4B6DA

Structure of the atypical c1 domain of mgcracgap
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
GPLGSMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords RAC GTPASE-ACTIVATING PROTEIN 1
publication title Centralspindlin Links the Mitotic Spindle to the Plasma Membrane During Cytokinesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4b6dA00
2B8TA 3UEJA 2QQ0A 1FAQA 1W4RA 4L9MA 1XBTA 2FNFX 1KBFA 5FUVA 4UXHA 1KBEA 3KY9A 2YUUA 2E73A 4FKDA 3BJIA 2UZ3A 3UGIA 1XA6A 3UEYA 2J87A 4UXJA 2J9RA 2QQEA 5FUYA 4UXIA 2ENNA 1PTQA 3UGDA 2ELIA 2WVJA 1R79A 1RFHA 5FUWA 1FARA 2ORVA 2JA1A 1TBOA 2QPOA 3CXLA 3E2IA 2DB6A 3UGLA 2VRWB 2ORWA 2ENZA 1XX6A 4B6DA 1TBNA 5FUXA 1PTRA 3UFFA 1Y8FA 2ROWA 2GVIA
chains in the Genus database with same CATH superfamily
1DS3I 4HGUA 3UEJA 2QQ0A 2GKTI 1FAQA 4L9MA 1XBTA 1IY6A 2XRCA 1H0ZA 4UXHA 1KBEA 2OU2A 3KY9A 1CT2I 4JCVE 1R0RI 1OMUA 2UZ3A 2SGPI 3OXLA 3R5DA 3UEYA 4UXJA 4AMLA 1YU6C 5FUYA 2V1CC 1Z7KB 5E3QA 1UUCA 2GKRI 2KMOA 7WGAA 3R5AA 2ELIA 3OXFA 2L7XA 3TOBA 1R79A 1CE3A 1RFHA 5FUWA 2QPOA 1TBOA 3SEKC 3UGLA 1HDLA 2DB6A 3TOAA 3OXGA 2QQCA 2ENZA 1XX6A 2OD1A 3SGBI 2K9HA 4WP4A 2YQPA 1SGRI 1PTRA 2LUYA 1N13A 5EX0A 2N1AB 1MJAA 2WGCA 2X52A 1TOTA 3MEKA 2UVOA 1OMTA 4MPIA 2ORVA 1IW4A 2B8TA 1P9ZA 1TIHA 2LB7A 2CWGA 1M8CA 4SGBI 1SGQI 1W4RA 2LEOA 1IY5A 1KBFA 2ARPF 1CHOI 1BUSA 2NU0I 2YUUA 1PPFI 2E73A 4FKDA 5JHWC 1K7TA 3QTLD 3FSXA 1SGPI 1K7UA 2N52A 1Y1BA 1TBQR 1UHAA 1ULNA 2J9RA 2KCXA 2QQEA 1PJUA 2E5RA 2ERWA 5EX3A 1SGYI 1SGEI 1BMOA 2ENNA 5J8CA 3VDPA 2L8EA 1YTPA 2B0UC 3FSYA 2WVJA 1FARA 2F3CI 2X3TA 2NU3I 3E2IA 1FY7A 2CJSC 1UVFA 1VDDA 2V1CA 4E1PA 2QQDA 2JW6A 1MJBA 1U5KA 3UFFA 2SGDI 3OL0A 5E3RA 1OYVI 1W3SA 1NUBA 1X4SA 2P6AC 3B4VC 1V1HA 2NU2I 1PCEA 2N71A 1SGDI 9WGAA 1LR9A 3PDNA 1TUSA 3E59A 3BJIA 1CGJI 1WGTA 2DIPA 2V53A 2SGFI 1S20A 2J87A 4A24A 3R5BA 1HPTA 3HH2C 2RIJA 1UVGA 3QWPA 4UXIA 5CCLA 2JXDA 5E3PA 3UOEA 3UGDA 3VE5A 1TBRR 2BUSA 1LR7A 2JZMA 2GKVA 2JA1A 3TO7A 4E1RA 2JYYA 2VRWB 2ORWA 5CCMA 2GIVA 2WCYA 1K7VA 5FUXA 3SGQI 1CT4I 3VDUA 3FC3A 2OZUA 2PQ8A 2Y0MA 2SGQI 3D00A 1Y8FA 1TURA 2KMPA 1TGSI 2M5XA 2GVIA 1WKXA 1ULMA 2ROWA 1WTJA 5DAEA 2CWHA 3R5CA 1LR8A 1WGCA 4DNCA 2FNFX 2ODDA 5FUVA 1CT0I 3QAHA 5HQ8A 1V1IA 1P9GA 2A20A 2NU1I 4OVOA 1XA6A 3TJQA 2KMRA 3TO6A 1Y1CA 2N17A 3UGIA 3GOXA 1SGNI 1KMAA 1FYBA 1DS2I 5J8FA 1CGII 1X74A 1PTQA 2CWFA 1CSOI 1MJ9A 1MT1A 1NXUA 5HI7A 2RC4A 3RU0A 3OVOA 1OVOA 2W0TA 2NU4I 1M8BA 3CXLA 1Z2IA 1Q9BA 4B6DA 1HJAI 1AN1I 1TBNA 2SGEI 2KMQA 1HEVA 2DKVA 4GI3C 1ULKA 3TO9A 2OVOA
