2P6AC

The structure of the activin:follistatin 315 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
290
structure length
282
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPKCRMNKKNKPRCVCAPDCSNKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Inhibin beta A chain
publication title Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 282
sequence length 290
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 2p6aC01
1NUBA 1UUCA 1SGQI 4OVOA 1IY6A 1TUSA 1M8BA 2N71A 1Z7KB 3OVOA 1UVFA 1CGJI 1HDLA 5JHWC 1UZQA 1KSQA 2N52A 1HPTA 1UVGA 2P6AC 3B4VC 2OVOA 4GI3C 4HGUA 3SGQI 1YU6C 1SGNI 2BUSA 1Y1CA 2XRCA 1TBRR 2NU4I 2QQDA 5DAEA 2GKRI 2QQCA 2KMRA 2NU3I 1CHOI 1APJA 1OYVI 2JYYA 1HJAI 1FYBA 1DS2I 2GKTI 1CT4I 1SGYI 1LR8A 1PJUA 2GKVA 2NU1I 2NU2I 2WCYA 1OMUA 2KMOA 1Y1BA 3SGBI 2SGQI 1MT1A 2V53A 2F3CI 1CT0I 1DS3I 2JXDA 1BMOA 2JZMA 1UZPA 1TIHA 1R0RI 3QTLD 1UZKA 1SGRI 1IY5A 1N13A 1SGEI 2NU0I 1UZJA 2SGEI 1CE3A 1CT2I 3HH2C 2SGDI 2B0UC 1TGSI 3TJQA 1SGPI 1LR7A 2KMQA 2N17A 2ERWA 2W86A 1M8CA 1IW4A 1H0ZA 1CGII 1PCEA 1OVOA 1SGDI 1TURA 1KMAA 1AN1I 2SGPI 1TBQR 3SEKC 1OMTA 1LR9A 2ARPF 2LEOA 1BUSA 1YTPA 2KMPA 4SGBI 2M5XA 2SGFI 1PPFI 2KCXA 1CSOI
chains in the Genus database with same CATH superfamily
4FKDA 1NUBA 1UUCA 1SGQI 1VDDA 4OVOA 1IY6A 2OD1A 1TUSA 1M8BA 2N71A 2GIVA 2OU2A 1XBTA 1NXUA 2J87A 1Z7KB 1X4SA 1TOTA 1PTQA 3MEKA 3OVOA 1UVFA 5E3RA 3TOBA 1CGJI 2QQEA 4UXJA 1HDLA 2PQ8A 2OZUA 5JHWC 1ULNA 1UZQA 3VDPA 1KSQA 2QPOA 5FUWA 3R5AA 2N52A 1HPTA 3FSYA 5EX0A 1UVGA 1V1HA 1W4RA 3CXLA 2P6AC 5E3QA 2WGCA 3B4VC 2ENZA 2A20A 2LB7A 1PTRA 2OVOA 4GI3C 1MJBA 4HGUA 1XX6A 4AMLA 3SGQI 1YU6C 1SGNI 1K7TA 2BUSA 1WTJA 3QAHA 1Y1CA 2QQ0A 1TBRR 2XRCA 5HI7A 2UVOA 2NU4I 2QQDA 4A24A 3OL0A 2ODDA 5DAEA 2DKVA 2DIPA 2GKRI 2QQCA 2ROWA 2KMRA 4DNCA 3UFFA 1FAQA 2RC4A 2NU3I 3FSXA 1CHOI 1APJA 1OYVI 2JYYA 4E1RA 1HJAI 1P9ZA 3OXGA 1HEVA 5E3PA 3GOXA 1DS2I 2GKTI 5FUYA 1FYBA 1CT4I 1SGYI 3OXLA 2RIJA 1R79A 2CJSC 1LR8A 1PJUA 4L9MA 2X3TA 3TOAA 2GKVA 1X74A 2NU1I 2NU2I 2WCYA 1FARA 2YQPA 1OMUA 1Q9BA 1Y1BA 2KMOA 5J8FA 3D00A 3SGBI 4UXHA 2SGQI 3UEJA 1TBNA 5CCMA 2E73A 