1K7UA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,4glcnac complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 45
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7uA04
1ULNA 2X52A 1WKXA 1K7VA 2WGCA 9WGAA 2DKVA 1K7UA 1HEVA 2LB7A 1P9GA 4WP4A 1WGTA 4MPIA 4AMLA 1P9ZA 1ULKA 1UHAA 2UVOA 7WGAA 1K7TA 2X3TA 1Q9BA 1ULMA 2CWGA 1WGCA
chains in the Genus database with same CATH superfamily
1IY5A 2DB6A 2V53A 1CSOI 1X74A 2N52A 2VRWB 2WGCA 3TOAA 1XA6A 2QQCA 4OVOA 2ENNA 5CCMA 2BUSA 1BUSA 2K9HA 1AN1I 4E1RA 3GOXA 1SGNI 2QPOA 2JW6A 4B6DA 4WP4A 1SGQI 1OMTA 1TUSA 2GKRI 4E1PA 1TIHA 2LUYA 3FC3A 2OD1A 3OVOA 3D00A 2OVOA 1LR9A 1CT0I 1ULKA 2GIVA 3UFFA 1RFHA 2SGPI 2UVOA 1CGII 2OU2A 7WGAA 1Y1BA 1Y8FA 1PTQA 2KMOA 1CT2I 1PJUA 1V1IA 1W3SA 3OXGA 1TBRR 2X3TA 1KMAA 3TO9A 1HDLA 1PCEA 4AMLA 1WGCA 5J8FA 2QQEA 5EX0A 1NXUA 4UXIA 5E3PA 1TOTA 1WKXA 3QAHA 1CE3A 3OL0A 9WGAA 2B8TA 2LB7A 2NU0I 2L8EA 3VDPA 2M5XA 1P9GA 3R5CA 4HGUA 1OYVI 1WTJA 1LR8A 1R79A 1TURA 2J87A 2RC4A 4L9MA 1FYBA 1H0ZA 2CWFA 2N1AB 1Z7KB 1MJBA 2CJSC 2NU2I 2W0TA 3BJIA 1YTPA 2QQDA 1FARA 5E3RA 3QWPA 3R5BA 5FUYA 2FNFX 3UOEA 1K7TA 1HPTA 3MEKA 3SGQI 3VE5A 1U5KA 2N71A 1FAQA 2YUUA 1SGEI 1V1HA 2JXDA 3UGDA 5FUXA 2V1CA 3FSXA 2LEOA 1OMUA 3PDNA 1CGJI 1BMOA 1K7VA 2N17A 2OZUA 3E2IA 1TGSI 1HEVA 2QQ0A 1XBTA 1DS2I 1TBQR 2V1CC 3UGIA 4JCVE 1HJAI 1S20A 2RIJA 2NU1I 1PPFI 2YQPA 3UGLA 5CCLA 2SGDI 1SGRI 5EX3A 1Z2IA 1CT4I 1N13A 1WGTA 3TO7A 2J9RA 2Y0MA 4MPIA 1PTRA 5DAEA 1UHAA 1MJ9A 2GKVA 2JA1A 2JZMA 1SGYI 5FUWA 2L7XA 2NU4I 1UUCA 5E3QA 2ENZA 1NUBA 2E5RA 4FKDA 3RU0A 4A24A 3VDUA 4SGBI 2KCXA 1M8BA 1MJAA 2B0UC 2JYYA 1ULMA 1UVFA 3KY9A 3UEJA 2DIPA 2F3CI 2ORWA 2ROWA 1CHOI 3UEYA 2ARPF 2SGQI 1ULNA 1SGDI 1Y1CA 2A20A 2GKTI 2X52A 2XRCA 1OVOA 2DKVA 1K7UA 2SGEI 2WCYA 3B4VC 1TBNA 1KBFA 1MT1A 1IW4A 3OXFA 1W4RA 3R5AA 3OXLA 3HH2C 2E73A 2P6AC 2UZ3A 5J8CA 1M8CA 5HQ8A 2KMPA 2PQ8A 1X4SA 3SEKC 3TO6A 1FY7A 1SGPI 3QTLD 1IY6A 1P9ZA 1LR7A 4GI3C 2GVIA 1DS3I 1TBOA 3E59A 3CXLA 4UXHA 3TJQA 5FUVA 1YU6C 5JHWC 1XX6A 2CWHA 2NU3I 5HI7A 2SGFI 3FSYA 1R0RI 2ODDA 4UXJA 1KBEA 1Q9BA 1UVGA 2ELIA 3R5DA 2ERWA 2KMQA 2WVJA 3TOBA 4DNCA 2KMRA 1VDDA 2CWGA 2ORVA 3SGBI
chains in the Genus database with same CATH topology
1ULNA 2X52A 1WKXA 1K7VA 2WGCA 9WGAA 2DKVA 1K7UA 1HEVA 2LB7A 1P9GA 4WP4A 1WGTA 4MPIA 4AMLA 1P9ZA 1ULKA 1UHAA 2UVOA 7WGAA 1K7TA 2X3TA 1Q9BA 1ULMA 2CWGA 1WGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULN A;  2X52 A;  1WKX A;  1K7V A;  2WGC A;  9WGA A;  2DKV A;  1K7U A;  1HEV A;  2LB7 A;  1P9G A;  4WP4 A;  1WGT A;  4MPI A;  4AML A;  1P9Z A;  1ULK A;  1UHA A;  2UVO A;  7WGA A;  1K7T A;  2X3T A;  1Q9B A;  1ULM A;  2CWG A;  1WGC A; 
#chains in the Genus database with same CATH topology