chains in the Genus database with same CATH topology
1DS3I 4HGUA 3UEJA 2QQ0A 2GKTI 1FAQA 4L9MA 1XBTA 1IY6A 2XRCA 1H0ZA 4UXHA 1KBEA 3KY9A 1CT2I 4JCVE 1R0RI 1OMUA 2UZ3A 2SGPI 3OXLA 3UEYA 4UXJA 1YU6C 5FUYA 2V1CC 1Z7KB 1UUCA 2GKRI 2KMOA 2ELIA 3OXFA 2L7XA 1R79A 1CE3A 1RFHA 5FUWA 2QPOA 1TBOA 3SEKC 3UGLA 1HDLA 2DB6A 3OXGA 2QQCA 2ENZA 1XX6A 2OD1A 3SGBI 2K9HA 2YQPA 1SGRI 1PTRA 2LUYA 1N13A 5EX0A 2N1AB 1TOTA 3MEKA 1OMTA 2ORVA 1IW4A 2B8TA 1TIHA 4SGBI 1M8CA 1IY5A 1SGQI 1W4RA 2LEOA 1KBFA 2ARPF 1CHOI 1BUSA 2NU0I 2YUUA 1PPFI 2E73A 4FKDA 5JHWC 3QTLD 1SGPI 2N52A 1Y1BA 1TBQR 2J9RA 2KCXA 2QQEA 1PJUA 2E5RA 2ERWA 5EX3A 1SGYI 1SGEI 1BMOA 2ENNA 3VDPA 2L8EA 1YTPA 2B0UC 2WVJA 1FARA 2F3CI 2NU3I 3E2IA 2CJSC 1UVFA 1VDDA 2V1CA 4E1PA 2QQDA 2JW6A 1U5KA 3UFFA 2SGDI 3OL0A 1OYVI 1W3SA 1NUBA 1X4SA 2P6AC 3B4VC 1V1HA 2NU2I 1PCEA 2N71A 1SGDI 1LR9A 3PDNA 1TUSA 3E59A 3BJIA 1CGJI 2DIPA 2V53A 2SGFI 2J87A 4A24A 1HPTA 3HH2C 3QWPA 1UVGA 5CCLA 4UXIA 2JXDA 3UGDA 3VE5A 1TBRR 2BUSA 1LR7A 2JZMA 2GKVA 2JA1A 4E1RA 2JYYA 2VRWB 2ORWA 5CCMA 2WCYA 5FUXA 3SGQI 1CT4I 3VDUA 3FC3A 2SGQI 3D00A 1Y8FA 1TURA 2KMPA 1TGSI 2M5XA 2GVIA 2ROWA 5DAEA 1LR8A 2FNFX 2ODDA 5FUVA 1CT0I 5HQ8A 1V1IA 3TJQA 2A20A 2NU1I 4OVOA 1XA6A 3UGIA 2KMRA 1KMAA 1Y1CA 2N17A 3GOXA 1SGNI 1FYBA 1DS2I 1CGII 1X74A 1PTQA 1CSOI 1MT1A 5HI7A 3RU0A 3OVOA 1OVOA 2W0TA 2NU4I 1M8BA 3CXLA 4B6DA 1HJAI 1AN1I 1TBNA 2SGEI 2KMQA 4GI3C 2OVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8T A;  3UEJ A;  2QQ0 A;  1FAQ A;  1W4R A;  4L9M A;  1XBT A;  2FNF X;  1KBF A;  5FUV A;  4UXH A;  1KBE A;  3KY9 A;  2YUU A;  2E73 A;  4FKD A;  3BJI A;  2UZ3 A;  3UGI A;  1XA6 A;  3UEY A;  2J87 A;  4UXJ A;  2J9R A;  2QQE A;  5FUY A;  4UXI A;  2ENN A;  1PTQ A;  3UGD A;  2ELI A;  2WVJ A;  1R79 A;  1RFH A;  5FUW A;  1FAR A;  2ORV A;  2JA1 A;  1TBO A;  2QPO A;  3CXL A;  3E2I A;  2DB6 A;  3UGL A;  2VRW B;  2ORW A;  2ENZ A;  1XX6 A;  4B6D A;  1TBN A;  5FUX A;  1PTR A;  3UFF A;  1Y8F A;  2ROW A;  2GVI A; 
#chains in the Genus database with same CATH topology