3PDNA 1MT1A 1UHAA 2ELIA 5J8CA 2V53A 2F3CI 5FUVA 1CT0I 3UEYA 1MJAA 1ULKA 1DS3I 2JXDA 3R5CA 2E5RA 1BMOA 2JZMA 3UGDA 1UZPA 2CWFA 2W0TA 1TIHA 3UOEA 5HQ8A 3TO9A 1R0RI 2JW6A 1WGTA 3QTLD 5EX3A 2UZ3A 1S20A 1Z2IA 4B6DA 4E1PA 9WGAA 1UZKA 1SGRI 1V1IA 3KY9A 2CWGA 4WP4A 3TO7A 4MPIA 3FC3A 7WGAA 1IY5A 1XA6A 1TBOA 2J9RA 1N13A 2K9HA 2L8EA 5FUXA 2B8TA 3R5DA 1K7VA 1SGEI 1Y8FA 3BJIA 1WGCA 2NU0I 1UZJA 2SGEI 1P9GA 1WKXA 2LUYA 1CE3A 1CT2I 2N1AB 1MJ9A 1K7UA 4UXIA 2FNFX 1W3SA 3RU0A 3VE5A 1RFHA 3HH2C 2SGDI 3VDUA 5CCLA 1ULMA 3UGLA 2B0UC 1TGSI 3TJQA 3TO6A 1SGPI 2YUUA 1LR7A 2KMQA 2N17A 2ERWA 2W86A 1M8CA 2GVIA 1IW4A 2V1CC 2ENNA 2CWHA 2VRWB 3OXFA 1H0ZA 1CGII 2V1CA 1PCEA 1U5KA 1OVOA 1SGDI 1KBFA 3E2IA 1TURA 1KMAA 1AN1I 2JA1A 2L7XA 1KBEA 2WVJA 3QWPA 2SGPI 1TBQR 3SEKC 1OMTA 2ORVA 2X52A 3R5BA 1LR9A 2ARPF 2LEOA 1FY7A 1YTPA 1BUSA 2KMPA 2DB6A 2ORWA 4SGBI 3E59A 4JCVE 2M5XA 3UGIA 2SGFI 1PPFI 2KCXA 2Y0MA 1CSOI
chains in the Genus database with same CATH topology
4FKDA 1NUBA 1UUCA 1SGQI 1VDDA 4OVOA 1IY6A 2OD1A 1TUSA 1M8BA 2N71A 1XBTA 2J87A 1Z7KB 1X4SA 1TOTA 1PTQA 3MEKA 3OVOA 1UVFA 1CGJI 2QQEA 4UXJA 1HDLA 5JHWC 1UZQA 3VDPA 1KSQA 2QPOA 5FUWA 2N52A 1HPTA 5EX0A 1UVGA 1V1HA 1W4RA 3CXLA 2P6AC 3B4VC 2ENZA 2A20A 1PTRA 2OVOA 4GI3C 4HGUA 1XX6A 3SGQI 1YU6C 1SGNI 2BUSA 1Y1CA 2QQ0A 1TBRR 2XRCA 5HI7A 4A24A 2NU4I 2QQDA 3OL0A 2ODDA 5DAEA 2GKRI 2DIPA 2ROWA 2QQCA 2KMRA 3UFFA 1FAQA 2NU3I 1CHOI 1APJA 1OYVI 2JYYA 4E1RA 1HJAI 3OXGA 3GOXA 1FYBA 1DS2I 2GKTI 5FUYA 1CT4I 1SGYI 3OXLA 4L9MA 1R79A 2CJSC 1LR8A 1PJUA 2GKVA 1X74A 2NU1I 2NU2I 2WCYA 1FARA 2YQPA 1OMUA 2KMOA 1Y1BA 3D00A 3SGBI 4UXHA 2SGQI 3UEJA 1TBNA 5CCMA 2E73A 3PDNA 1MT1A 2ELIA 2V53A 2F3CI 5FUVA 1CT0I 3UEYA 1DS3I 2JXDA 2E5RA 1BMOA 2JZMA 3UGDA 1UZPA 2W0TA 1TIHA 1R0RI 2JW6A 3QTLD 5EX3A 2UZ3A 4E1PA 4B6DA 1UZKA 1SGRI 1V1IA 3KY9A 3FC3A 1IY5A 1XA6A 1TBOA 2J9RA 1N13A 2K9HA 2L8EA 5FUXA 2B8TA 1SGEI 1Y8FA 3BJIA 2NU0I 1UZJA 2SGEI 2LUYA 1CE3A 1CT2I 2N1AB 4UXIA 2FNFX 1W3SA 3RU0A 3VE5A 1RFHA 3HH2C 2SGDI 3VDUA 5CCLA 3UGLA 2B0UC 1TGSI 3TJQA 1SGPI 2YUUA 1LR7A 2KMQA 2N17A 2ERWA 2W86A 1M8CA 2GVIA 1IW4A 2V1CC 2ENNA 2VRWB 