 1IY5 A;  2DB6 A;  2V53 A;  1CSO I;  1X74 A;  2N52 A;  2VRW B;  2WGC A;  3TOA A;  1XA6 A;  2QQC A;  4OVO A;  2ENN A;  5CCM A;  2BUS A;  1BUS A;  2K9H A;  1AN1 I;  4E1R A;  3GOX A;  1SGN I;  2QPO A;  2JW6 A;  4B6D A;  4WP4 A;  1SGQ I;  1OMT A;  1TUS A;  2GKR I;  4E1P A;  1TIH A;  2LUY A;  3FC3 A;  2OD1 A;  3OVO A;  3D00 A;  2OVO A;  1LR9 A;  1CT0 I;  1ULK A;  2GIV A;  3UFF A;  1RFH A;  2SGP I;  2UVO A;  1CGI I;  2OU2 A;  7WGA A;  1Y1B A;  1Y8F A;  1PTQ A;  2KMO A;  1CT2 I;  1PJU A;  1V1I A;  1W3S A;  3OXG A;  1TBR R;  2X3T A;  1KMA A;  3TO9 A;  1HDL A;  1PCE A;  4AML A;  1WGC A;  5J8F A;  2QQE A;  5EX0 A;  1NXU A;  4UXI A;  5E3P A;  1TOT A;  1WKX A;  3QAH A;  1CE3 A;  3OL0 A;  9WGA A;  2B8T A;  2LB7 A;  2NU0 I;  2L8E A;  3VDP A;  2M5X A;  1P9G A;  3R5C A;  4HGU A;  1OYV I;  1WTJ A;  1LR8 A;  1R79 A;  1TUR A;  2J87 A;  2RC4 A;  4L9M A;  1FYB A;  1H0Z A;  2CWF A;  2N1A B;  1Z7K B;  1MJB A;  2CJS C;  2NU2 I;  2W0T A;  3BJI A;  1YTP A;  2QQD A;  1FAR A;  5E3R A;  3QWP A;  3R5B A;  5FUY A;  2FNF X;  3UOE A;  1K7T A;  1HPT A;  3MEK A;  3SGQ I;  3VE5 A;  1U5K A;  2N71 A;  1FAQ A;  2YUU A;  1SGE I;  1V1H A;  2JXD A;  3UGD A;  5FUX A;  2V1C A;  3FSX A;  2LEO A;  1OMU A;  3PDN A;  1CGJ I;  1BMO A;  1K7V A;  2N17 A;  2OZU A;  3E2I A;  1TGS I;  1HEV A;  2QQ0 A;  1XBT A;  1DS2 I;  1TBQ R;  2V1C C;  3UGI A;  4JCV E;  1HJA I;  1S20 A;  2RIJ A;  2NU1 I;  1PPF I;  2YQP A;  3UGL A;  5CCL A;  2SGD I;  1SGR I;  5EX3 A;  1Z2I A;  1CT4 I;  1N13 A;  1WGT A;  3TO7 A;  2J9R A;  2Y0M A;  4MPI A;  1PTR A;  5DAE A;  1UHA A;  1MJ9 A;  2GKV A;  2JA1 A;  2JZM A;  1SGY I;  5FUW A;  2L7X A;  2NU4 I;  1UUC A;  5E3Q A;  2ENZ A;  1NUB A;  2E5R A;  4FKD A;  3RU0 A;  4A24 A;  3VDU A;  4SGB I;  2KCX A;  1M8B A;  1MJA A;  2B0U C;  2JYY A;  1ULM A;  1UVF A;  3KY9 A;  3UEJ A;  2DIP A;  2F3C I;  2ORW A;  2ROW A;  1CHO I;  3UEY A;  2ARP F;  2SGQ I;  1ULN A;  1SGD I;  1Y1C A;  2A20 A;  2GKT I;  2X52 A;  2XRC A;  1OVO A;  2DKV A;  1K7U A;  2SGE I;  2WCY A;  3B4V C;  1TBN A;  1KBF A;  1MT1 A;  1IW4 A;  3OXF A;  1W4R A;  3R5A A;  3OXL A;  3HH2 C;  2E73 A;  2P6A C;  2UZ3 A;  5J8C A;  1M8C A;  5HQ8 A;  2KMP A;  2PQ8 A;  1X4S A;  3SEK C;  3TO6 A;  1FY7 A;  1SGP I;  3QTL D;  1IY6 A;  1P9Z A;  1LR7 A;  4GI3 C;  2GVI A;  1DS3 I;  1TBO A;  3E59 A;  3CXL A;  4UXH A;  3TJQ A;  5FUV A;  1YU6 C;  5JHW C;  1XX6 A;  2CWH A;  2NU3 I;  5HI7 A;  2SGF I;  3FSY A;  1R0R I;  2ODD A;  4UXJ A;  1KBE A;  1Q9B A;  1UVG A;  2ELI A;  3R5D A;  2ERW A;  2KMQ A;  2WVJ A;  3TOB A;  4DNC A;  2KMR A;  1VDD A;  2CWG A;  2ORV A;  3SGB I; 
#chains in the Genus database with same CATH homology
 1ULN A;  2X52 A;  1WKX A;  1K7V A;  2WGC A;  9WGA A;  2DKV A;  1K7U A;  1HEV A;  2LB7 A;  1P9G A;  4WP4 A;  1WGT A;  4MPI A;  4AML A;  1P9Z A;  1ULK A;  1UHA A;  2UVO A;  7WGA A;  1K7T A;  2X3T A;  1Q9B A;  1ULM A;  2CWG A;  1WGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...