2P6AC

The structure of the activin:follistatin 315 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
290
structure length
282
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPKCRMNKKNKPRCVCAPDCSNKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibin beta A chain
publication title Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 282
sequence length 290
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2p6aC02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 2p6aC01
1TIHA 1YU6C 1TBRR 1TBQR 1HPTA 1CT0I 1M8BA 1SGNI 3OVOA 2SGDI 2WCYA 1R0RI 2W86A 2QQDA 3SGBI 1UZJA 1CGJI 2GKVA 1SGQI 1APJA 1SGDI 3B4VC 3HH2C 1SGRI 2OVOA 1BMOA 2GKRI 1LR8A 1KMAA 1H0ZA 2BUSA 1PJUA 1TGSI 1MT1A 2NU2I 1Z7KB 2JZMA 2KMPA 3QTLD 1CHOI 1PCEA 1SGEI 2KMRA 2SGPI 2V53A 2N71A 1BUSA 1TUSA 2KMOA 2KMQA 3TJQA 1DS3I 1HDLA 5JHWC 1YTPA 2JXDA 1LR9A 1M8CA 2GKTI 1FYBA 1CT2I 1CT4I 5DAEA 2NU0I 1UZPA 2NU1I 1UZKA 4OVOA 1Y1CA 1CGII 1NUBA 1DS2I 2SGFI 1CE3A 1LR7A 4SGBI 1IY5A 1IY6A 1UVFA 1OMTA 1HJAI 1OMUA 1N13A 1OYVI 3SEKC 1CSOI 2NU4I 1Y1BA 2N17A 1KSQA 2JYYA 2ARPF 2NU3I 1TURA 1SGYI 2SGEI 1OVOA 1PPFI 2SGQI 1UUCA 2QQCA 2F3CI 3SGQI 1IW4A 2KCXA 2XRCA 2ERWA 2M5XA 1SGPI 4HGUA 4GI3C 2B0UC 2P6AC 1UVGA 1AN1I 2N52A 2LEOA 1UZQA
chains in the Genus database with same CATH superfamily
1TBOA 1RFHA 1TIHA 2L7XA 3R5AA 5FUXA 2B8TA 3UGIA 1X74A 1YU6C 2JA1A 1TBRR 3TOAA 4UXHA 1TBQR 1UZJA 5CCMA 1HPTA 2CJSC 2V1CC 1CT0I 1M8BA 3UGLA 2PQ8A 2CWHA 1SGNI 3VE5A 3OVOA 2SGDI 1W3SA 1R0RI 2WCYA 2QQEA 2W86A 3UFFA 2QQDA 2E5RA 3R5CA 3SGBI 1CGJI 2GKVA 2UVOA 5EX3A 3UEYA 2J9RA 4FKDA 5HQ8A 1SGQI 1MJBA 1P9ZA 3R5BA 1APJA 1SGDI 3B4VC 3HH2C 1SGRI 2ENNA 2OVOA 1BMOA 2GKRI 1LR8A 1FARA 1WGCA 1KMAA 5EX0A 1KBEA 1V1HA 2JW6A 1H0ZA 1S20A 2BUSA 2A20A 2LB7A 3E2IA 1PJUA 1ULNA 1TGSI 3MEKA 1MT1A 2NU2I 1Z7KB 1XA6A 2JZMA 1UHAA 2KMPA 3D00A 3QTLD 1CHOI 3FC3A 1PCEA 2QPOA 5FUWA 1SGEI 1K7UA 2KMRA 2UZ3A 2SGPI 2DB6A 2V53A 2WGCA 3KY9A 5E3PA 3TOBA 2DKVA 5E3QA 2LUYA 2N71A 1BUSA 1R79A 1FAQA 2J87A 2ORWA 1WKXA 1TUSA 2KMOA 2KMQA 3UOEA 2YQPA 2CWFA 1DS3I 3TJQA 1PTRA 1HDLA 5J8CA 5JHWC 2RC4A 1ULKA 1YTPA 2JXDA 3BJIA 