 1DS3 I;  4HGU A;  3UEJ A;  2QQ0 A;  2GKT I;  1FAQ A;  4L9M A;  1XBT A;  1IY6 A;  2XRC A;  1H0Z A;  4UXH A;  1KBE A;  2OU2 A;  3KY9 A;  1CT2 I;  4JCV E;  1R0R I;  1OMU A;  2UZ3 A;  2SGP I;  3OXL A;  3R5D A;  3UEY A;  4UXJ A;  4AML A;  1YU6 C;  5FUY A;  2V1C C;  1Z7K B;  5E3Q A;  1UUC A;  2GKR I;  2KMO A;  7WGA A;  3R5A A;  2ELI A;  3OXF A;  2L7X A;  3TOB A;  1R79 A;  1CE3 A;  1RFH A;  5FUW A;  2QPO A;  1TBO A;  3SEK C;  3UGL A;  1HDL A;  2DB6 A;  3TOA A;  3OXG A;  2QQC A;  2ENZ A;  1XX6 A;  2OD1 A;  3SGB I;  2K9H A;  4WP4 A;  2YQP A;  1SGR I;  1PTR A;  2LUY A;  1N13 A;  5EX0 A;  2N1A B;  1MJA A;  2WGC A;  2X52 A;  1TOT A;  3MEK A;  2UVO A;  1OMT A;  4MPI A;  2ORV A;  1IW4 A;  2B8T A;  1P9Z A;  1TIH A;  2LB7 A;  2CWG A;  1M8C A;  4SGB I;  1SGQ I;  1W4R A;  2LEO A;  1IY5 A;  1KBF A;  2ARP F;  1CHO I;  1BUS A;  2NU0 I;  2YUU A;  1PPF I;  2E73 A;  4FKD A;  5JHW C;  1K7T A;  3QTL D;  3FSX A;  1SGP I;  1K7U A;  2N52 A;  1Y1B A;  1TBQ R;  1UHA A;  1ULN A;  2J9R A;  2KCX A;  2QQE A;  1PJU A;  2E5R A;  2ERW A;  5EX3 A;  1SGY I;  1SGE I;  1BMO A;  2ENN A;  5J8C A;  3VDP A;  2L8E A;  1YTP A;  2B0U C;  3FSY A;  2WVJ A;  1FAR A;  2F3C I;  2X3T A;  2NU3 I;  3E2I A;  1FY7 A;  2CJS C;  1UVF A;  1VDD A;  2V1C A;  4E1P A;  2QQD A;  2JW6 A;  1MJB A;  1U5K A;  3UFF A;  2SGD I;  3OL0 A;  5E3R A;  1OYV I;  1W3S A;  1NUB A;  1X4S A;  2P6A C;  3B4V C;  1V1H A;  2NU2 I;  1PCE A;  2N71 A;  1SGD I;  9WGA A;  1LR9 A;  3PDN A;  1TUS A;  3E59 A;  3BJI A;  1CGJ I;  1WGT A;  2DIP A;  2V53 A;  2SGF I;  1S20 A;  2J87 A;  4A24 A;  3R5B A;  1HPT A;  3HH2 C;  2RIJ A;  1UVG A;  3QWP A;  4UXI A;  5CCL A;  2JXD A;  5E3P A;  3UOE A;  3UGD A;  3VE5 A;  1TBR R;  2BUS A;  1LR7 A;  2JZM A;  2GKV A;  2JA1 A;  3TO7 A;  4E1R A;  2JYY A;  2VRW B;  2ORW A;  5CCM A;  2GIV A;  2WCY A;  1K7V A;  5FUX A;  3SGQ I;  1CT4 I;  3VDU A;  3FC3 A;  2OZU A;  2PQ8 A;  2Y0M A;  2SGQ I;  3D00 A;  1Y8F A;  1TUR A;  2KMP A;  1TGS I;  2M5X A;  2GVI A;  1WKX A;  1ULM A;  2ROW A;  1WTJ A;  5DAE A;  2CWH A;  3R5C A;  1LR8 A;  1WGC A;  4DNC A;  2FNF X;  2ODD A;  5FUV A;  1CT0 I;  3QAH A;  5HQ8 A;  1V1I A;  1P9G A;  2A20 A;  2NU1 I;  4OVO A;  1XA6 A;  3TJQ A;  2KMR A;  3TO6 A;  1Y1C A;  2N17 A;  3UGI A;  3GOX A;  1SGN I;  1KMA A;  1FYB A;  1DS2 I;  5J8F A;  1CGI I;  1X74 A;  1PTQ A;  2CWF A;  1CSO I;  1MJ9 A;  1MT1 A;  1NXU A;  5HI7 A;  2RC4 A;  3RU0 A;  3OVO A;  1OVO A;  2W0T A;  2NU4 I;  1M8B A;  3CXL A;  1Z2I A;  1Q9B A;  4B6D A;  1HJA I;  1AN1 I;  1TBN A;  2SGE I;  2KMQ A;  1HEV A;  2DKV A;  4GI3 C;  1ULK A;  3TO9 A;  2OVO A; 
