3TJQA

N-domain of htra1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
106
Chain Sequence
GCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 106
sequence length 119
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00219 IGFBP Insulin-like growth factor binding protein
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3tjqA00
1PJUA 2JXDA 2B0UC 2P6AC 1TBRR 1PCEA 1SGNI 1TGSI 1OMUA 5JHWC 1PPFI 2KMRA 1NUBA 2LEOA 2ERWA 1TURA 4HGUA 1TIHA 2BUSA 1SGEI 1CT2I 3SGBI 1CT4I 3SEKC 2GKTI 1HJAI 2SGPI 2N71A 2XRCA 3TJQA 2NU2I 1CGII 1CSOI 2SGFI 2QQCA 2WCYA 1IW4A 1N13A 1HPTA 1H0ZA 1MT1A 1TBQR 2KMQA 1CT0I 3SGQI 2JZMA 1DS3I 2N52A 1SGYI 1LR7A 1SGDI 2NU4I 2QQDA 1CHOI 1Z7KB 3QTLD 3OVOA 3B4VC 2N17A 2JYYA 1HDLA 2V53A 1LR8A 4OVOA 1Y1CA 2SGEI 4GI3C 1M8CA 2GKVA 1FYBA 1CE3A 4SGBI 1CGJI 2KMOA 1UUCA 2KCXA 1UVFA 1M8BA 1OVOA 2M5XA 1BUSA 1OMTA 1SGQI 1LR9A 2NU3I 1R0RI 2GKRI 1IY6A 1KMAA 1AN1I 5DAEA 1TUSA 1YTPA 1Y1BA 1UVGA 2OVOA 1SGPI 2NU1I 2NU0I 2F3CI 1YU6C 1OYVI 2KMPA 2ARPF 2SGQI 1IY5A 2SGDI 1DS2I 3HH2C 1BMOA 1SGRI
chains in the Genus database with same CATH superfamily
1PJUA 1V1HA 4MPIA 2JXDA 2B0UC 2FNFX 2P6AC 5FUVA 5J8CA 2DB6A 1PTRA 3UGIA 1UHAA 2QPOA 5E3PA 3D00A 1TBRR 3TO7A 2N1AB 2V1CC 1PCEA 2UVOA 2ELIA 1SGNI 3UGDA 3UEJA 2E5RA 2LUYA 2X3TA 5CCLA 2OZUA 3FC3A 1NXUA 1K7TA 2CWGA 2DKVA 1TGSI 3FSYA 3QAHA 1ULNA 1OMUA 5JHWC 1PPFI 2KMRA 2L7XA 1NUBA 2LEOA 1Z2IA 2ERWA 1P9ZA 1TURA 1TIHA 1VDDA 2BUSA 4HGUA 1SGEI 1TBOA 1CT2I 2RC4A 3E59A 5FUXA 5HI7A 3SGBI 1CT4I 3SEKC 2GKTI 2WGCA 1R79A 3PDNA 1HJAI 2ENNA 2B8TA 2N71A 1MJAA 2SGPI 1RFHA 2OU2A 2XRCA 3TJQA 1TOTA 2NU2I 2UZ3A 2RIJA 1CGII 1W3SA 3RU0A 1CSOI 5EX3A 3MEKA 2JW6A 1FARA 3UOEA 2E73A 2QQCA 2SGFI 5E3QA 2WCYA 2CWHA 1N13A 1IW4A 2JA1A 2Y0MA 1HPTA 1H0ZA 2OD1A 3VE5A 3BJIA 3R5BA 5FUWA 2W0TA 1TBNA 3OXFA 1MT1A 1K7VA 2CWFA 2ODDA 2QQEA 1TBQR 3TOBA 5E3RA 2KMQA 2VRWB 3E2IA 3OXGA 3CXLA 1XX6A 1FAQA 1CT0I 3SGQI 4B6DA 4DNCA 1XA6A 2JZMA 4L9MA 1DS3I 1XBTA 2N52A 2YQPA 5EX0A 4UXJA 1SGYI 1WTJA 5J8FA 1LR7A 2ORVA 1KBFA 1X4SA 