2V1CA 1V1IA 2E73A 1LR9A 1M8CA 2GKTI 4UXIA 1XX6A 2Y0MA 1PTQA 1FYBA 2X52A 1CT2I 1WGTA 2RIJA 5FUYA 1TOTA 3UGDA 1MJ9A 2GIVA 3VDPA 3QAHA 3GOXA 1CT4I 3OXFA 5DAEA 4DNCA 2NU0I 1X4SA 2NU1I 1UZKA 1UZPA 4L9MA 3UEJA 2N1AB 1XBTA 1TBNA 4OVOA 2X3TA 1Y1CA 1CGII 1FY7A 1NUBA 3TO6A 2FNFX 1DS2I 1W4RA 2SGFI 1Z2IA 5E3RA 1CE3A 3FSYA 1LR7A 4B6DA 4SGBI 1WTJA 2ORVA 2OU2A 3TO7A 9WGAA 1HEVA 1U5KA 2YUUA 4E1RA 1IY5A 1IY6A 2OZUA 2WVJA 1UVFA 1Y8FA 2CWGA 4WP4A 2L8EA 2ODDA 7WGAA 1VDDA 1KBFA 3R5DA 1OMTA 1HJAI 3OXLA 1Q9BA 3PDNA 1OMUA 4UXJA 3FSXA 1N13A 1OYVI 3SEKC 1CSOI 2NU4I 2VRWB 2W0TA 4E1PA 2ENZA 3CXLA 1Y1BA 2K9HA 2N17A 3OL0A 3E59A 1KSQA 1P9GA 2JYYA 4AMLA 2ARPF 2NU3I 5J8FA 2GVIA 3OXGA 4MPIA 1TURA 5FUVA 1SGYI 2QQ0A 2SGEI 1OVOA 1NXUA 1PPFI 2SGQI 1K7TA 1UUCA 2OD1A 2QQCA 2F3CI 3SGQI 3RU0A 1IW4A 3TO9A 3QWPA 2KCXA 2ELIA 2ROWA 2XRCA 3VDUA 1MJAA 5CCLA 4A24A 2ERWA 2M5XA 1SGPI 4JCVE 4HGUA 2DIPA 1ULMA 4GI3C 2B0UC 2P6AC 1UVGA 1AN1I 2N52A 5HI7A 2LEOA 1K7VA 1UZQA
chains in the Genus database with same CATH topology
1TBOA 1RFHA 1TIHA 2L7XA 5FUXA 3UGIA 2B8TA 1X74A 1YU6C 2JA1A 1TBRR 4UXHA 1TBQR 5CCMA 1HPTA 2CJSC 2V1CC 1CT0I 1M8BA 3UGLA 1SGNI 3VE5A 3OVOA 2SGDI 1W3SA 1R0RI 2WCYA 2QQEA 2W86A 3UFFA 2QQDA 2E5RA 3SGBI 1UZJA 1CGJI 2GKVA 5EX3A 3UEYA 5HQ8A 2J9RA 4FKDA 1SGQI 1APJA 1SGDI 3B4VC 3HH2C 1SGRI 2ENNA 2OVOA 1BMOA 2GKRI 1LR8A 1FARA 1KMAA 5EX0A 1KBEA 1V1HA 2JW6A 1H0ZA 2BUSA 2A20A 3E2IA 1PJUA 1TGSI 3MEKA 1MT1A 2NU2I 1Z7KB 1XA6A 2JZMA 2KMPA 3D00A 3QTLD 1CHOI 3FC3A 1PCEA 2QPOA 5FUWA 1SGEI 2KMRA 2UZ3A 2SGPI 2DB6A 2V53A 3KY9A 2LUYA 2N71A 1BUSA 1R79A 1FAQA 2J87A 2ORWA 1TUSA 2KMOA 2KMQA 2YQPA 3TJQA 1DS3I 1PTRA 1HDLA 5JHWC 3BJIA 1YTPA 2JXDA 2V1CA 1V1IA 2E73A 1LR9A 1M8CA 2GKTI 4UXIA 1XX6A 1FYBA 1PTQA 1CT2I 5FUYA 3UGDA 1TOTA 3VDPA 3GOXA 1CT4I 3OXFA 5DAEA 2NU0I 1X4SA 2NU1I 1UZKA 1UZPA 4L9MA 3UEJA 2N1AB 1XBTA 1TBNA 4OVOA 1Y1CA 1CGII 1NUBA 2FNFX 1DS2I 1W4RA 2SGFI 1CE3A 1LR7A 4B6DA 4SGBI 2ORVA 1U5KA 2YUUA 4E1RA 1IY5A 1IY6A 2WVJA 1UVFA 1Y8FA 2L8EA 2ODDA 1VDDA 1KBFA 1OMTA 1HJAI 3OXLA 3PDNA 4UXJA 1OMUA 1N13A 1OYVI 3SEKC 1CSOI 2NU4I 2VRWB 2W0TA 4E1PA 2ENZA 3CXLA 1Y1BA 2K9HA 2N17A 