4B6DA

Structure of the atypical c1 domain of mgcracgap
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
GPLGSMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAC GTPASE-ACTIVATING PROTEIN 1
publication title Centralspindlin Links the Mitotic Spindle to the Plasma Membrane During Cytokinesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4b6dA00
1Y8FA 1KBFA 2ELIA 2DB6A 2YUUA 3KY9A 3UEYA 2J87A 2JA1A 1FAQA 1TBNA 3UGLA 3UGIA 1W4RA 2ORVA 2ROWA 1PTRA 2VRWB 4B6DA 4L9MA 2ENNA 1RFHA 2B8TA 3E2IA 5FUXA 2ORWA 3BJIA 1TBOA 2QQEA 5FUWA 3CXLA 1PTQA 5FUVA 4UXJA 3UFFA 2UZ3A 4UXIA 2FNFX 2WVJA 1XA6A 1KBEA 1FARA 5FUYA 4FKDA 4UXHA 1XX6A 1R79A 2ENZA 3UEJA 3UGDA 1XBTA 2GVIA 2QQ0A 2E73A 2J9RA 2QPOA
chains in the Genus database with same CATH superfamily
1Y8FA 1KBFA 1MJAA 1LR9A 2OU2A 2DB6A 1TGSI 1X74A 1PCEA 2OZUA 1N13A 1R0RI 3OVOA 1TURA 1AN1I 1SGYI 2VRWB 3VDUA 2SGEI 1W3SA 2PQ8A 1WTJA 4E1RA 2ORWA 5FUWA 2DIPA 3SGBI 1PTQA 5J8CA 1CT0I 3R5BA 2OVOA 1IW4A 1Y1BA 2OD1A 4UXJA 5DAEA 3UFFA 1IY6A 3QTLD 2UZ3A 1WGCA 2ARPF 1PPFI 1H0ZA 1K7VA 1V1IA 2ODDA 2LB7A 2WCYA 1FARA 2N52A 2SGFI 1OVOA 1FY7A 3OL0A 2E5RA 1XX6A 1OMUA 3TO6A 3UEJA 3SEKC 1Y1CA 1YU6C 1ULNA 5CCMA 3CXLA 1TUSA 2L7XA 2K9HA 1SGRI 2ELIA 1TBRR 1MT1A 3FSYA 3UGLA 1UHAA 2KMPA 1LR7A 1W4RA 1U5KA 2KMOA 2RC4A 2ROWA 1M8CA 1PTRA 1TBQR 2NU2I 2SGDI 3QAHA 4AMLA 2JYYA 1V1HA 1UVFA 2ENNA 3B4VC 2B8TA 2Y0MA 2M5XA 2NU0I 5E3RA 3BJIA 2CWHA 2QQEA 5FUVA 1CHOI 1WGTA 2X52A 1IY5A 1SGPI 4JCVE 1K7TA 4UXIA 3QWPA 2LEOA 3R5CA 2WVJA 4OVOA 5E3PA 3TJQA 1ULMA 2W0TA 5FUYA 1NXUA 1HDLA 3OXLA 1TIHA 2JZMA 1BUSA 4UXHA 1CE3A 2JW6A 2X3TA 3HH2C 1M8BA 3R5DA 1HPTA 2LUYA 1KMAA 7WGAA 3TOAA 3PDNA 2YUUA 4WP4A 5CCLA 1TOTA 1P9ZA 2JA1A 4A24A 2GIVA 1UVGA 2SGQI 3TOBA 4GI3C 5J8FA 4HGUA 2F3CI 4L9MA 1RFHA 3E2IA 2QQCA 1Q9BA 2N17A 1TBOA 5HQ8A 2KMQA 4DNCA 3UGIA 5E3QA 5EX0A 1BMOA 2B0UC 1DS2I 5JHWC 2GKRI 3FC3A 2P6AC 3E59A 1HJAI 3OXFA 3SGQI 1SGQI 1VDDA 1XA6A 2NU4I 2WGCA 4MPIA 1Z7KB 1SGDI 2A20A 1SGNI 2ERWA 2KMRA 3RU0A 2CJSC 2QQDA 2BUSA 1R79A 2ENZA 3VE5A 1PJUA 2NU3I 5HI7A 1K7UA 2QQ0A 2QPOA 3TO9A 3GOXA 2DKVA 1CSOI 3KY9A 3UEYA 2J87A 1FAQA 1DS3I 1TBNA 2KCXA 4E1PA 1MJBA 2V1CA 2ORVA 2V53A 3D00A 1ULKA 2CWGA 3R5AA 2XRCA 2N71A 1CT4I 2CWFA 2L8EA 2N1AB 4SGBI 5EX3A 4B6DA 1FYBA 3MEKA 5FUXA 1CGII 3FSXA 2RIJA 2GKTI 1YTPA 3TO7A 1HEVA 1NUBA 1OYVI 1OMTA 1X4SA 1P9GA 1S20A 2NU1I 3UOEA 1SGEI 1LR8A 2GKVA 2UVOA 3VDPA 1MJ9A 2FNFX 1Z2IA 1CT2I 2JXDA 2YQPA 9WGAA 2SGPI 1KBEA 2V1CC 4FKDA 1UUCA 3UGDA 1XBTA 1WKXA 2GVIA 2E73A 2J9RA 1CGJI 3OXGA