2J9RA 1SGDI 3OL0A 3R5CA 1K7UA 2NU4I 4UXIA 2QQDA 3VDUA 1CHOI 2CJSC 1Z7KB 3QTLD 3OVOA 4UXHA 3TO6A 3B4VC 4E1PA 2N17A 2JYYA 1HDLA 2V53A 1LR8A 4OVOA 2GVIA 1ULKA 1Y1CA 2SGEI 4GI3C 1M8CA 3FSXA 2GKVA 4AMLA 1WKXA 1CE3A 2YUUA 1FYBA 2DIPA 1CGJI 2KMOA 1UUCA 3QWPA 3KY9A 3R5DA 4SGBI 3UEYA 1MJBA 1MJ9A 9WGAA 2KCXA 3UGLA 1UVFA 1M8BA 1OVOA 2M5XA 2PQ8A 1BUSA 1OMTA 1X74A 1SGQI 1LR9A 1R0RI 2NU3I 2QQ0A 2J87A 2LB7A 5HQ8A 2GKRI 4WP4A 3GOXA 1V1IA 2V1CA 4JCVE 5CCMA 1KBEA 1IY6A 3R5AA 1AN1I 5DAEA 1TUSA 3UFFA 2ENZA 5FUYA 1KMAA 1YTPA 1WGCA 1Y1BA 2WVJA 1UVGA 3TOAA 1Y8FA 2L8EA 1FY7A 2OVOA 4A24A 1HEVA 4FKDA 4E1RA 1SGPI 3VDPA 2NU1I 2NU0I 2F3CI 1S20A 1YU6C 1OYVI 2ROWA 2A20A 2KMPA 1Q9BA 2K9HA 2ARPF 2GIVA 1PTQA 2X52A 2SGQI 1P9GA 1W4RA 3TO9A 2ORWA 2SGDI 1WGTA 7WGAA 1IY5A 1DS2I 1U5KA 1ULMA 3OXLA 3HH2C 1BMOA 1SGRI
chains in the Genus database with same CATH topology
1PJUA 1V1HA 2JXDA 2B0UC 2FNFX 2P6AC 5FUVA 2DB6A 1PTRA 3UGIA 2QPOA 3D00A 1TBRR 2N1AB 2V1CC 1PCEA 2ELIA 1SGNI 3UGDA 3UEJA 2E5RA 2LUYA 5CCLA 3FC3A 1TGSI 1OMUA 5JHWC 1PPFI 2KMRA 2L7XA 1NUBA 2LEOA 2ERWA 1TURA 4HGUA 1TIHA 1VDDA 2BUSA 1SGEI 1TBOA 1CT2I 5FUXA 3E59A 3SGBI 5HI7A 1CT4I 3SEKC 2GKTI 1R79A 3PDNA 1HJAI 2ENNA 2B8TA 2N71A 2SGPI 1RFHA 2XRCA 3TJQA 1TOTA 2NU2I 2UZ3A 1CGII 1W3SA 3RU0A 1CSOI 5EX3A 3MEKA 2JW6A 1FARA 2E73A 2QQCA 2SGFI 2WCYA 1IW4A 1N13A 2JA1A 1HPTA 1H0ZA 2OD1A 3VE5A 3BJIA 5FUWA 2W0TA 1TBNA 3OXFA 1MT1A 2ODDA 2QQEA 1TBQR 2KMQA 2VRWB 3E2IA 3OXGA 3CXLA 1XX6A 1FAQA 1CT0I 3SGQI 4B6DA 1XA6A 2JZMA 4L9MA 1DS3I 1XBTA 2N52A 2YQPA 5EX0A 4UXJA 1SGYI 1LR7A 2ORVA 1KBFA 1X4SA 2J9RA 1SGDI 3OL0A 2NU4I 4UXIA 2QQDA 3VDUA 1CHOI 2CJSC 1Z7KB 3QTLD 3OVOA 4UXHA 4E1PA 3B4VC 2N17A 2JYYA 1HDLA 2V53A 1LR8A 4OVOA 2GVIA 1Y1CA 2SGEI 4GI3C 1M8CA 2GKVA 1FYBA 1CE3A 2YUUA 2DIPA 1CGJI 2KMOA 1UUCA 3QWPA 3KY9A 4SGBI 3UEYA 2KCXA 3UGLA 1UVFA 1M8BA 1OVOA 2M5XA 1BUSA 1OMTA 1X74A 1SGQI 1LR9A 1R0RI 2NU3I 2QQ0A 2J87A 5HQ8A 2GKRI 3GOXA 1V1IA 2V1CA 4JCVE 5CCMA 1KBEA 1IY6A 1KMAA 1AN1I 5DAEA 1TUSA 3UFFA 2ENZA 5FUYA 1YTPA 1Y1BA 