3TJQA

N-domain of htra1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
106
Chain Sequence
GCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease HTRA1
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 23
structure length 106
sequence length 119
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00219 IGFBP Insulin-like growth factor binding protein
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3tjqA00
1AN1I 2NU1I 1R0RI 2KMOA 3SGBI 2N17A 2JXDA 2P6AC 2SGDI 1N13A 1CT0I 1HPTA 2V53A 1CGJI 1CHOI 1LR7A 1TIHA 2QQDA 1CSOI 1CT4I 1LR9A 1Y1BA 2N52A 1DS2I 1CE3A 2WCYA 4HGUA 1BUSA 5DAEA 1LR8A 1SGRI 1TURA 1UUCA 1UVFA 2ERWA 1SGQI 1HJAI 1IW4A 1Z7KB 3QTLD 3TJQA 2M5XA 1OMTA 1MT1A 2LEOA 2F3CI 3SEKC 1DS3I 4GI3C 2JYYA 2NU0I 2SGQI 1HDLA 2JZMA 1SGNI 2OVOA 3B4VC 1M8BA 1IY5A 2NU2I 1YTPA 1PCEA 4SGBI 1SGPI 3SGQI 3HH2C 1PPFI 2KMRA 1FYBA 1H0ZA 1UVGA 3OVOA 1BMOA 2NU3I 1SGYI 1CT2I 2GKVA 1TBQR 2NU4I 2XRCA 1NUBA 2GKTI 1OYVI 1Y1CA 1OVOA 2KMQA 1TBRR 2SGEI 2KCXA 2SGPI 1YU6C 1TUSA 2KMPA 1KMAA 2GKRI 5JHWC 1CGII 4OVOA 1M8CA 1PJUA 2SGFI 1IY6A 2B0UC 1SGDI 2QQCA 2N71A 2BUSA 1TGSI 1SGEI 2ARPF 1OMUA
chains in the Genus database with same CATH superfamily
1AN1I 1UHAA 2NU1I 1KBEA 1R0RI 2KMOA 5CCLA 3SGBI 2N17A 1XBTA 2JXDA 2P6AC 2SGDI 5E3RA 1N13A 1CT0I 1ULKA 1HPTA 2N1AB 3UEJA 7WGAA 1XA6A 1WGCA 2V53A 1KBFA 1TBNA 1CGJI 1WTJA 2OZUA 5J8CA 5CCMA 1CHOI 2QQEA 1V1IA 1CE3A 1LR7A 1TIHA 1Y8FA 2QQDA 1MJAA 1CSOI 1V1HA 1CT4I 1U5KA 1LR9A 1Y1BA 3R5CA 5E3PA 1HEVA 1K7VA 1FARA 1DS2I 2N52A 2WCYA 2ODDA 3BJIA 3KY9A 4HGUA 5FUYA 4E1PA 1BUSA 5DAEA 1LR8A 2FNFX 2RC4A 1SGRI 1TURA 1UUCA 1UVFA 2ERWA 1SGQI 5E3QA 1HJAI 2WVJA 1IW4A 1Z7KB 1WKXA 2YQPA 3QTLD 3TJQA 1Z2IA 2CWGA 4E1RA 2A20A 1K7TA 3D00A 2M5XA 1TBOA 1OMTA 3UOEA 3TO7A 1PTQA 1FAQA 1MT1A 2B8TA 2LEOA 3R5AA 4A24A 3E59A 2F3CI 2DIPA 2X52A 3SEKC 1DS3I 2YUUA 5HQ8A 2E73A 4B6DA 3PDNA 2CJSC 4UXIA 4GI3C 2OD1A 2JYYA 2NU0I 3QWPA 2SGQI 3UGIA 3FSXA 1HDLA 2PQ8A 2W0TA 1W4RA 4L9MA 4UXJA 2JZMA 2ORVA 1SGNI 3UEYA 1MJBA 2DB6A 2VRWB 5HI7A 5EX0A 2OVOA 