chains in the Genus database with same CATH topology
1Y8FA 1KBFA 1LR9A 2DB6A 1TGSI 1X74A 1PCEA 1N13A 1R0RI 3OVOA 1TURA 1AN1I 1SGYI 2VRWB 3VDUA 2SGEI 1W3SA 4E1RA 2ORWA 5FUWA 2DIPA 3SGBI 1PTQA 1CT0I 2OVOA 1IW4A 1Y1BA 2OD1A 4UXJA 5DAEA 3UFFA 1IY6A 3QTLD 2UZ3A 2ARPF 1PPFI 1H0ZA 1V1IA 2WCYA 2ODDA 1FARA 2N52A 2SGFI 1OVOA 3OL0A 2E5RA 1XX6A 1OMUA 3UEJA 3SEKC 1Y1CA 1YU6C 3CXLA 1TUSA 2L7XA 2K9HA 1SGRI 2ELIA 1TBRR 1MT1A 3UGLA 2KMPA 1LR7A 1W4RA 1U5KA 2KMOA 2ROWA 1M8CA 1PTRA 1TBQR 2NU2I 2SGDI 2JYYA 1V1HA 1UVFA 2ENNA 3B4VC 2B8TA 2M5XA 2NU0I 3BJIA 2QQEA 5FUVA 1CHOI 1IY5A 1SGPI 4JCVE 4UXIA 3QWPA 2LEOA 4OVOA 2WVJA 3TJQA 2W0TA 5FUYA 1HDLA 3OXLA 1TIHA 2JZMA 1BUSA 4UXHA 1CE3A 2JW6A 1KMAA 3HH2C 1M8BA 1HPTA 2LUYA 3PDNA 2YUUA 5CCLA 1TOTA 2JA1A 4A24A 1UVGA 2SGQI 4GI3C 4HGUA 2F3CI 4L9MA 1RFHA 3E2IA 2QQCA 2N17A 1TBOA 5HQ8A 2KMQA 5EX0A 1BMOA 2B0UC 1DS2I 5JHWC 2GKRI 3FC3A 2P6AC 3E59A 1HJAI 3OXFA 3SGQI 1SGQI 1VDDA 1XA6A 2NU4I 1Z7KB 1SGDI 2A20A 1SGNI 2ERWA 2KMRA 3RU0A 2CJSC 2QQDA 2BUSA 1R79A 2ENZA 3VE5A 1PJUA 2NU3I 5HI7A 2QQ0A 2QPOA 3GOXA 1CSOI 3KY9A 3UEYA 2J87A 1FAQA 1DS3I 1TBNA 2KCXA 4E1PA 2V1CA 3UGIA 2ORVA 2V53A 3D00A 5CCMA 2XRCA 2N71A 1CT4I 2L8EA 2N1AB 4SGBI 5EX3A 4B6DA 1FYBA 3MEKA 5FUXA 1CGII 2GKTI 1YTPA 1NUBA 1OYVI 1OMTA 1X4SA 2NU1I 1SGEI 1LR8A 2GKVA 3VDPA 2FNFX 2JXDA 1CT2I 2YQPA 2SGPI 1KBEA 2V1CC 4FKDA 1UUCA 3UGDA 1XBTA 2GVIA 2E73A 2J9RA 1CGJI 3OXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8F A;  1KBF A;  2ELI A;  2DB6 A;  2YUU A;  3KY9 A;  3UEY A;  2J87 A;  2JA1 A;  1FAQ A;  1TBN A;  3UGL A;  3UGI A;  1W4R A;  2ORV A;  2ROW A;  1PTR A;  2VRW B;  4B6D A;  4L9M A;  2ENN A;  1RFH A;  2B8T A;  3E2I A;  5FUX A;  2ORW A;  3BJI A;  1TBO A;  2QQE A;  5FUW A;  3CXL A;  1PTQ A;  5FUV A;  4UXJ A;  3UFF A;  2UZ3 A;  4UXI A;  2FNF X;  2WVJ A;  1XA6 A;  1KBE A;  1FAR A;  5FUY A;  4FKD A;  4UXH A;  1XX6 A;  1R79 A;  2ENZ A;  3UEJ A;  3UGD A;  1XBT A;  2GVI A;  2QQ0 A;  2E73 A;  2J9R A;  2QPO A; 
#chains in the Genus database with same CATH topology