2WVJA 1UVGA 1Y8FA 2L8EA 2OVOA 4A24A 4FKDA 4E1RA 1SGPI 3VDPA 2NU1I 2NU0I 2F3CI 1YU6C 1OYVI 2ROWA 2A20A 2KMPA 2K9HA 2ARPF 1PTQA 2SGQI 1W4RA 2ORWA 2SGDI 1IY5A 1DS2I 1U5KA 3OXLA 3HH2C 1BMOA 1SGRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJU A;  2JXD A;  2B0U C;  2P6A C;  1TBR R;  1PCE A;  1SGN I;  1TGS I;  1OMU A;  5JHW C;  1PPF I;  2KMR A;  1NUB A;  2LEO A;  2ERW A;  1TUR A;  4HGU A;  1TIH A;  2BUS A;  1SGE I;  1CT2 I;  3SGB I;  1CT4 I;  3SEK C;  2GKT I;  1HJA I;  2SGP I;  2N71 A;  2XRC A;  3TJQ A;  2NU2 I;  1CGI I;  1CSO I;  2SGF I;  2QQC A;  2WCY A;  1IW4 A;  1N13 A;  1HPT A;  1H0Z A;  1MT1 A;  1TBQ R;  2KMQ A;  1CT0 I;  3SGQ I;  2JZM A;  1DS3 I;  2N52 A;  1SGY I;  1LR7 A;  1SGD I;  2NU4 I;  2QQD A;  1CHO I;  1Z7K B;  3QTL D;  3OVO A;  3B4V C;  2N17 A;  2JYY A;  1HDL A;  2V53 A;  1LR8 A;  4OVO A;  1Y1C A;  2SGE I;  4GI3 C;  1M8C A;  2GKV A;  1FYB A;  1CE3 A;  4SGB I;  1CGJ I;  2KMO A;  1UUC A;  2KCX A;  1UVF A;  1M8B A;  1OVO A;  2M5X A;  1BUS A;  1OMT A;  1SGQ I;  1LR9 A;  2NU3 I;  1R0R I;  2GKR I;  1IY6 A;  1KMA A;  1AN1 I;  5DAE A;  1TUS A;  1YTP A;  1Y1B A;  1UVG A;  2OVO A;  1SGP I;  2NU1 I;  2NU0 I;  2F3C I;  1YU6 C;  1OYV I;  2KMP A;  2ARP F;  2SGQ I;  1IY5 A;  2SGD I;  1DS2 I;  3HH2 C;  1BMO A;  1SGR I; 
#chains in the Genus database with same CATH topology
 1PJU A;  1V1H A;  4MPI A;  2JXD A;  2B0U C;  2FNF X;  2P6A C;  5FUV A;  5J8C A;  2DB6 A;  1PTR A;  3UGI A;  1UHA A;  2QPO A;  5E3P A;  3D00 A;  1TBR R;  3TO7 A;  2N1A B;  2V1C C;  1PCE A;  2UVO A;  2ELI A;  1SGN I;  3UGD A;  3UEJ A;  2E5R A;  2LUY A;  2X3T A;  5CCL A;  2OZU A;  3FC3 A;  1NXU A;  1K7T A;  2CWG A;  2DKV A;  1TGS I;  3FSY A;  3QAH A;  1ULN A;  1OMU A;  5JHW C;  1PPF I;  2KMR A;  2L7X A;  1NUB A;  2LEO A;  1Z2I A;  2ERW A;  1P9Z A;  1TUR A;  1TIH A;  1VDD A;  2BUS A;  4HGU A;  1SGE I;  1TBO A;  1CT2 I;  2RC4 A;  3E59 A;  5FUX A;  5HI7 A;  3SGB I;  1CT4 I;  3SEK C;  2GKT I;  2WGC A;  1R79 A;  3PDN A;  1HJA I;  2ENN A;  2B8T A;  2N71 A;  