1WGTA

X-ray structure of wheat germ agglutinin isolectin 3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin (agglutinin)
molecule keywords WHEAT GERM LECTIN
publication title X-ray structure of wheat germ agglutinin isolectin 3.
pubmed doi rcsb
source organism Triticum aestivum
total genus 51
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA04
2CWGA 2WGCA 4MPIA 1UHAA 1HEVA 1K7UA 1WGTA 2DKVA 2UVOA 2LB7A 9WGAA 1K7TA 1ULMA 1K7VA 1P9GA 1ULKA 1WKXA 2X52A 1ULNA 1P9ZA 7WGAA 4AMLA 2X3TA 1Q9BA 4WP4A 1WGCA
chains in the Genus database with same CATH superfamily
2N1AB 3UGDA 1W3SA 1TURA 5HQ8A 2OVOA 3SGQI 1HEVA 1PTQA 3QTLD 3R5DA 5FUYA 1FAQA 1R0RI 1LR9A 1UUCA 2LB7A 3FC3A 1NXUA 1W4RA 2QQEA 1K7TA 3E2IA 3CXLA 1BUSA 3B4VC 1TBOA 5FUWA 1MT1A 1K7VA 1OMTA 1P9GA 1LR8A 1U5KA 1TUSA 1XBTA 2LEOA 2SGDI 4L9MA 5EX3A 2GKVA 3OXFA 1CE3A 3RU0A 3E59A 2CWHA 2JW6A 2KMRA 3TO7A 1P9ZA 1SGEI 7WGAA 2KMOA 4GI3C 2ENNA 2X3TA 2SGFI 5J8FA 1TIHA 2ORWA 1UVFA 1MJBA 5E3PA 2QPOA 3SGBI 2CWGA 1MJ9A 2BUSA 2YQPA 2KCXA 1TBNA 4MPIA 1X4SA 5DAEA 2E73A 2JA1A 1OVOA 2RIJA 2GVIA 1N13A 4SGBI 1UHAA 2J87A 1BMOA 1RFHA 2V1CA 1HJAI 3BJIA 1WGTA 3UGIA 3TJQA 3OL0A 3VDUA 4JCVE 3TOAA 2QQDA 2JXDA 4E1PA 5J8CA 3UFFA 3PDNA 3QWPA 3TOBA 4B6DA 1TBRR 5CCLA 2GIVA 1DS2I 1IY6A 2RC4A 1ULKA 2K9HA 2NU2I 1FY7A 3FSYA 4UXJA 1M8BA 1ULNA 2WVJA 4HGUA 3OXGA 1IW4A 4E1RA 2UZ3A 2GKTI 1KBFA 1Q9BA 2L7XA 2V53A 5E3RA 1XA6A 2OZUA 2OU2A 1SGYI 1PTRA 1SGNI 3OVOA 4UXHA 3OXLA 2WGCA 3R5CA 3UGLA 4FKDA 5FUXA 2N71A 2SGQI 2ENZA 2LUYA 2KMQA 2XRCA 3VDPA 3UEJA 2WCYA 1K7UA 1V1HA 2YUUA 5JHWC 2DKVA 2NU3I 2QQCA 1Y1BA 4UXIA 1UVGA 2N17A 3UOEA 1CSOI 2GKRI 1ULMA 2ELIA 1H0ZA 1KMAA 1S20A 2L8EA 3R5BA 2B8TA 2W0TA 1PPFI 2CJSC 1IY5A 1YTPA 5FUVA 3FSXA 2SGEI 2X52A 1SGPI 1PJUA 1YU6C 1M8CA 1XX6A 1KBEA 2NU1I 3UEYA 2ORVA 1HPTA 1SGQI 2P6AC 2VRWB 2ROWA 4DNCA 2KMPA 1OYVI 2V1CC 1MJAA 4WP4A 1WGCA 2J9RA 1Y8FA 1HDLA 1FARA 1R79A 1TOTA 2M5XA 3KY9A 3VE5A 1FYBA 1CT0I 2N52A 5CCMA 1VDDA 2A20A 1PCEA 2DIPA 2F3CI 5HI7A 3TO9A 1V1IA 3R5AA 4A24A 1DS3I 1OMUA 1SGRI 2SGPI 2PQ8A 1CGJI 1Y1CA 2UVOA 2JYYA 2NU4I 2NU0I 2DB6A 3TO6A 9WGAA 1TBQR 1AN1I 1TGSI 2OD1A 1CGII 2E5RA 3SEKC 1CHOI 3QAHA 4OVOA 1NUBA 5EX0A 2QQ0A 2JZMA 3GOXA 2CWFA 2FNFX 2ODDA 1Z2IA 5E3QA 1WKXA 1LR7A 1Z7KB 3MEKA 2B0UC 3D00A 1CT4I 1SGDI 2ERWA 4AMLA 1CT2I 1WTJA 3HH2C 2ARPF 2Y0MA 1X74A
chains in the Genus database with same CATH topology
2CWGA 2WGCA 4MPIA 1UHAA 1HEVA 1K7UA 1WGTA 2DKVA 2UVOA 2LB7A 9WGAA 1K7TA 1ULMA 1K7VA 1P9GA 1ULKA 1WKXA 2X52A 1ULNA 1P9ZA 7WGAA 4AMLA 2X3TA 1Q9BA 4WP4A 1WGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWG A;  2WGC A;  4MPI A;  1UHA A;  1HEV A;  1K7U A;  1WGT A;  2DKV A;  2UVO A;  2LB7 A;  9WGA A;  1K7T A;  1ULM A;  1K7V A;  1P9G A;  1ULK A;  1WKX A;  2X52 A;  1ULN A;  1P9Z A;  7WGA A;  4AML A;  2X3T A;  1Q9B A;  4WP4 A;  1WGC A; 
#chains in the Genus database with same CATH topology