2JW6A 3B4VC 3QAHA 1M8BA 1ULMA 1IY5A 2E5RA 9WGAA 2JA1A 2NU2I 1X74A 2ORWA 1YTPA 3MEKA 1WGTA 3OXFA 2ROWA 3R5BA 1MJ9A 4FKDA 1PCEA 2ELIA 2GVIA 4JCVE 4SGBI 3TOBA 2L8EA 3VDUA 1R79A 1SGPI 2L7XA 2X3TA 2J87A 3SGQI 3RU0A 3HH2C 5J8FA 3TO6A 2V1CA 3TO9A 1ULNA 1PPFI 2KMRA 3VDPA 1FYBA 5FUWA 1FY7A 2QPOA 1S20A 1UVGA 1H0ZA 5EX3A 3OVOA 2CWFA 3OXLA 4AMLA 1PTRA 4DNCA 1BMOA 2NU3I 1P9ZA 3UGLA 3GOXA 1SGYI 2OU2A 1TOTA 1CT2I 2GKVA 1TBQR 2NU4I 2XRCA 2Y0MA 1NUBA 3OL0A 4UXHA 5FUXA 1OYVI 2GKTI 3UGDA 1Y1CA 2LUYA 1NXUA 1OVOA 2RIJA 2CWHA 2KMQA 1TBRR 2SGEI 2KCXA 2SGPI 1YU6C 3FC3A 1TUSA 2KMPA 3R5DA 2GKRI 4MPIA 4WP4A 5JHWC 1KMAA 1CGII 4OVOA 1M8CA 3E2IA 1PJUA 1Q9BA 2WGCA 2SGFI 3VE5A 1IY6A 1X4SA 1K7UA 1RFHA 2B0UC 2V1CC 1SGDI 2QQ0A 3TOAA 2UZ3A 1VDDA 2K9HA 2QQCA 2ENNA 2BUSA 1TGSI 1SGEI 2N71A 3OXGA 1W3SA 2ARPF 2J9RA 2GIVA 2DKVA 3FSYA 3UFFA 1P9GA 5FUVA 2ENZA 3CXLA 1OMUA 1XX6A 2UVOA 2LB7A
chains in the Genus database with same CATH topology
1AN1I 2NU1I 1KBEA 1R0RI 2KMOA 5CCLA 3SGBI 2N17A 1XBTA 2JXDA 2P6AC 2SGDI 1N13A 1CT0I 1HPTA 2N1AB 3UEJA 1XA6A 1KBFA 2V53A 1TBNA 1CGJI 5CCMA 1CHOI 2QQEA 1V1IA 1CE3A 1LR7A 1TIHA 1Y8FA 2QQDA 4FKDA 1CSOI 1V1HA 1CT4I 1U5KA 1LR9A 1Y1BA 1FARA 1DS2I 2N52A 2WCYA 2ODDA 3BJIA 3KY9A 4HGUA 5FUYA 4E1PA 1BUSA 5DAEA 1LR8A 2FNFX 1SGRI 1TURA 1UUCA 1UVFA 2ERWA 1SGQI 1HJAI 2WVJA 1IW4A 1Z7KB 2YQPA 3QTLD 3TJQA 4E1RA 2A20A 3D00A 2M5XA 1TBOA 1OMTA 1FAQA 1PTQA 1MT1A 2B8TA 2LEOA 4A24A 3E59A 2F3CI 2DIPA 3SEKC 1DS3I 2YUUA 5HQ8A 2E73A 4B6DA 3PDNA 2CJSC 4UXIA 4GI3C 2OD1A 2JYYA 2NU0I 3QWPA 2SGQI 3UGIA 1HDLA 2W0TA 4L9MA 1W4RA 4UXJA 2JZMA 2ORVA 1SGNI 3UEYA 2VRWB 2DB6A 5HI7A 5EX0A 2OVOA 2JW6A 3B4VC 1M8BA 1IY5A 2E5RA 2JA1A 2NU2I 1X74A 2ORWA 1YTPA 3MEKA 3OXFA 2ROWA 1PCEA 2ELIA 2GVIA 4JCVE 4SGBI 2L8EA 3VDUA 1R79A 1SGPI 2L7XA 2J87A 3SGQI 3RU0A 3HH2C 2V1CA 1PPFI 2KMRA 3VDPA 1FYBA 5FUWA 2QPOA 1H0ZA 1UVGA 5EX3A 3OVOA 3OXLA 1PTRA 1BMOA 2NU3I 3UGLA 3GOXA 1SGYI 1TOTA 1CT2I 2GKVA 1TBQR 2NU4I 2XRCA 3OL0A 1NUBA 4UXHA 5FUXA 3UGDA 1OYVI 2GKTI 1Y1CA 2LUYA 1OVOA 2KMQA 1TBRR 2SGEI 2KCXA 2SGPI 