1MJA A;  2SGP I;  1RFH A;  2OU2 A;  2XRC A;  3TJQ A;  1TOT A;  2NU2 I;  2UZ3 A;  2RIJ A;  1CGI I;  1W3S A;  3RU0 A;  1CSO I;  5EX3 A;  3MEK A;  2JW6 A;  1FAR A;  3UOE A;  2E73 A;  2QQC A;  2SGF I;  5E3Q A;  2WCY A;  2CWH A;  1N13 A;  1IW4 A;  2JA1 A;  2Y0M A;  1HPT A;  1H0Z A;  2OD1 A;  3VE5 A;  3BJI A;  3R5B A;  5FUW A;  2W0T A;  1TBN A;  3OXF A;  1MT1 A;  1K7V A;  2CWF A;  2ODD A;  2QQE A;  1TBQ R;  3TOB A;  5E3R A;  2KMQ A;  2VRW B;  3E2I A;  3OXG A;  3CXL A;  1XX6 A;  1FAQ A;  1CT0 I;  3SGQ I;  4B6D A;  4DNC A;  1XA6 A;  2JZM A;  4L9M A;  1DS3 I;  1XBT A;  2N52 A;  2YQP A;  5EX0 A;  4UXJ A;  1SGY I;  1WTJ A;  5J8F A;  1LR7 A;  2ORV A;  1KBF A;  1X4S A;  2J9R A;  1SGD I;  3OL0 A;  3R5C A;  1K7U A;  2NU4 I;  4UXI A;  2QQD A;  3VDU A;  1CHO I;  2CJS C;  1Z7K B;  3QTL D;  3OVO A;  4UXH A;  3TO6 A;  3B4V C;  4E1P A;  2N17 A;  2JYY A;  1HDL A;  2V53 A;  1LR8 A;  4OVO A;  2GVI A;  1ULK A;  1Y1C A;  2SGE I;  4GI3 C;  1M8C A;  3FSX A;  2GKV A;  4AML A;  1WKX A;  1CE3 A;  2YUU A;  1FYB A;  2DIP A;  1CGJ I;  2KMO A;  1UUC A;  3QWP A;  3KY9 A;  3R5D A;  4SGB I;  3UEY A;  1MJB A;  1MJ9 A;  9WGA A;  2KCX A;  3UGL A;  1UVF A;  1M8B A;  1OVO A;  2M5X A;  2PQ8 A;  1BUS A;  1OMT A;  1X74 A;  1SGQ I;  1LR9 A;  1R0R I;  2NU3 I;  2QQ0 A;  2J87 A;  2LB7 A;  5HQ8 A;  2GKR I;  4WP4 A;  3GOX A;  1V1I A;  2V1C A;  4JCV E;  5CCM A;  1KBE A;  1IY6 A;  3R5A A;  1AN1 I;  5DAE A;  1TUS A;  3UFF A;  2ENZ A;  5FUY A;  1KMA A;  1YTP A;  1WGC A;  1Y1B A;  2WVJ A;  1UVG A;  3TOA A;  1Y8F A;  2L8E A;  1FY7 A;  2OVO A;  4A24 A;  1HEV A;  4FKD A;  4E1R A;  1SGP I;  3VDP A;  2NU1 I;  2NU0 I;  2F3C I;  1S20 A;  1YU6 C;  1OYV I;  2ROW A;  2A20 A;  2KMP A;  1Q9B A;  2K9H A;  2ARP F;  2GIV A;  1PTQ A;  2X52 A;  2SGQ I;  1P9G A;  1W4R A;  3TO9 A;  2ORW A;  2SGD I;  1WGT A;  7WGA A;  1IY5 A;  1DS2 I;  1U5K A;  1ULM A;  3OXL A;  3HH2 C;  1BMO A;  1SGR I; 
#chains in the Genus database with same CATH homology