 2N1A B;  3UGD A;  1W3S A;  1TUR A;  5HQ8 A;  2OVO A;  3SGQ I;  1HEV A;  1PTQ A;  3QTL D;  3R5D A;  5FUY A;  1FAQ A;  1R0R I;  1LR9 A;  1UUC A;  2LB7 A;  3FC3 A;  1NXU A;  1W4R A;  2QQE A;  1K7T A;  3E2I A;  3CXL A;  1BUS A;  3B4V C;  1TBO A;  5FUW A;  1MT1 A;  1K7V A;  1OMT A;  1P9G A;  1LR8 A;  1U5K A;  1TUS A;  1XBT A;  2LEO A;  2SGD I;  4L9M A;  5EX3 A;  2GKV A;  3OXF A;  1CE3 A;  3RU0 A;  3E59 A;  2CWH A;  2JW6 A;  2KMR A;  3TO7 A;  1P9Z A;  1SGE I;  7WGA A;  2KMO A;  4GI3 C;  2ENN A;  2X3T A;  2SGF I;  5J8F A;  1TIH A;  2ORW A;  1UVF A;  1MJB A;  5E3P A;  2QPO A;  3SGB I;  2CWG A;  1MJ9 A;  2BUS A;  2YQP A;  2KCX A;  1TBN A;  4MPI A;  1X4S A;  5DAE A;  2E73 A;  2JA1 A;  1OVO A;  2RIJ A;  2GVI A;  1N13 A;  4SGB I;  1UHA A;  2J87 A;  1BMO A;  1RFH A;  2V1C A;  1HJA I;  3BJI A;  1WGT A;  3UGI A;  3TJQ A;  3OL0 A;  3VDU A;  4JCV E;  3TOA A;  2QQD A;  2JXD A;  4E1P A;  5J8C A;  3UFF A;  3PDN A;  3QWP A;  3TOB A;  4B6D A;  1TBR R;  5CCL A;  2GIV A;  1DS2 I;  1IY6 A;  2RC4 A;  1ULK A;  2K9H A;  2NU2 I;  1FY7 A;  3FSY A;  4UXJ A;  1M8B A;  1ULN A;  2WVJ A;  4HGU A;  3OXG A;  1IW4 A;  4E1R A;  2UZ3 A;  2GKT I;  1KBF A;  1Q9B A;  2L7X A;  2V53 A;  5E3R A;  1XA6 A;  2OZU A;  2OU2 A;  1SGY I;  1PTR A;  1SGN I;  3OVO A;  4UXH A;  3OXL A;  2WGC A;  3R5C A;  3UGL A;  4FKD A;  5FUX A;  2N71 A;  2SGQ I;  2ENZ A;  2LUY A;  2KMQ A;  2XRC A;  3VDP A;  3UEJ A;  2WCY A;  1K7U A;  1V1H A;  2YUU A;  5JHW C;  2DKV A;  2NU3 I;  2QQC A;  1Y1B A;  4UXI A;  1UVG A;  2N17 A;  3UOE A;  1CSO I;  2GKR I;  1ULM A;  2ELI A;  1H0Z A;  1KMA A;  1S20 A;  2L8E A;  3R5B A;  2B8T A;  2W0T A;  1PPF I;  2CJS C;  1IY5 A;  1YTP A;  5FUV A;  3FSX A;  2SGE I;  2X52 A;  1SGP I;  1PJU A;  1YU6 C;  1M8C A;  1XX6 A;  1KBE A;  2NU1 I;  3UEY A;  2ORV A;  1HPT A;  1SGQ I;  2P6A C;  2VRW B;  2ROW A;  4DNC A;  2KMP A;  1OYV I;  2V1C C;  1MJA A;  4WP4 A;  1WGC A;  2J9R A;  1Y8F A;  1HDL A;  1FAR A;  1R79 A;  1TOT A;  2M5X A;  3KY9 A;  3VE5 A;  1FYB A;  1CT0 I;  2N52 A;  5CCM A;  1VDD A;  2A20 A;  1PCE A;  2DIP A;  2F3C I;  5HI7 A;  3TO9 A;  1V1I A;  3R5A A;  4A24 A;  1DS3 I;  1OMU A;  1SGR I;  2SGP I;  2PQ8 A;  1CGJ I;  1Y1C A;  2UVO A;  2JYY A;  2NU4 I;  2NU0 I;  2DB6 A;  3TO6 A;  9WGA A;  1TBQ R;  1AN1 I;  1TGS I;  2OD1 A;  1CGI I;  2E5R A;  3SEK C;  1CHO I;  3QAH A;  4OVO A;  1NUB A;  5EX0 A;  2QQ0 A;  2JZM A;  3GOX A;  2CWF A;  2FNF X;  2ODD A;  1Z2I A;  5E3Q A;  1WKX A;  1LR7 A;  1Z7K B;  3MEK A;  2B0U C;  3D00 A;  1CT4 I;  1SGD I;  2ERW A;  4AML A;  1CT2 I;  1WTJ A;  3HH2 C;  2ARP F;  2Y0M A;  1X74 A; 
#chains in the Genus database with same CATH homology
 2CWG A;  2WGC A;  4MPI A;  1UHA A;  1HEV A;  1K7U A;  1WGT A;  2DKV A;  2UVO A;  2LB7 A;  9WGA A;  1K7T A;  1ULM A;  1K7V A;  1P9G A;  1ULK A;  1WKX A;  2X52 A;  1ULN A;  1P9Z A;  7WGA A;  4AML A;  2X3T A;  1Q9B A;  4WP4 A;  1WGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...