3OL0A 3E59A 1KSQA 2JYYA 2ARPF 2NU3I 2GVIA 3OXGA 1TURA 5FUVA 1SGYI 2QQ0A 2SGEI 1OVOA 1PPFI 2SGQI 1UUCA 2OD1A 2QQCA 2F3CI 3SGQI 3RU0A 1IW4A 3QWPA 2KCXA 2ELIA 2ROWA 2XRCA 3VDUA 5CCLA 4A24A 2ERWA 2M5XA 1SGPI 4JCVE 4HGUA 2DIPA 4GI3C 2B0UC 2P6AC 1UVGA 1AN1I 2N52A 5HI7A 2LEOA 1UZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIH A;  1YU6 C;  1TBR R;  1TBQ R;  1HPT A;  1CT0 I;  1M8B A;  1SGN I;  3OVO A;  2SGD I;  2WCY A;  1R0R I;  2W86 A;  2QQD A;  3SGB I;  1UZJ A;  1CGJ I;  2GKV A;  1SGQ I;  1APJ A;  1SGD I;  3B4V C;  3HH2 C;  1SGR I;  2OVO A;  1BMO A;  2GKR I;  1LR8 A;  1KMA A;  1H0Z A;  2BUS A;  1PJU A;  1TGS I;  1MT1 A;  2NU2 I;  1Z7K B;  2JZM A;  2KMP A;  3QTL D;  1CHO I;  1PCE A;  1SGE I;  2KMR A;  2SGP I;  2V53 A;  2N71 A;  1BUS A;  1TUS A;  2KMO A;  2KMQ A;  3TJQ A;  1DS3 I;  1HDL A;  5JHW C;  1YTP A;  2JXD A;  1LR9 A;  1M8C A;  2GKT I;  1FYB A;  1CT2 I;  1CT4 I;  5DAE A;  2NU0 I;  1UZP A;  2NU1 I;  1UZK A;  4OVO A;  1Y1C A;  1CGI I;  1NUB A;  1DS2 I;  2SGF I;  1CE3 A;  1LR7 A;  4SGB I;  1IY5 A;  1IY6 A;  1UVF A;  1OMT A;  1HJA I;  1OMU A;  1N13 A;  1OYV I;  3SEK C;  1CSO I;  2NU4 I;  1Y1B A;  2N17 A;  1KSQ A;  2JYY A;  2ARP F;  2NU3 I;  1TUR A;  1SGY I;  2SGE I;  1OVO A;  1PPF I;  2SGQ I;  1UUC A;  2QQC A;  2F3C I;  3SGQ I;  1IW4 A;  2KCX A;  2XRC A;  2ERW A;  2M5X A;  1SGP I;  4HGU A;  4GI3 C;  2B0U C;  2P6A C;  1UVG A;  1AN1 I;  2N52 A;  2LEO A;  1UZQ A; 
#chains in the Genus database with same CATH topology
 1TBO A;  1RFH A;  1TIH A;  2L7X A;  3R5A A;  5FUX A;  2B8T A;  3UGI A;  1X74 A;  1YU6 C;  2JA1 A;  1TBR R;  3TOA A;  4UXH A;  1TBQ R;  1UZJ A;  5CCM A;  1HPT A;  2CJS C;  2V1C C;  1CT0 I;  1M8B A;  3UGL A;  2PQ8 A;  2CWH A;  1SGN I;  3VE5 A;  3OVO A;  2SGD I;  1W3S A;  1R0R I;  2WCY A;  2QQE A;  2W86 A;  3UFF A;  2QQD A;  2E5R A;  3R5C A;  3SGB I;  1CGJ I;  2GKV A;  2UVO A;  5EX3 A;  3UEY A;  2J9R A;  4FKD A;  5HQ8 A;  1SGQ I;  1MJB A;  1P9Z A;  3R5B A;  1APJ A;  1SGD I;  3B4V C;  3HH2 C;  1SGR I;  2ENN A;  2OVO A;  1BMO A;  2GKR I;  1LR8 A;  1FAR A;  1WGC A;  1KMA A;  5EX0 A;  1KBE A;  1V1H