3OXFA 1H0ZA 1CGII 2V1CA 1PCEA 1U5KA 1OVOA 1SGDI 1KBFA 3E2IA 1TURA 1KMAA 1AN1I 2JA1A 2L7XA 1KBEA 2WVJA 3QWPA 2SGPI 1TBQR 3SEKC 1OMTA 2ORVA 1LR9A 2ARPF 2LEOA 1BUSA 1YTPA 2KMPA 2DB6A 2ORWA 4SGBI 3E59A 4JCVE 2M5XA 3UGIA 2SGFI 1PPFI 2KCXA 5HQ8A 1CSOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUB A;  1UUC A;  1SGQ I;  4OVO A;  1IY6 A;  1TUS A;  1M8B A;  2N71 A;  1Z7K B;  3OVO A;  1UVF A;  1CGJ I;  1HDL A;  5JHW C;  1UZQ A;  1KSQ A;  2N52 A;  1HPT A;  1UVG A;  2P6A C;  3B4V C;  2OVO A;  4GI3 C;  4HGU A;  3SGQ I;  1YU6 C;  1SGN I;  2BUS A;  1Y1C A;  2XRC A;  1TBR R;  2NU4 I;  2QQD A;  5DAE A;  2GKR I;  2QQC A;  2KMR A;  2NU3 I;  1CHO I;  1APJ A;  1OYV I;  2JYY A;  1HJA I;  1FYB A;  1DS2 I;  2GKT I;  1CT4 I;  1SGY I;  1LR8 A;  1PJU A;  2GKV A;  2NU1 I;  2NU2 I;  2WCY A;  1OMU A;  2KMO A;  1Y1B A;  3SGB I;  2SGQ I;  1MT1 A;  2V53 A;  2F3C I;  1CT0 I;  1DS3 I;  2JXD A;  1BMO A;  2JZM A;  1UZP A;  1TIH A;  1R0R I;  3QTL D;  1UZK A;  1SGR I;  1IY5 A;  1N13 A;  1SGE I;  2NU0 I;  1UZJ A;  2SGE I;  1CE3 A;  1CT2 I;  3HH2 C;  2SGD I;  2B0U C;  1TGS I;  3TJQ A;  1SGP I;  1LR7 A;  2KMQ A;  2N17 A;  2ERW A;  2W86 A;  1M8C A;  1IW4 A;  1H0Z A;  1CGI I;  1PCE A;  1OVO A;  1SGD I;  1TUR A;  1KMA A;  1AN1 I;  2SGP I;  1TBQ R;  3SEK C;  1OMT A;  1LR9 A;  2ARP F;  2LEO A;  1BUS A;  1YTP A;  2KMP A;  4SGB I;  2M5X A;  2SGF I;  1PPF I;  2KCX A;  1CSO I; 
#chains in the Genus database with same CATH topology
 4FKD A;  1NUB A;  1UUC A;  1SGQ I;  1VDD A;  4OVO A;  1IY6 A;  2OD1 A;  1TUS A;  1M8B A;  2N71 A;  2GIV A;  2OU2 A;  1XBT A;  1NXU A;  2J87 A;  1Z7K B;  1X4S A;  1TOT A;  1PTQ A;  3MEK A;  3OVO A;  1UVF A;  5E3R A;  3TOB A;  1CGJ I;  2QQE A;  4UXJ A;  1HDL A;  2PQ8 A;  2OZU A;  5JHW C;  1ULN A;  1UZQ A;  3VDP A;  1KSQ A;  2QPO A;  5FUW A;  3R5A A;  2N52 A;  1HPT A;  3FSY A;  5EX0 A;  1UVG A;  1V1H A;  1W4R A;  3CXL A;  2P6A C;  5E3Q A;  2WGC A;  3B4V C;  2ENZ A;  2A20 A;  2LB7 A;  1PTR A;  2OVO A;  4GI3 C;  1MJB A;  4HGU A;  1XX6 A;  4AML A;  3SGQ I;  1YU6 C;  1SGN I;  1K7T A;  2BUS A;  1WTJ A;  3QAH A;  1Y1C A;  