1WGTA

X-ray structure of wheat germ agglutinin isolectin 3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WHEAT GERM LECTIN
publication title X-ray structure of wheat germ agglutinin isolectin 3.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Lectin (agglutinin)
total genus 51
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wgtA04
1Q9BA 4MPIA 7WGAA 1ULNA 2LB7A 1P9ZA 2X52A 1P9GA 2DKVA 9WGAA 2X3TA 4WP4A 1K7VA 1K7UA 1ULMA 2CWGA 2WGCA 4AMLA 1WGTA 1WGCA 1K7TA 1HEVA 1UHAA 1ULKA 2UVOA 1WKXA
chains in the Genus database with same CATH superfamily
3UEJA 3CXLA 3B4VC 2L7XA 3OXGA 3SEKC 4MPIA 2N52A 2YUUA 1AN1I 1HPTA 1TGSI 2KMRA 2QQCA 1WTJA 4GI3C 3UGLA 1Z7KB 2N71A 3VDUA 1PTRA 2SGEI 1KBFA 3TOAA 1P9GA 9WGAA 1BUSA 4SGBI 1Y1BA 2X3TA 5E3QA 3FC3A 2ELIA 3OVOA 2GVIA 2OZUA 4WP4A 3UFFA 1K7UA 4UXIA 3TO7A 3RU0A 1XBTA 3TJQA 1TBOA 2ARPF 1DS2I 2Y0MA 4A24A 2W0TA 2OU2A 3R5AA 1CT0I 5FUYA 2NU0I 2QQDA 1IY5A 2ENZA 1TBQR 3QTLD 1IW4A 3QAHA 2QQEA 2NU2I 3FSYA 3R5CA 1HEVA 1ULKA 3KY9A 2WCYA 1KBEA 1V1HA 3QWPA 3UEYA 2ROWA 1X4SA 1R0RI 2J9RA 1DS3I 1BMOA 3OXLA 2ENNA 1CT4I 1OMTA 5J8CA 1CGII 1FAQA 1CSOI 5E3RA 3TO6A 2M5XA 1RFHA 2DB6A 2LUYA 1TIHA 4DNCA 2VRWB 4E1RA 1ULNA 2JA1A 1P9ZA 2QPOA 3MEKA 2OVOA 4HGUA 2JYYA 3TOBA 1YTPA 5FUXA 1LR8A 2B8TA 3OL0A 5FUVA 2ERWA 2L8EA 1FYBA 2WGCA 3R5DA 2RC4A 2A20A 1WGCA 2CWFA 1KMAA 1PPFI 2RIJA 2CWHA 2SGFI 1UHAA 3FSXA 1LR7A 2UZ3A 1SGYI 2WVJA 1M8BA 1PTQA 1SGRI 1XA6A 1H0ZA 2KMQA 3E2IA 1NUBA 3VDPA 2NU3I 1Y8FA 5JHWC 4UXJA 1V1IA 1NXUA 1W4RA 2V53A 1FARA 1OMUA 3OXFA 2E73A 4FKDA 2GIVA 2LB7A 2PQ8A 5EX0A 3SGBI 4B6DA 1MJAA 1TURA 2JXDA 2F3CI 2NU1I 2JZMA 2X52A 1M8CA 2QQ0A 2GKRI 3BJIA 1S20A 1YU6C 1U5KA 1UUCA 1Z2IA 1X74A 1LR9A 1K7VA 1UVFA 1MJBA 2BUSA 2KMOA 2NU4I 2GKTI 1CHOI 1CT2I 2FNFX 1SGPI 1ULMA 1IY6A 2CWGA 2ORWA 2P6AC 4E1PA 3UOEA 3D00A 2N1AB 3UGIA 1K7TA 1OVOA 1CGJI 1SGDI 3R5BA 3UGDA 5CCLA 1OYVI 2J87A 4JCVE 1SGEI 2JW6A 1FY7A 2ODDA 2ORVA 1PCEA 1MT1A 1PJUA 3PDNA 3E59A 1XX6A 1Q9BA 7WGAA 1HJAI 5J8FA 2GKVA 4UXHA 1R79A 5E3PA 5EX3A 5HI7A 2V1CC 2XRCA 3VE5A 3HH2C 2KMPA 2DIPA 2B0UC 2CJSC 2DKVA 2SGQI 1TOTA 1W3SA 2N17A 1CE3A 1HDLA 4L9MA 1TBRR 2KCXA 2V1CA 1TUSA 2YQPA 2SGDI 2LEOA 5CCMA 1MJ9A 1SGQI 1TBNA 2E5RA 2OD1A 1VDDA 5DAEA 3SGQI 3TO9A 1UVGA 1WGTA 1N13A 4AMLA 3GOXA 1SGNI 1Y1CA 2SGPI 5FUWA 5HQ8A 2K9HA 2UVOA 1WKXA 4OVOA
