;  2N17 A;  1M8B A;  1XA6 A;  2V53 A;  2N1A B;  2JA1 A;  1CGI I;  1SGN I;  4A24 A;  1R79 A;  1WGC A;  2XRC A;  1TBN A;  1MT1 A;  1TIH A;  1MJB A;  2UZ3 A;  1CHO I;  2P6A C;  1TBO A;  2RC4 A;  2RIJ A;  3OVO A;  3R5A A;  4JCV E;  1NXU A;  5JHW C;  1X4S A;  2ENN A;  2YUU A;  4FKD A;  1Y1C A;  1W4R A;  2BUS A;  2V1C A;  3TO9 A;  2L8E A;  1IY5 A;  2WCY A;  2NU3 I;  1S20 A;  2B0U C;  4AML A;  2DIP A;  1OVO A;  2JW6 A;  5DAE A;  3UEJ A;  1Y1B A;  2DKV A;  1P9G A;  1TUR A;  1PPF I;  1TGS I;  1Z7K B;  2ORW A;  3TO7 A;  3SEK C;  3TO6 A;  1N13 A;  1TBQ R;  2QPO A;  1XX6 A;  2ERW A;  2SGP I;  2KMR A;  3UOE A;  2QQ0 A;  1YTP A;  3BJI A;  2E5R A;  5CCM A;  2J87 A;  5EX0 A;  3FSY A;  1CGJ I;  3CXL A;  1P9Z A;  1CT4 I;  2NU1 I;  2L7X A;  1WGT A;  4B6D A;  3TOA A;  2A20 A;  1ULM A;  2E73 A;  2GKT I;  1KBE A;  1NUB A;  1LR7 A;  5J8C A;  1CSO I;  1IY6 A;  5FUY A;  3OXL A;  1FY7 A;  1FAR A;  1UVG A;  2QQE A;  2UVO A;  5FUW A;  1HPT A;  3VDP A;  2ARP F;  1IW4 A;  3OXF A;  2FNF X;  3B4V C;  3OL0 A;  9WGA A;  5FUV A;  1V1H A;  2SGD I;  3E2I A;  1DS3 I;  1LR8 A;  1LR9 A;  1SGP I;  1SGR I;  2DB6 A;  2JXD A;  3E59 A;  3UGI A;  1BUS A;  1Z2I A;  3SGB I;  1KMA A;  3FSX A;  2KMQ A;  3VDU A;  2KMP A;  5CCL A;  2SGE I;  1MJ9 A;  1YU6 C;  2ENZ A;  5E3Q A;  2CJS C;  3R5B A;  3UGL A;  2J9R A;  3FC3 A;  2LEO A;  1PJU A;  2ODD A;  4E1R A;  1SGY I;  1PCE A;  2SGF I;  7WGA A;  2M5X A;  3OXG A;  4OVO A;  2LB7 A;  4UXI A;  4SGB I;  1CT0 I;  1PTQ A;  2GKV A;  2JZM A;  2VRW B;  1K7V A;  2V1C C;  2W0T A;  3HH2 C;  5EX3 A;  1MJA A;  1TUS A;  4GI3 C;  1AN1 I;  2ORV A;  1HDL A;  1XBT A;  1R0R I;  1HJA I;  1SGE I;  2CWF A;  2GVI A;  1CT2 I;  1W3S A;  1UHA A;  2YQP A;  3QTL D;  1WTJ A;  2X3T A;  1RFH A;  3QAH A;  2QQD A;  5FUX A;  2LUY A;  2JYY A;  2OZU A;  4MPI A;  2WGC A;  1ULK A;  2X52 A;  1UUC A;  2KCX A;  3R5D A;  1M8C A;  3UGD A;  1VDD A;  2GKR I;  2KMO A;  3R5C A;  1HEV A;  4UXJ A;  2NU0 I;  2NU2 I;  2QQC A;  5J8F A;  1WKX A;  1UVF A;  1K7T A;  4E1P A;  1OYV I;  1K7U A;  2ELI A;  2OVO A;  3UFF A;  1PTR A;  2N52 A;  3KY9 A;  3QWP A;  1H0Z A;  2NU4 I;  1OMU A;  3SGQ I;  2OD1 A;  1Q9B A; 
#chains in the Genus database with same CATH homology
 1ULN A;  4WP4 A;  1K7V A;  2UVO A;  1UHA A;  2X3T A;  9WGA A;  1Q9B A;  4MPI A;  2WGC A;  1ULK A;  2X52 A;  4AML A;  2DKV A;  1P9G A;  1HEV A;  1WKX A;  1K7T A;  2CWG A;  1K7U A;  7WGA A;  1P9Z A;  1WGC A;  1WGT A;  2LB7 A;  1ULM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...