2QQ0 A;  1TBR R;  2XRC A;  5HI7 A;  2UVO A;  2NU4 I;  2QQD A;  4A24 A;  3OL0 A;  2ODD A;  5DAE A;  2DKV A;  2DIP A;  2GKR I;  2QQC A;  2ROW A;  2KMR A;  4DNC A;  3UFF A;  1FAQ A;  2RC4 A;  2NU3 I;  3FSX A;  1CHO I;  1APJ A;  1OYV I;  2JYY A;  4E1R A;  1HJA I;  1P9Z A;  3OXG A;  1HEV A;  5E3P A;  3GOX A;  1DS2 I;  2GKT I;  5FUY A;  1FYB A;  1CT4 I;  1SGY I;  3OXL A;  2RIJ A;  1R79 A;  2CJS C;  1LR8 A;  1PJU A;  4L9M A;  2X3T A;  3TOA A;  2GKV A;  1X74 A;  2NU1 I;  2NU2 I;  2WCY A;  1FAR A;  2YQP A;  1OMU A;  1Q9B A;  1Y1B A;  2KMO A;  5J8F A;  3D00 A;  3SGB I;  4UXH A;  2SGQ I;  3UEJ A;  1TBN A;  5CCM A;  2E73 A;  3PDN A;  1MT1 A;  1UHA A;  2ELI A;  5J8C A;  2V53 A;  2F3C I;  5FUV A;  1CT0 I;  3UEY A;  1MJA A;  1ULK A;  1DS3 I;  2JXD A;  3R5C A;  2E5R A;  1BMO A;  2JZM A;  3UGD A;  1UZP A;  2CWF A;  2W0T A;  1TIH A;  3UOE A;  5HQ8 A;  3TO9 A;  1R0R I;  2JW6 A;  1WGT A;  3QTL D;  5EX3 A;  2UZ3 A;  1S20 A;  1Z2I A;  4B6D A;  4E1P A;  9WGA A;  1UZK A;  1SGR I;  1V1I A;  3KY9 A;  2CWG A;  4WP4 A;  3TO7 A;  4MPI A;  3FC3 A;  7WGA A;  1IY5 A;  1XA6 A;  1TBO A;  2J9R A;  1N13 A;  2K9H A;  2L8E A;  5FUX A;  2B8T A;  3R5D A;  1K7V A;  1SGE I;  1Y8F A;  3BJI A;  1WGC A;  2NU0 I;  1UZJ A;  2SGE I;  1P9G A;  1WKX A;  2LUY A;  1CE3 A;  1CT2 I;  2N1A B;  1MJ9 A;  1K7U A;  4UXI A;  2FNF X;  1W3S A;  3RU0 A;  3VE5 A;  1RFH A;  3HH2 C;  2SGD I;  3VDU A;  5CCL A;  1ULM A;  3UGL A;  2B0U C;  1TGS I;  3TJQ A;  3TO6 A;  1SGP I;  2YUU A;  1LR7 A;  2KMQ A;  2N17 A;  2ERW A;  2W86 A;  1M8C A;  2GVI A;  1IW4 A;  2V1C C;  2ENN A;  2CWH A;  2VRW B;  3OXF A;  1H0Z A;  1CGI I;  2V1C A;  1PCE A;  1U5K A;  1OVO A;  1SGD I;  1KBF A;  3E2I A;  1TUR A;  1KMA A;  1AN1 I;  2JA1 A;  2L7X A;  1KBE A;  2WVJ A;  3QWP A;  2SGP I;  1TBQ R;  3SEK C;  1OMT A;  2ORV A;  2X52 A;  3R5B A;  1LR9 A;  2ARP F;  2LEO A;  1FY7 A;  1YTP A;  1BUS A;  2KMP A;  2DB6 A;  2ORW A;  4SGB I;  3E59 A;  4JCV E;  2M5X A;  3UGI A;  2SGF I;  1PPF I;  2KCX A;  2Y0M A;  1CSO I; 
#chains in the Genus database with same CATH homology