#chains in the Genus database with same CATH homology
 1DS3 I;  4HGU A;  3UEJ A;  2QQ0 A;  2GKT I;  1FAQ A;  4L9M A;  1XBT A;  1IY6 A;  2XRC A;  1H0Z A;  4UXH A;  1KBE A;  3KY9 A;  1CT2 I;  4JCV E;  1R0R I;  1OMU A;  2UZ3 A;  2SGP I;  3OXL A;  3UEY A;  4UXJ A;  1YU6 C;  5FUY A;  2V1C C;  1Z7K B;  1UUC A;  2GKR I;  2KMO A;  2ELI A;  3OXF A;  2L7X A;  1R79 A;  1CE3 A;  1RFH A;  5FUW A;  2QPO A;  1TBO A;  3SEK C;  3UGL A;  1HDL A;  2DB6 A;  3OXG A;  2QQC A;  2ENZ A;  1XX6 A;  2OD1 A;  3SGB I;  2K9H A;  2YQP A;  1SGR I;  1PTR A;  2LUY A;  1N13 A;  5EX0 A;  2N1A B;  1TOT A;  3MEK A;  1OMT A;  2ORV A;  1IW4 A;  2B8T A;  1TIH A;  4SGB I;  1M8C A;  1IY5 A;  1SGQ I;  1W4R A;  2LEO A;  1KBF A;  2ARP F;  1CHO I;  1BUS A;  2NU0 I;  2YUU A;  1PPF I;  2E73 A;  4FKD A;  5JHW C;  3QTL D;  1SGP I;  2N52 A;  1Y1B A;  1TBQ R;  2J9R A;  2KCX A;  2QQE A;  1PJU A;  2E5R A;  2ERW A;  5EX3 A;  1SGY I;  1SGE I;  1BMO A;  2ENN A;  3VDP A;  2L8E A;  1YTP A;  2B0U C;  2WVJ A;  1FAR A;  2F3C I;  2NU3 I;  3E2I A;  2CJS C;  1UVF A;  1VDD A;  2V1C A;  4E1P A;  2QQD A;  2JW6 A;  1U5K A;  3UFF A;  2SGD I;  3OL0 A;  1OYV I;  1W3S A;  1NUB A;  1X4S A;  2P6A C;  3B4V C;  1V1H A;  2NU2 I;  1PCE A;  2N71 A;  1SGD I;  1LR9 A;  3PDN A;  1TUS A;  3E59 A;  3BJI A;  1CGJ I;  2DIP A;  2V53 A;  2SGF I;  2J87 A;  4A24 A;  1HPT A;  3HH2 C;  3QWP A;  1UVG A;  5CCL A;  4UXI A;  2JXD A;  3UGD A;  3VE5 A;  1TBR R;  2BUS A;  1LR7 A;  2JZM A;  2GKV A;  2JA1 A;  4E1R A;  2JYY A;  2VRW B;  2ORW A;  5CCM A;  2WCY A;  5FUX A;  3SGQ I;  1CT4 I;  3VDU A;  3FC3 A;  2SGQ I;  3D00 A;  1Y8F A;  1TUR A;  2KMP A;  1TGS I;  2M5X A;  2GVI A;  2ROW A;  5DAE A;  1LR8 A;  2FNF X;  2ODD A;  5FUV A;  1CT0 I;  5HQ8 A;  1V1I A;  3TJQ A;  2A20 A;  2NU1 I;  4OVO A;  1XA6 A;  3UGI A;  2KMR A;  1KMA A;  1Y1C A;  2N17 A;  3GOX A;  1SGN I;  1FYB A;  1DS2 I;  1CGI I;  1X74 A;  1PTQ A;  1CSO I;  1MT1 A;  5HI7 A;  3RU0 A;  3OVO A;  1OVO A;  2W0T A;  2NU4 I;  1M8B A;  3CXL A;  4B6D A;  1HJA I;  1AN1 I;  1TBN A;  2SGE I;  2KMQ A;  4GI3 C;  2OVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...