1R79A

Solution structure of the c1 domain of the human diacylglycerol kinase delta
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GSSGSSGTTLASIGKDIIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of The C1 Domain of The Human Diacylglycerol Kinase Delta
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diacylglycerol kinase, delta
total genus 7
structure length 84
sequence length 84
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2003-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1r79A01
2VRWB 2B8TA 1PTQA 4L9MA 4UXIA 1TBNA 2DB6A 2E73A 2J87A 3UFFA 2ELIA 3CXLA 1FAQA 2ORVA 2ROWA 2QQ0A 2JA1A 2ENZA 2WVJA 3E2IA 5FUWA 1RFHA 2QQEA 4FKDA 1TBOA 4UXJA 3BJIA 3UGIA 3KY9A 4UXHA 3UEYA 2YUUA 2FNFX 2ORWA 2QPOA 5FUYA 3UGDA 1PTRA 2J9RA 1W4RA 3UEJA 1KBFA 1XBTA 4B6DA 1KBEA 5FUXA 2UZ3A 2ENNA 5FUVA 3UGLA 1R79A 2GVIA 1FARA 1XX6A 1Y8FA 1XA6A
chains in the Genus database with same CATH superfamily
1ULKA 3PDNA 1X74A 2W0TA 1IY5A 2KMQA 7WGAA 1PTQA 4L9MA 1P9ZA 3TOAA 1TBNA 1CGJI 1K7TA 2J87A 1Q9BA 4E1PA 5DAEA 3OXFA 5CCLA 2KMPA 1FAQA 1TBRR 1Y1BA 2QQ0A 3E59A 1CT2I 1FY7A 1SGRI 1RFHA 1TGSI 2QQDA 1DS2I 3FSXA 5E3QA 2K9HA 2V1CC 2SGPI 1TBQR 3OXLA 4UXJA 5J8CA 1X4SA 2SGEI 3KY9A 3SEKC 1ULNA 5FUYA 2ORWA 9WGAA 2LEOA 2YQPA 2NU3I 3UGDA 1UUCA 2N71A 3OL0A 3QWPA 2ARPF 2UZ3A 5FUXA 1UVGA 2QQCA 2WGCA 3MEKA 2NU4I 1WGCA 3QAHA 3TO7A 1WTJA 2B8TA 2X3TA 1U5KA 3D00A 1LR8A 4UXIA 2LUYA 1CHOI 1LR9A 2ODDA 1BUSA 1TUSA 2DB6A 1HPTA 2E73A 2DIPA 3UFFA 2ELIA 2ORVA 1S20A 2N17A 2NU1I 2ROWA 3OVOA 1AN1I 5FUWA 3FC3A 5HQ8A 2QQEA 1OVOA 2CWFA 1TBOA 2GKRI 2Y0MA 3BJIA 3OXGA 1TURA 1HJAI 2P6AC 2NU0I 3UEYA 2YUUA 2FNFX 2LB7A 2N52A 5E3PA 1SGYI 2OZUA 1H0ZA 1NXUA 3UEJA 1NUBA 3UOEA 2F3CI 2KMOA 1KBEA 1OMUA 1MJ9A 1KMAA 1IW4A 2OVOA 1R79A 3UGLA 2GVIA 1FYBA 1OMTA 1XX6A 1Y8FA 1XA6A 1N13A 5HI7A 1K7UA 2V1CA 3R5CA 1K7VA 2VRWB 4SGBI 1PPFI 1V1IA 1MT1A 2GKTI 3TOBA 2L7XA 3QTLD 3RU0A 1CE3A 1TOTA 3VE5A 2ERWA 1DS3I 1YTPA 2JA1A 2WCYA 2KCXA 4GI3C 1UHAA 1VDDA 1SGNI 2KMRA 3UGIA 1PJUA 4A24A 2JZMA 4OVOA 1SGPI 3TO9A 1M8CA 2E5RA 1HEVA 1Z7KB 4DNCA 2L8EA 3SGQI 2OU2A 1CT4I 1W4RA 1YU6C 1SGDI 1XBTA 2NU2I 2RIJA 3TO6A 4B6DA 2DKVA 2JYYA 2ENNA 5E3RA 2M5XA 5JHWC 3SGBI 3HH2C 2B0UC 5EX0A 1SGQI 4MPIA 1KBFA 5CCMA 2V53A 2GIVA 2CJSC 2OD1A 3FSYA 5EX3A 3VDPA 1MJAA 4HGUA 2UVOA 4AMLA 2N1AB 4JCVE 3B4VC 1Y1CA 1PCEA 2SGFI 2PQ8A 3R5BA 1R0RI 2RC4A 1MJBA 1WGTA 5J8FA 3E2IA 2ENZA 2WVJA 1HDLA 2JW6A 2XRCA 1IY6A 1SGEI 1CT0I 2X52A 4FKDA 2CWGA 1TIHA 3R5DA 2JXDA 1V1HA 1CSOI 1W3SA 4UXHA 2QPOA 1P9GA 3VDUA 3TJQA 1WKXA 2CWHA 1PTRA 2J9RA 3R5AA 4WP4A 1CGII 2A20A 1OYVI 1UVFA 1ULMA 2GKVA 1LR7A 5FUVA 1BMOA 1Z2IA 1FARA 4E1RA 3GOXA 3CXLA 1M8BA 2SGDI 2BUSA 2SGQI