1YU6C 3FC3A 1TUSA 2KMPA 1KMAA 2GKRI 5JHWC 1CGII 4OVOA 1M8CA 3E2IA 1PJUA 3VE5A 2SGFI 1IY6A 1X4SA 2B0UC 1RFHA 2V1CC 1SGDI 2QQ0A 2UZ3A 1VDDA 2K9HA 2QQCA 2ENNA 2BUSA 1TGSI 1SGEI 2N71A 3OXGA 1W3SA 2ARPF 2J9RA 3UFFA 5FUVA 2ENZA 3CXLA 1OMUA 1XX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AN1 I;  2NU1 I;  1R0R I;  2KMO A;  3SGB I;  2N17 A;  2JXD A;  2P6A C;  2SGD I;  1N13 A;  1CT0 I;  1HPT A;  2V53 A;  1CGJ I;  1CHO I;  1LR7 A;  1TIH A;  2QQD A;  1CSO I;  1CT4 I;  1LR9 A;  1Y1B A;  2N52 A;  1DS2 I;  1CE3 A;  2WCY A;  4HGU A;  1BUS A;  5DAE A;  1LR8 A;  1SGR I;  1TUR A;  1UUC A;  1UVF A;  2ERW A;  1SGQ I;  1HJA I;  1IW4 A;  1Z7K B;  3QTL D;  3TJQ A;  2M5X A;  1OMT A;  1MT1 A;  2LEO A;  2F3C I;  3SEK C;  1DS3 I;  4GI3 C;  2JYY A;  2NU0 I;  2SGQ I;  1HDL A;  2JZM A;  1SGN I;  2OVO A;  3B4V C;  1M8B A;  1IY5 A;  2NU2 I;  1YTP A;  1PCE A;  4SGB I;  1SGP I;  3SGQ I;  3HH2 C;  1PPF I;  2KMR A;  1FYB A;  1H0Z A;  1UVG A;  3OVO A;  1BMO A;  2NU3 I;  1SGY I;  1CT2 I;  2GKV A;  1TBQ R;  2NU4 I;  2XRC A;  1NUB A;  2GKT I;  1OYV I;  1Y1C A;  1OVO A;  2KMQ A;  1TBR R;  2SGE I;  2KCX A;  2SGP I;  1YU6 C;  1TUS A;  2KMP A;  1KMA A;  2GKR I;  5JHW C;  1CGI I;  4OVO A;  1M8C A;  1PJU A;  2SGF I;  1IY6 A;  2B0U C;  1SGD I;  2QQC A;  2N71 A;  2BUS A;  1TGS I;  1SGE I;  2ARP F;  1OMU A; 
#chains in the Genus database with same CATH topology
 1AN1 I;  1UHA A;  2NU1 I;  1KBE A;  1R0R I;  2KMO A;  5CCL A;  3SGB I;  2N17 A;  1XBT A;  2JXD A;  2P6A C;  2SGD I;  5E3R A;  1N13 A;  1CT0 I;  1ULK A;  1HPT A;  2N1A B;  3UEJ A;  7WGA A;  1XA6 A;  1WGC A;  2V53 A;  1KBF A;  1TBN A;  1CGJ I;  1WTJ A;  2OZU A;  5J8C A;  5CCM A;  1CHO I;  2QQE A;  1V1I A;  1CE3 A;  1LR7 A;  1TIH A;  1Y8F A;  2QQD A;  1MJA A;  1CSO I;  1V1H A;  1CT4 I;  1U5K A;  1LR9 A;  1Y1B A;  3R5C A;  5E3P A;  1HEV A;  1K7V A;  1FAR A;  1DS2 I;  2N52 A;  2WCY A;  2ODD A;  3BJI A;  3KY9 A;  4HGU A;  5FUY A;  4E1P A;  1BUS A;  5DAE A;  1LR8 A;  2FNF X;  2RC4 A;  1SGR I;  1TUR A;  1UUC A;  1UVF A;  