A;  2JW6 A;  1H0Z A;  1S20 A;  2BUS A;  2A20 A;  2LB7 A;  3E2I A;  1PJU A;  1ULN A;  1TGS I;  3MEK A;  1MT1 A;  2NU2 I;  1Z7K B;  1XA6 A;  2JZM A;  1UHA A;  2KMP A;  3D00 A;  3QTL D;  1CHO I;  3FC3 A;  1PCE A;  2QPO A;  5FUW A;  1SGE I;  1K7U A;  2KMR A;  2UZ3 A;  2SGP I;  2DB6 A;  2V53 A;  2WGC A;  3KY9 A;  5E3P A;  3TOB A;  2DKV A;  5E3Q A;  2LUY A;  2N71 A;  1BUS A;  1R79 A;  1FAQ A;  2J87 A;  2ORW A;  1WKX A;  1TUS A;  2KMO A;  2KMQ A;  3UOE A;  2YQP A;  2CWF A;  1DS3 I;  3TJQ A;  1PTR A;  1HDL A;  5J8C A;  5JHW C;  2RC4 A;  1ULK A;  1YTP A;  2JXD A;  3BJI A;  2V1C A;  1V1I A;  2E73 A;  1LR9 A;  1M8C A;  2GKT I;  4UXI A;  1XX6 A;  2Y0M A;  1PTQ A;  1FYB A;  2X52 A;  1CT2 I;  1WGT A;  2RIJ A;  5FUY A;  1TOT A;  3UGD A;  1MJ9 A;  2GIV A;  3VDP A;  3QAH A;  3GOX A;  1CT4 I;  3OXF A;  5DAE A;  4DNC A;  2NU0 I;  1X4S A;  2NU1 I;  1UZK A;  1UZP A;  4L9M A;  3UEJ A;  2N1A B;  1XBT A;  1TBN A;  4OVO A;  2X3T A;  1Y1C A;  1CGI I;  1FY7 A;  1NUB A;  3TO6 A;  2FNF X;  1DS2 I;  1W4R A;  2SGF I;  1Z2I A;  5E3R A;  1CE3 A;  3FSY A;  1LR7 A;  4B6D A;  4SGB I;  1WTJ A;  2ORV A;  2OU2 A;  3TO7 A;  9WGA A;  1HEV A;  1U5K A;  2YUU A;  4E1R A;  1IY5 A;  1IY6 A;  2OZU A;  2WVJ A;  1UVF A;  1Y8F A;  2CWG A;  4WP4 A;  2L8E A;  2ODD A;  7WGA A;  1VDD A;  1KBF A;  3R5D A;  1OMT A;  1HJA I;  3OXL A;  1Q9B A;  3PDN A;  1OMU A;  4UXJ A;  3FSX A;  1N13 A;  1OYV I;  3SEK C;  1CSO I;  2NU4 I;  2VRW B;  2W0T A;  4E1P A;  2ENZ A;  3CXL A;  1Y1B A;  2K9H A;  2N17 A;  3OL0 A;  3E59 A;  1KSQ A;  1P9G A;  2JYY A;  4AML A;  2ARP F;  2NU3 I;  5J8F A;  2GVI A;  3OXG A;  4MPI A;  1TUR A;  5FUV A;  1SGY I;  2QQ0 A;  2SGE I;  1OVO A;  1NXU A;  1PPF I;  2SGQ I;  1K7T A;  1UUC A;  2OD1 A;  2QQC A;  2F3C I;  3SGQ I;  3RU0 A;  1IW4 A;  3TO9 A;  3QWP A;  2KCX A;  2ELI A;  2ROW A;  2XRC A;  3VDU A;  1MJA A;  5CCL A;  4A24 A;  2ERW A;  2M5X A;  1SGP I;  4JCV E;  4HGU A;  2DIP A;  1ULM A;  4GI3 C;  2B0U C;  2P6A C;  1UVG A;  1AN1 I;  2N52 A;  5HI7 A;  2LEO A;  1K7V A;  1UZQ A; 
#chains in the Genus database with same CATH homology