chains in the Genus database with same CATH topology
3PDNA 1IY5A 1X74A 2W0TA 2KMQA 1PTQA 4L9MA 1TBNA 1CGJI 2J87A 4E1PA 5DAEA 3OXFA 5CCLA 2KMPA 1FAQA 1TBRR 1Y1BA 2QQ0A 3E59A 1CT2I 1SGRI 1TGSI 1RFHA 2QQDA 1DS2I 2K9HA 2V1CC 2SGPI 1TBQR 3OXLA 4UXJA 1X4SA 2SGEI 3KY9A 3SEKC 5FUYA 2ORWA 2LEOA 2YQPA 2NU3I 3UGDA 1UUCA 2N71A 3OL0A 3QWPA 2ARPF 2UZ3A 5FUXA 1UVGA 2QQCA 3MEKA 2NU4I 2B8TA 1U5KA 3D00A 1LR8A 4UXIA 2LUYA 1CHOI 1LR9A 2ODDA 1BUSA 1TUSA 2DB6A 1HPTA 2E73A 2DIPA 3UFFA 2ELIA 2ORVA 2N17A 3FC3A 2NU1I 2ROWA 3OVOA 1AN1I 5FUWA 5HQ8A 2QQEA 1OVOA 1TBOA 2GKRI 3OXGA 3BJIA 1TURA 1HJAI 2P6AC 2NU0I 3UEYA 2YUUA 2FNFX 2N52A 1SGYI 1H0ZA 3UEJA 1NUBA 2F3CI 2KMOA 1KBEA 1OMUA 1KMAA 1IW4A 2OVOA 1R79A 3UGLA 2GVIA 1FYBA 1OMTA 1XX6A 1Y8FA 1XA6A 1N13A 5HI7A 2V1CA 2VRWB 4SGBI 1PPFI 1V1IA 1MT1A 2GKTI 2L7XA 3QTLD 3RU0A 1CE3A 1TOTA 3VE5A 2ERWA 1DS3I 1YTPA 2JA1A 2WCYA 2KCXA 4GI3C 1VDDA 1SGNI 2KMRA 3UGIA 1PJUA 4A24A 2JZMA 4OVOA 1SGPI 1M8CA 2E5RA 1Z7KB 2L8EA 3SGQI 1CT4I 1W4RA 1YU6C 1SGDI 1XBTA 2NU2I 4B6DA 2JYYA 2ENNA 2M5XA 5JHWC 3SGBI 3HH2C 2B0UC 5EX0A 1SGQI 1KBFA 5CCMA 2V53A 2OD1A 2CJSC 5EX3A 3VDPA 4HGUA 2N1AB 4JCVE 3B4VC 1Y1CA 1PCEA 2SGFI 1R0RI 3E2IA 2ENZA 2WVJA 1HDLA 2JW6A 2XRCA 1IY6A 1SGEI 1CT0I 4FKDA 1TIHA 2JXDA 1V1HA 1CSOI 1W3SA 4UXHA 2QPOA 3VDUA 3TJQA 1PTRA 2J9RA 1CGII 2A20A 1OYVI 1UVFA 2GKVA 1LR7A 5FUVA 1BMOA 1FARA 4E1RA 3GOXA 3CXLA 1M8BA 2SGDI 2BUSA 2SGQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRW B;  2B8T A;  1PTQ A;  4L9M A;  4UXI A;  1TBN A;  2DB6 A;  2E73 A;  2J87 A;  3UFF A;  2ELI A;  3CXL A;  1FAQ A;  2ORV A;  2ROW A;  2QQ0 A;  2JA1 A;  2ENZ A;  2WVJ A;  3E2I A;  5FUW A;  1RFH A;  2QQE A;  4FKD A;  1TBO A;  4UXJ A;  3BJI A;  3UGI A;  3KY9 A;  4UXH A;  3UEY A;  2YUU A;  2FNF X;  2ORW A;  2QPO A;  5FUY A;  3UGD A;  1PTR A;  2J9R A;  1W4R A;  3UEJ A;  1KBF A;  1XBT A;  4B6D A;  1KBE A;  5FUX A;  2UZ3 A;  2ENN A;  5FUV A;  3UGL A;  1R79 A;  2GVI A;  1FAR A;  1XX6 A;  1Y8F A;  1XA6 A; 
#chains in the Genus database with same CATH topology