2ERW A;  1SGQ I;  5E3Q A;  1HJA I;  2WVJ A;  1IW4 A;  1Z7K B;  1WKX A;  2YQP A;  3QTL D;  3TJQ A;  1Z2I A;  2CWG A;  4E1R A;  2A20 A;  1K7T A;  3D00 A;  2M5X A;  1TBO A;  1OMT A;  3UOE A;  3TO7 A;  1PTQ A;  1FAQ A;  1MT1 A;  2B8T A;  2LEO A;  3R5A A;  4A24 A;  3E59 A;  2F3C I;  2DIP A;  2X52 A;  3SEK C;  1DS3 I;  2YUU A;  5HQ8 A;  2E73 A;  4B6D A;  3PDN A;  2CJS C;  4UXI A;  4GI3 C;  2OD1 A;  2JYY A;  2NU0 I;  3QWP A;  2SGQ I;  3UGI A;  3FSX A;  1HDL A;  2PQ8 A;  2W0T A;  1W4R A;  4L9M A;  4UXJ A;  2JZM A;  2ORV A;  1SGN I;  3UEY A;  1MJB A;  2DB6 A;  2VRW B;  5HI7 A;  5EX0 A;  2OVO A;  2JW6 A;  3B4V C;  3QAH A;  1M8B A;  1ULM A;  1IY5 A;  2E5R A;  9WGA A;  2JA1 A;  2NU2 I;  1X74 A;  2ORW A;  1YTP A;  3MEK A;  1WGT A;  3OXF A;  2ROW A;  3R5B A;  1MJ9 A;  4FKD A;  1PCE A;  2ELI A;  2GVI A;  4JCV E;  4SGB I;  3TOB A;  2L8E A;  3VDU A;  1R79 A;  1SGP I;  2L7X A;  2X3T A;  2J87 A;  3SGQ I;  3RU0 A;  3HH2 C;  5J8F A;  3TO6 A;  2V1C A;  3TO9 A;  1ULN A;  1PPF I;  2KMR A;  3VDP A;  1FYB A;  5FUW A;  1FY7 A;  2QPO A;  1S20 A;  1UVG A;  1H0Z A;  5EX3 A;  3OVO A;  2CWF A;  3OXL A;  4AML A;  1PTR A;  4DNC A;  1BMO A;  2NU3 I;  1P9Z A;  3UGL A;  3GOX A;  1SGY I;  2OU2 A;  1TOT A;  1CT2 I;  2GKV A;  1TBQ R;  2NU4 I;  2XRC A;  2Y0M A;  1NUB A;  3OL0 A;  4UXH A;  5FUX A;  1OYV I;  2GKT I;  3UGD A;  1Y1C A;  2LUY A;  1NXU A;  1OVO A;  2RIJ A;  2CWH A;  2KMQ A;  1TBR R;  2SGE I;  2KCX A;  2SGP I;  1YU6 C;  3FC3 A;  1TUS A;  2KMP A;  3R5D A;  2GKR I;  4MPI A;  4WP4 A;  5JHW C;  1KMA A;  1CGI I;  4OVO A;  1M8C A;  3E2I A;  1PJU A;  1Q9B A;  2WGC A;  2SGF I;  3VE5 A;  1IY6 A;  1X4S A;  1K7U A;  1RFH A;  2B0U C;  2V1C C;  1SGD I;  2QQ0 A;  3TOA A;  2UZ3 A;  1VDD A;  2K9H A;  2QQC A;  2ENN A;  2BUS A;  1TGS I;  1SGE I;  2N71 A;  3OXG A;  1W3S A;  2ARP F;  2J9R A;  2GIV A;  2DKV A;  3FSY A;  3UFF A;  1P9G A;  5FUV A;  2ENZ A;  3CXL A;  1OMU A;  1XX6 A;  2UVO A;  2LB7 A; 
#chains in the Genus database with same CATH homology