 1PJU A;  1V1H A;  2JXD A;  2B0U C;  2FNF X;  2P6A C;  5FUV A;  2DB6 A;  1PTR A;  3UGI A;  2QPO A;  3D00 A;  1TBR R;  2N1A B;  2V1C C;  1PCE A;  2ELI A;  1SGN I;  3UGD A;  3UEJ A;  2E5R A;  2LUY A;  5CCL A;  3FC3 A;  1TGS I;  1OMU A;  5JHW C;  1PPF I;  2KMR A;  2L7X A;  1NUB A;  2LEO A;  2ERW A;  1TUR A;  4HGU A;  1TIH A;  1VDD A;  2BUS A;  1SGE I;  1TBO A;  1CT2 I;  5FUX A;  3E59 A;  3SGB I;  5HI7 A;  1CT4 I;  3SEK C;  2GKT I;  1R79 A;  3PDN A;  1HJA I;  2ENN A;  2B8T A;  2N71 A;  2SGP I;  1RFH A;  2XRC A;  3TJQ A;  1TOT A;  2NU2 I;  2UZ3 A;  1CGI I;  1W3S A;  3RU0 A;  1CSO I;  5EX3 A;  3MEK A;  2JW6 A;  1FAR A;  2E73 A;  2QQC A;  2SGF I;  2WCY A;  1IW4 A;  1N13 A;  2JA1 A;  1HPT A;  1H0Z A;  2OD1 A;  3VE5 A;  3BJI A;  5FUW A;  2W0T A;  1TBN A;  3OXF A;  1MT1 A;  2ODD A;  2QQE A;  1TBQ R;  2KMQ A;  2VRW B;  3E2I A;  3OXG A;  3CXL A;  1XX6 A;  1FAQ A;  1CT0 I;  3SGQ I;  4B6D A;  1XA6 A;  2JZM A;  4L9M A;  1DS3 I;  1XBT A;  2N52 A;  2YQP A;  5EX0 A;  4UXJ A;  1SGY I;  1LR7 A;  2ORV A;  1KBF A;  1X4S A;  2J9R A;  1SGD I;  3OL0 A;  2NU4 I;  4UXI A;  2QQD A;  3VDU A;  1CHO I;  2CJS C;  1Z7K B;  3QTL D;  3OVO A;  4UXH A;  4E1P A;  3B4V C;  2N17 A;  2JYY A;  1HDL A;  2V53 A;  1LR8 A;  4OVO A;  2GVI A;  1Y1C A;  2SGE I;  4GI3 C;  1M8C A;  2GKV A;  1FYB A;  1CE3 A;  2YUU A;  2DIP A;  1CGJ I;  2KMO A;  1UUC A;  3QWP A;  3KY9 A;  4SGB I;  3UEY A;  2KCX A;  3UGL A;  1UVF A;  1M8B A;  1OVO A;  2M5X A;  1BUS A;  1OMT A;  1X74 A;  1SGQ I;  1LR9 A;  1R0R I;  2NU3 I;  2QQ0 A;  2J87 A;  5HQ8 A;  2GKR I;  3GOX A;  1V1I A;  2V1C A;  4JCV E;  5CCM A;  1KBE A;  1IY6 A;  1KMA A;  1AN1 I;  5DAE A;  1TUS A;  3UFF A;  2ENZ A;  5FUY A;  1YTP A;  1Y1B A;  2WVJ A;  1UVG A;  1Y8F A;  2L8E A;  2OVO A;  4A24 A;  4FKD A;  4E1R A;  1SGP I;  3VDP A;  2NU1 I;  2NU0 I;  2F3C I;  1YU6 C;  1OYV I;  2ROW A;  2A20 A;  2KMP A;  2K9H A;  2ARP F;  1PTQ A;  2SGQ I;  1W4R A;  2ORW A;  2SGD I;  1IY5 A;  1DS2 I;  1U5K A;  3OXL A;  3HH2 C;  1BMO A;  1SGR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...