 1ULK A;  3PDN A;  1X74 A;  2W0T A;  1IY5 A;  2KMQ A;  7WGA A;  1PTQ A;  4L9M A;  1P9Z A;  3TOA A;  1TBN A;  1CGJ I;  1K7T A;  2J87 A;  1Q9B A;  4E1P A;  5DAE A;  3OXF A;  5CCL A;  2KMP A;  1FAQ A;  1TBR R;  1Y1B A;  2QQ0 A;  3E59 A;  1CT2 I;  1FY7 A;  1SGR I;  1RFH A;  1TGS I;  2QQD A;  1DS2 I;  3FSX A;  5E3Q A;  2K9H A;  2V1C C;  2SGP I;  1TBQ R;  3OXL A;  4UXJ A;  5J8C A;  1X4S A;  2SGE I;  3KY9 A;  3SEK C;  1ULN A;  5FUY A;  2ORW A;  9WGA A;  2LEO A;  2YQP A;  2NU3 I;  3UGD A;  1UUC A;  2N71 A;  3OL0 A;  3QWP A;  2ARP F;  2UZ3 A;  5FUX A;  1UVG A;  2QQC A;  2WGC A;  3MEK A;  2NU4 I;  1WGC A;  3QAH A;  3TO7 A;  1WTJ A;  2B8T A;  2X3T A;  1U5K A;  3D00 A;  1LR8 A;  4UXI A;  2LUY A;  1CHO I;  1LR9 A;  2ODD A;  1BUS A;  1TUS A;  2DB6 A;  1HPT A;  2E73 A;  2DIP A;  3UFF A;  2ELI A;  2ORV A;  1S20 A;  2N17 A;  2NU1 I;  2ROW A;  3OVO A;  1AN1 I;  5FUW A;  3FC3 A;  5HQ8 A;  2QQE A;  1OVO A;  2CWF A;  1TBO A;  2GKR I;  2Y0M A;  3BJI A;  3OXG A;  1TUR A;  1HJA I;  2P6A C;  2NU0 I;  3UEY A;  2YUU A;  2FNF X;  2LB7 A;  2N52 A;  5E3P A;  1SGY I;  2OZU A;  1H0Z A;  1NXU A;  3UEJ A;  1NUB A;  3UOE A;  2F3C I;  2KMO A;  1KBE A;  1OMU A;  1MJ9 A;  1KMA A;  1IW4 A;  2OVO A;  1R79 A;  3UGL A;  2GVI A;  1FYB A;  1OMT A;  1XX6 A;  1Y8F A;  1XA6 A;  1N13 A;  5HI7 A;  1K7U A;  2V1C A;  3R5C A;  1K7V A;  2VRW B;  4SGB I;  1PPF I;  1V1I A;  1MT1 A;  2GKT I;  3TOB A;  2L7X A;  3QTL D;  3RU0 A;  1CE3 A;  1TOT A;  3VE5 A;  2ERW A;  1DS3 I;  1YTP A;  2JA1 A;  2WCY A;  2KCX A;  4GI3 C;  1UHA A;  1VDD A;  1SGN I;  2KMR A;  3UGI A;  1PJU A;  4A24 A;  2JZM A;  4OVO A;  1SGP I;  3TO9 A;  1M8C A;  2E5R A;  1HEV A;  1Z7K B;  4DNC A;  2L8E A;  3SGQ I;  2OU2 A;  1CT4 I;  1W4R A;  1YU6 C;  1SGD I;  1XBT A;  2NU2 I;  2RIJ A;  3TO6 A;  4B6D A;  2DKV A;  2JYY A;  2ENN A;  5E3R A;  2M5X A;  5JHW C;  3SGB I;  3HH2 C;  2B0U C;  5EX0 A;  1SGQ I;  4MPI A;  1KBF A;  5CCM A;  2V53 A;  2GIV A;  2CJS C;  2OD1 A;  3FSY A;  5EX3 A;  3VDP A;  1MJA A;  4HGU A;  2UVO A;  4AML A;  2N1A B;  4JCV E;  3B4V C;  1Y1C A;  1PCE A;  2SGF I;  2PQ8 A;  3R5B A;  1R0R I;  2RC4 A;  1MJB A;  1WGT A;  5J8F A;  3E2I A;  2ENZ A;  2WVJ A;  1HDL A;  2JW6 A;  2XRC A;  1IY6 A;  1SGE I;  1CT0 I;  2X52 A;  4FKD A;  2CWG A;  1TIH A;  3R5D A;  2JXD A;  1V1H A;  1CSO I;  1W3S A;  4UXH A;  2QPO A;  1P9G A;  3VDU A;  3TJQ A;  1WKX A;  2CWH A;  1PTR A;  2J9R A;  3R5A A;  4WP4 A;  1CGI I;  2A20 A;  1OYV I;  1UVF A;  1ULM A;  2GKV A;  1LR7 A;  5FUV A;  1BMO A;  1Z2I A;  1FAR A;  4E1R A;  3GOX A;  3CXL A;  1M8B A;  2SGD I;  2BUS A;  2SGQ I; 