 1Y8F A;  1KBF A;  1MJA A;  1LR9 A;  2OU2 A;  2DB6 A;  1TGS I;  1X74 A;  1PCE A;  2OZU A;  1N13 A;  1R0R I;  3OVO A;  1TUR A;  1AN1 I;  1SGY I;  2VRW B;  3VDU A;  2SGE I;  1W3S A;  2PQ8 A;  1WTJ A;  4E1R A;  2ORW A;  5FUW A;  2DIP A;  3SGB I;  1PTQ A;  5J8C A;  1CT0 I;  3R5B A;  2OVO A;  1IW4 A;  1Y1B A;  2OD1 A;  4UXJ A;  5DAE A;  3UFF A;  1IY6 A;  3QTL D;  2UZ3 A;  1WGC A;  2ARP F;  1PPF I;  1H0Z A;  1K7V A;  1V1I A;  2ODD A;  2LB7 A;  2WCY A;  1FAR A;  2N52 A;  2SGF I;  1OVO A;  1FY7 A;  3OL0 A;  2E5R A;  1XX6 A;  1OMU A;  3TO6 A;  3UEJ A;  3SEK C;  1Y1C A;  1YU6 C;  1ULN A;  5CCM A;  3CXL A;  1TUS A;  2L7X A;  2K9H A;  1SGR I;  2ELI A;  1TBR R;  1MT1 A;  3FSY A;  3UGL A;  1UHA A;  2KMP A;  1LR7 A;  1W4R A;  1U5K A;  2KMO A;  2RC4 A;  2ROW A;  1M8C A;  1PTR A;  1TBQ R;  2NU2 I;  2SGD I;  3QAH A;  4AML A;  2JYY A;  1V1H A;  1UVF A;  2ENN A;  3B4V C;  2B8T A;  2Y0M A;  2M5X A;  2NU0 I;  5E3R A;  3BJI A;  2CWH A;  2QQE A;  5FUV A;  1CHO I;  1WGT A;  2X52 A;  1IY5 A;  1SGP I;  4JCV E;  1K7T A;  4UXI A;  3QWP A;  2LEO A;  3R5C A;  2WVJ A;  4OVO A;  5E3P A;  3TJQ A;  1ULM A;  2W0T A;  5FUY A;  1NXU A;  1HDL A;  3OXL A;  1TIH A;  2JZM A;  1BUS A;  4UXH A;  1CE3 A;  2JW6 A;  2X3T A;  3HH2 C;  1M8B A;  3R5D A;  1HPT A;  2LUY A;  1KMA A;  7WGA A;  3TOA A;  3PDN A;  2YUU A;  4WP4 A;  5CCL A;  1TOT A;  1P9Z A;  2JA1 A;  4A24 A;  2GIV A;  1UVG A;  2SGQ I;  3TOB A;  4GI3 C;  5J8F A;  4HGU A;  2F3C I;  4L9M A;  1RFH A;  3E2I A;  2QQC A;  1Q9B A;  2N17 A;  1TBO A;  5HQ8 A;  2KMQ A;  4DNC A;  3UGI A;  5E3Q A;  5EX0 A;  1BMO A;  2B0U C;  1DS2 I;  5JHW C;  2GKR I;  3FC3 A;  2P6A C;  3E59 A;  1HJA I;  3OXF A;  3SGQ I;  1SGQ I;  1VDD A;  1XA6 A;  2NU4 I;  2WGC A;  4MPI A;  1Z7K B;  1SGD I;  2A20 A;  1SGN I;  2ERW A;  2KMR A;  3RU0 A;  2CJS C;  2QQD A;  2BUS A;  1R79 A;  2ENZ A;  3VE5 A;  1PJU A;  2NU3 I;  5HI7 A;  1K7U A;  2QQ0 A;  2QPO A;  3TO9 A;  3GOX A;  2DKV A;  1CSO I;  3KY9 A;  3UEY A;  2J87 A;  1FAQ A;  1DS3 I;  1TBN A;  2KCX A;  4E1P A;  1MJB A;  2V1C A;  2ORV A;  2V53 A;  3D00 A;  1ULK A;  2CWG A;  3R5A A;  2XRC A;  2N71 A;  1CT4 I;  2CWF A;  2L8E A;  2N1A B;  4SGB I;  5EX3 A;  4B6D A;  1FYB A;  3MEK A;  5FUX A;  1CGI I;  3FSX A;  2RIJ A;  2GKT I;  1YTP A;  3TO7 A;  1HEV A;  1NUB A;  1OYV I;  1OMT A;  1X4S A;  1P9G A;  1S20 A;  2NU1 I;  3UOE A;  1SGE I;  1LR8 A;  2GKV A;  2UVO A;  3VDP A;  1MJ9 A;  2FNF X;  1Z2I A;  1CT2 I;  2JXD A;  2YQP A;  9WGA A;  2SGP I;  1KBE A;  2V1C C;  4FKD A;  1UUC A;  3UGD A;  1XBT A;  1WKX A;  2GVI A;  2E73 A;  2J9R A;  1CGJ I;  3OXG A; 