 1TBO A;  1RFH A;  1TIH A;  2L7X A;  5FUX A;  3UGI A;  2B8T A;  1X74 A;  1YU6 C;  2JA1 A;  1TBR R;  4UXH A;  1TBQ R;  5CCM A;  1HPT A;  2CJS C;  2V1C C;  1CT0 I;  1M8B A;  3UGL A;  1SGN I;  3VE5 A;  3OVO A;  2SGD I;  1W3S A;  1R0R I;  2WCY A;  2QQE A;  2W86 A;  3UFF A;  2QQD A;  2E5R A;  3SGB I;  1UZJ A;  1CGJ I;  2GKV A;  5EX3 A;  3UEY A;  5HQ8 A;  2J9R A;  4FKD A;  1SGQ I;  1APJ A;  1SGD I;  3B4V C;  3HH2 C;  1SGR I;  2ENN A;  2OVO A;  1BMO A;  2GKR I;  1LR8 A;  1FAR A;  1KMA A;  5EX0 A;  1KBE A;  1V1H A;  2JW6 A;  1H0Z A;  2BUS A;  2A20 A;  3E2I A;  1PJU A;  1TGS I;  3MEK A;  1MT1 A;  2NU2 I;  1Z7K B;  1XA6 A;  2JZM A;  2KMP A;  3D00 A;  3QTL D;  1CHO I;  3FC3 A;  1PCE A;  2QPO A;  5FUW A;  1SGE I;  2KMR A;  2UZ3 A;  2SGP I;  2DB6 A;  2V53 A;  3KY9 A;  2LUY A;  2N71 A;  1BUS A;  1R79 A;  1FAQ A;  2J87 A;  2ORW A;  1TUS A;  2KMO A;  2KMQ A;  2YQP A;  3TJQ A;  1DS3 I;  1PTR A;  1HDL A;  5JHW C;  3BJI A;  1YTP A;  2JXD A;  2V1C A;  1V1I A;  2E73 A;  1LR9 A;  1M8C A;  2GKT I;  4UXI A;  1XX6 A;  1FYB A;  1PTQ A;  1CT2 I;  5FUY A;  3UGD A;  1TOT A;  3VDP A;  3GOX A;  1CT4 I;  3OXF A;  5DAE A;  2NU0 I;  1X4S A;  2NU1 I;  1UZK A;  1UZP A;  4L9M A;  3UEJ A;  2N1A B;  1XBT A;  1TBN A;  4OVO A;  1Y1C A;  1CGI I;  1NUB A;  2FNF X;  1DS2 I;  1W4R A;  2SGF I;  1CE3 A;  1LR7 A;  4B6D A;  4SGB I;  2ORV A;  1U5K A;  2YUU A;  4E1R A;  1IY5 A;  1IY6 A;  2WVJ A;  1UVF A;  1Y8F A;  2L8E A;  2ODD A;  1VDD A;  1KBF A;  1OMT A;  1HJA I;  3OXL A;  3PDN A;  4UXJ A;  1OMU A;  1N13 A;  1OYV I;  3SEK C;  1CSO I;  2NU4 I;  2VRW B;  2W0T A;  4E1P A;  2ENZ A;  3CXL A;  1Y1B A;  2K9H A;  2N17 A;  3OL0 A;  3E59 A;  1KSQ A;  2JYY A;  2ARP F;  2NU3 I;  2GVI A;  3OXG A;  1TUR A;  5FUV A;  1SGY I;  2QQ0 A;  2SGE I;  1OVO A;  1PPF I;  2SGQ I;  1UUC A;  2OD1 A;  2QQC A;  2F3C I;  3SGQ I;  3RU0 A;  1IW4 A;  3QWP A;  2KCX A;  2ELI A;  2ROW A;  2XRC A;  3VDU A;  5CCL A;  4A24 A;  2ERW A;  2M5X A;  1SGP I;  4JCV E;  4HGU A;  2DIP A;  4GI3 C;  2B0U C;  2P6A C;  1UVG A;  1AN1 I;  2N52 A;  5HI7 A;  2LEO A;  1UZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...