#chains in the Genus database with same CATH homology
 3PDN A;  1IY5 A;  1X74 A;  2W0T A;  2KMQ A;  1PTQ A;  4L9M A;  1TBN A;  1CGJ I;  2J87 A;  4E1P A;  5DAE A;  3OXF A;  5CCL A;  2KMP A;  1FAQ A;  1TBR R;  1Y1B A;  2QQ0 A;  3E59 A;  1CT2 I;  1SGR I;  1TGS I;  1RFH A;  2QQD A;  1DS2 I;  2K9H A;  2V1C C;  2SGP I;  1TBQ R;  3OXL A;  4UXJ A;  1X4S A;  2SGE I;  3KY9 A;  3SEK C;  5FUY A;  2ORW A;  2LEO A;  2YQP A;  2NU3 I;  3UGD A;  1UUC A;  2N71 A;  3OL0 A;  3QWP A;  2ARP F;  2UZ3 A;  5FUX A;  1UVG A;  2QQC A;  3MEK A;  2NU4 I;  2B8T A;  1U5K A;  3D00 A;  1LR8 A;  4UXI A;  2LUY A;  1CHO I;  1LR9 A;  2ODD A;  1BUS A;  1TUS A;  2DB6 A;  1HPT A;  2E73 A;  2DIP A;  3UFF A;  2ELI A;  2ORV A;  2N17 A;  3FC3 A;  2NU1 I;  2ROW A;  3OVO A;  1AN1 I;  5FUW A;  5HQ8 A;  2QQE A;  1OVO A;  1TBO A;  2GKR I;  3OXG A;  3BJI A;  1TUR A;  1HJA I;  2P6A C;  2NU0 I;  3UEY A;  2YUU A;  2FNF X;  2N52 A;  1SGY I;  1H0Z A;  3UEJ A;  1NUB A;  2F3C I;  2KMO A;  1KBE A;  1OMU A;  1KMA A;  1IW4 A;  2OVO A;  1R79 A;  3UGL A;  2GVI A;  1FYB A;  1OMT A;  1XX6 A;  1Y8F A;  1XA6 A;  1N13 A;  5HI7 A;  2V1C A;  2VRW B;  4SGB I;  1PPF I;  1V1I A;  1MT1 A;  2GKT I;  2L7X A;  3QTL D;  3RU0 A;  1CE3 A;  1TOT A;  3VE5 A;  2ERW A;  1DS3 I;  1YTP A;  2JA1 A;  2WCY A;  2KCX A;  4GI3 C;  1VDD A;  1SGN I;  2KMR A;  3UGI A;  1PJU A;  4A24 A;  2JZM A;  4OVO A;  1SGP I;  1M8C A;  2E5R A;  1Z7K B;  2L8E A;  3SGQ I;  1CT4 I;  1W4R A;  1YU6 C;  1SGD I;  1XBT A;  2NU2 I;  4B6D A;  2JYY A;  2ENN A;  2M5X A;  5JHW C;  3SGB I;  3HH2 C;  2B0U C;  5EX0 A;  1SGQ I;  1KBF A;  5CCM A;  2V53 A;  2OD1 A;  2CJS C;  5EX3 A;  3VDP A;  4HGU A;  2N1A B;  4JCV E;  3B4V C;  1Y1C A;  1PCE A;  2SGF I;  1R0R I;  3E2I A;  2ENZ A;  2WVJ A;  1HDL A;  2JW6 A;  2XRC A;  1IY6 A;  1SGE I;  1CT0 I;  4FKD A;  1TIH A;  2JXD A;  1V1H A;  1CSO I;  1W3S A;  4UXH A;  2QPO A;  3VDU A;  3TJQ A;  1PTR A;  2J9R A;  1CGI I;  2A20 A;  1OYV I;  1UVF A;  2GKV A;  1LR7 A;  5FUV A;  1BMO A;  1FAR A;  4E1R A;  3GOX A;  3CXL A;  1M8B A;  2SGD I;  2BUS A;  2SGQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...