#chains in the Genus database with same CATH homology
 1Y8F A;  1KBF A;  1LR9 A;  2DB6 A;  1TGS I;  1X74 A;  1PCE A;  1N13 A;  1R0R I;  3OVO A;  1TUR A;  1AN1 I;  1SGY I;  2VRW B;  3VDU A;  2SGE I;  1W3S A;  4E1R A;  2ORW A;  5FUW A;  2DIP A;  3SGB I;  1PTQ A;  1CT0 I;  2OVO A;  1IW4 A;  1Y1B A;  2OD1 A;  4UXJ A;  5DAE A;  3UFF A;  1IY6 A;  3QTL D;  2UZ3 A;  2ARP F;  1PPF I;  1H0Z A;  1V1I A;  2WCY A;  2ODD A;  1FAR A;  2N52 A;  2SGF I;  1OVO A;  3OL0 A;  2E5R A;  1XX6 A;  1OMU A;  3UEJ A;  3SEK C;  1Y1C A;  1YU6 C;  3CXL A;  1TUS A;  2L7X A;  2K9H A;  1SGR I;  2ELI A;  1TBR R;  1MT1 A;  3UGL A;  2KMP A;  1LR7 A;  1W4R A;  1U5K A;  2KMO A;  2ROW A;  1M8C A;  1PTR A;  1TBQ R;  2NU2 I;  2SGD I;  2JYY A;  1V1H A;  1UVF A;  2ENN A;  3B4V C;  2B8T A;  2M5X A;  2NU0 I;  3BJI A;  2QQE A;  5FUV A;  1CHO I;  1IY5 A;  1SGP I;  4JCV E;  4UXI A;  3QWP A;  2LEO A;  4OVO A;  2WVJ A;  3TJQ A;  2W0T A;  5FUY A;  1HDL A;  3OXL A;  1TIH A;  2JZM A;  1BUS A;  4UXH A;  1CE3 A;  2JW6 A;  1KMA A;  3HH2 C;  1M8B A;  1HPT A;  2LUY A;  3PDN A;  2YUU A;  5CCL A;  1TOT A;  2JA1 A;  4A24 A;  1UVG A;  2SGQ I;  4GI3 C;  4HGU A;  2F3C I;  4L9M A;  1RFH A;  3E2I A;  2QQC A;  2N17 A;  1TBO A;  5HQ8 A;  2KMQ A;  5EX0 A;  1BMO A;  2B0U C;  1DS2 I;  5JHW C;  2GKR I;  3FC3 A;  2P6A C;  3E59 A;  1HJA I;  3OXF A;  3SGQ I;  1SGQ I;  1VDD A;  1XA6 A;  2NU4 I;  1Z7K B;  1SGD I;  2A20 A;  1SGN I;  2ERW A;  2KMR A;  3RU0 A;  2CJS C;  2QQD A;  2BUS A;  1R79 A;  2ENZ A;  3VE5 A;  1PJU A;  2NU3 I;  5HI7 A;  2QQ0 A;  2QPO A;  3GOX A;  1CSO I;  3KY9 A;  3UEY A;  2J87 A;  1FAQ A;  1DS3 I;  1TBN A;  2KCX A;  4E1P A;  2V1C A;  3UGI A;  2ORV A;  2V53 A;  3D00 A;  5CCM A;  2XRC A;  2N71 A;  1CT4 I;  2L8E A;  2N1A B;  4SGB I;  5EX3 A;  4B6D A;  1FYB A;  3MEK A;  5FUX A;  1CGI I;  2GKT I;  1YTP A;  1NUB A;  1OYV I;  1OMT A;  1X4S A;  2NU1 I;  1SGE I;  1LR8 A;  2GKV A;  3VDP A;  2FNF X;  2JXD A;  1CT2 I;  2YQP A;  2SGP I;  1KBE A;  2V1C C;  4FKD A;  1UUC A;  3UGD A;  1XBT A;  2GVI A;  2E73 A;  2J9R A;  1CGJ I;  3OXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...