 1AN1 I;  2NU1 I;  1KBE A;  1R0R I;  2KMO A;  5CCL A;  3SGB I;  2N17 A;  1XBT A;  2JXD A;  2P6A C;  2SGD I;  1N13 A;  1CT0 I;  1HPT A;  2N1A B;  3UEJ A;  1XA6 A;  1KBF A;  2V53 A;  1TBN A;  1CGJ I;  5CCM A;  1CHO I;  2QQE A;  1V1I A;  1CE3 A;  1LR7 A;  1TIH A;  1Y8F A;  2QQD A;  4FKD A;  1CSO I;  1V1H A;  1CT4 I;  1U5K A;  1LR9 A;  1Y1B A;  1FAR A;  1DS2 I;  2N52 A;  2WCY A;  2ODD A;  3BJI A;  3KY9 A;  4HGU A;  5FUY A;  4E1P A;  1BUS A;  5DAE A;  1LR8 A;  2FNF X;  1SGR I;  1TUR A;  1UUC A;  1UVF A;  2ERW A;  1SGQ I;  1HJA I;  2WVJ A;  1IW4 A;  1Z7K B;  2YQP A;  3QTL D;  3TJQ A;  4E1R A;  2A20 A;  3D00 A;  2M5X A;  1TBO A;  1OMT A;  1FAQ A;  1PTQ A;  1MT1 A;  2B8T A;  2LEO A;  4A24 A;  3E59 A;  2F3C I;  2DIP A;  3SEK C;  1DS3 I;  2YUU A;  5HQ8 A;  2E73 A;  4B6D A;  3PDN A;  2CJS C;  4UXI A;  4GI3 C;  2OD1 A;  2JYY A;  2NU0 I;  3QWP A;  2SGQ I;  3UGI A;  1HDL A;  2W0T A;  4L9M A;  1W4R A;  4UXJ A;  2JZM A;  2ORV A;  1SGN I;  3UEY A;  2VRW B;  2DB6 A;  5HI7 A;  5EX0 A;  2OVO A;  2JW6 A;  3B4V C;  1M8B A;  1IY5 A;  2E5R A;  2JA1 A;  2NU2 I;  1X74 A;  2ORW A;  1YTP A;  3MEK A;  3OXF A;  2ROW A;  1PCE A;  2ELI A;  2GVI A;  4JCV E;  4SGB I;  2L8E A;  3VDU A;  1R79 A;  1SGP I;  2L7X A;  2J87 A;  3SGQ I;  3RU0 A;  3HH2 C;  2V1C A;  1PPF I;  2KMR A;  3VDP A;  1FYB A;  5FUW A;  2QPO A;  1H0Z A;  1UVG A;  5EX3 A;  3OVO A;  3OXL A;  1PTR A;  1BMO A;  2NU3 I;  3UGL A;  3GOX A;  1SGY I;  1TOT A;  1CT2 I;  2GKV A;  1TBQ R;  2NU4 I;  2XRC A;  3OL0 A;  1NUB A;  4UXH A;  5FUX A;  3UGD A;  1OYV I;  2GKT I;  1Y1C A;  2LUY A;  1OVO A;  2KMQ A;  1TBR R;  2SGE I;  2KCX A;  2SGP I;  1YU6 C;  3FC3 A;  1TUS A;  2KMP A;  1KMA A;  2GKR I;  5JHW C;  1CGI I;  4OVO A;  1M8C A;  3E2I A;  1PJU A;  3VE5 A;  2SGF I;  1IY6 A;  1X4S A;  2B0U C;  1RFH A;  2V1C C;  1SGD I;  2QQ0 A;  2UZ3 A;  1VDD A;  2K9H A;  2QQC A;  2ENN A;  2BUS A;  1TGS I;  1SGE I;  2N71 A;  3OXG A;  1W3S A;  2ARP F;  2J9R A;  3UFF A;  5FUV A;  2ENZ A;  3CXL A;  1OMU A;  1XX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...