 4FKD A;  1NUB A;  1UUC A;  1SGQ I;  1VDD A;  4OVO A;  1IY6 A;  2OD1 A;  1TUS A;  1M8B A;  2N71 A;  1XBT A;  2J87 A;  1Z7K B;  1X4S A;  1TOT A;  1PTQ A;  3MEK A;  3OVO A;  1UVF A;  1CGJ I;  2QQE A;  4UXJ A;  1HDL A;  5JHW C;  1UZQ A;  3VDP A;  1KSQ A;  2QPO A;  5FUW A;  2N52 A;  1HPT A;  5EX0 A;  1UVG A;  1V1H A;  1W4R A;  3CXL A;  2P6A C;  3B4V C;  2ENZ A;  2A20 A;  1PTR A;  2OVO A;  4GI3 C;  4HGU A;  1XX6 A;  3SGQ I;  1YU6 C;  1SGN I;  2BUS A;  1Y1C A;  2QQ0 A;  1TBR R;  2XRC A;  5HI7 A;  4A24 A;  2NU4 I;  2QQD A;  3OL0 A;  2ODD A;  5DAE A;  2GKR I;  2DIP A;  2ROW A;  2QQC A;  2KMR A;  3UFF A;  1FAQ A;  2NU3 I;  1CHO I;  1APJ A;  1OYV I;  2JYY A;  4E1R A;  1HJA I;  3OXG A;  3GOX A;  1FYB A;  1DS2 I;  2GKT I;  5FUY A;  1CT4 I;  1SGY I;  3OXL A;  4L9M A;  1R79 A;  2CJS C;  1LR8 A;  1PJU A;  2GKV A;  1X74 A;  2NU1 I;  2NU2 I;  2WCY A;  1FAR A;  2YQP A;  1OMU A;  2KMO A;  1Y1B A;  3D00 A;  3SGB I;  4UXH A;  2SGQ I;  3UEJ A;  1TBN A;  5CCM A;  2E73 A;  3PDN A;  1MT1 A;  2ELI A;  2V53 A;  2F3C I;  5FUV A;  1CT0 I;  3UEY A;  1DS3 I;  2JXD A;  2E5R A;  1BMO A;  2JZM A;  3UGD A;  1UZP A;  2W0T A;  1TIH A;  1R0R I;  2JW6 A;  3QTL D;  5EX3 A;  2UZ3 A;  4E1P A;  4B6D A;  1UZK A;  1SGR I;  1V1I A;  3KY9 A;  3FC3 A;  1IY5 A;  1XA6 A;  1TBO A;  2J9R A;  1N13 A;  2K9H A;  2L8E A;  5FUX A;  2B8T A;  1SGE I;  1Y8F A;  3BJI A;  2NU0 I;  1UZJ A;  2SGE I;  2LUY A;  1CE3 A;  1CT2 I;  2N1A B;  4UXI A;  2FNF X;  1W3S A;  3RU0 A;  3VE5 A;  1RFH A;  3HH2 C;  2SGD I;  3VDU A;  5CCL A;  3UGL A;  2B0U C;  1TGS I;  3TJQ A;  1SGP I;  2YUU A;  1LR7 A;  2KMQ A;  2N17 A;  2ERW A;  2W86 A;  1M8C A;  2GVI A;  1IW4 A;  2V1C C;  2ENN A;  2VRW B;  3OXF A;  1H0Z A;  1CGI I;  2V1C A;  1PCE A;  1U5K A;  1OVO A;  1SGD I;  1KBF A;  3E2I A;  1TUR A;  1KMA A;  1AN1 I;  2JA1 A;  2L7X A;  1KBE A;  2WVJ A;  3QWP A;  2SGP I;  1TBQ R;  3SEK C;  1OMT A;  2ORV A;  1LR9 A;  2ARP F;  2LEO A;  1BUS A;  1YTP A;  2KMP A;  2DB6 A;  2ORW A;  4SGB I;  3E59 A;  4JCV E;  2M5X A;  3UGI A;  2SGF I;  1PPF I;  2KCX A;  5HQ8 A;  1CSO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...