chains in the Genus database with same CATH topology
1Q9BA 4MPIA 7WGAA 1ULNA 2LB7A 1P9ZA 2X52A 1P9GA 2DKVA 9WGAA 2X3TA 4WP4A 1K7VA 1K7UA 1ULMA 2CWGA 2WGCA 4AMLA 1WGTA 1WGCA 1K7TA 1HEVA 1UHAA 1ULKA 2UVOA 1WKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9B A;  4MPI A;  7WGA A;  1ULN A;  2LB7 A;  1P9Z A;  2X52 A;  1P9G A;  2DKV A;  9WGA A;  2X3T A;  4WP4 A;  1K7V A;  1K7U A;  1ULM A;  2CWG A;  2WGC A;  4AML A;  1WGT A;  1WGC A;  1K7T A;  1HEV A;  1UHA A;  1ULK A;  2UVO A;  1WKX A; 
#chains in the Genus database with same CATH topology
 3UEJ A;  3CXL A;  3B4V C;  2L7X A;  3OXG A;  3SEK C;  4MPI A;  2N52 A;  2YUU A;  1AN1 I;  1HPT A;  1TGS I;  2KMR A;  2QQC A;  1WTJ A;  4GI3 C;  3UGL A;  1Z7K B;  2N71 A;  3VDU A;  1PTR A;  2SGE I;  1KBF A;  3TOA A;  1P9G A;  9WGA A;  1BUS A;  4SGB I;  1Y1B A;  2X3T A;  5E3Q A;  3FC3 A;  2ELI A;  3OVO A;  2GVI A;  2OZU A;  4WP4 A;  3UFF A;  1K7U A;  4UXI A;  3TO7 A;  3RU0 A;  1XBT A;  3TJQ A;  1TBO A;  2ARP F;  1DS2 I;  2Y0M A;  4A24 A;  2W0T A;  2OU2 A;  3R5A A;  1CT0 I;  5FUY A;  2NU0 I;  2QQD A;  1IY5 A;  2ENZ A;  1TBQ R;  3QTL D;  1IW4 A;  3QAH A;  2QQE A;  2NU2 I;  3FSY A;  3R5C A;  1HEV A;  1ULK A;  3KY9 A;  2WCY A;  1KBE A;  1V1H A;  3QWP A;  3UEY A;  2ROW A;  1X4S A;  1R0R I;  2J9R A;  1DS3 I;  1BMO A;  3OXL A;  2ENN A;  1CT4 I;  1OMT A;  5J8C A;  1CGI I;  1FAQ A;  1CSO I;  5E3R A;  3TO6 A;  2M5X A;  1RFH A;  2DB6 A;  2LUY A;  1TIH A;  4DNC A;  2VRW B;  4E1R A;  1ULN A;  2JA1 A;  1P9Z A;  2QPO A;  3MEK A;  2OVO A;  4HGU A;  2JYY A;  3TOB A;  1YTP A;  5FUX A;  1LR8 A;  2B8T A;  3OL0 A;  5FUV A;  2ERW A;  2L8E A;  1FYB A;  2WGC A;  3R5D A;  2RC4 A;  2A20 A;  1WGC A;  2CWF A;  1KMA A;  1PPF I;  2RIJ A;  2CWH A;  2SGF I;  1UHA A;  3FSX A;  1LR7 A;  2UZ3 A;  1SGY I;  2WVJ A;  1M8B A;  1PTQ A;  1SGR I;  1XA6 A;  1H0Z A;  2KMQ A;  3E2I A;  1NUB A;  3VDP A;  2NU3 I;  1Y8F A;  5JHW C;  4UXJ A;  1V1I A;  1NXU A;  1W4R A;  2V53 A;  1FAR A;  1OMU A;  3OXF A;  2E73 A;  4FKD A;  2GIV A;  2LB7 A;  2PQ8 A;  5EX0 A;  3SGB I;  4B6D A;  1MJA A;  1TUR A;  2JXD A;  2F3C I;  2NU1 I;  2JZM A;  2X52 A;  1M8C A;  2QQ0 A;  2GKR I;  3BJI A;  1S20 A;  1YU6 C;  1U5K A;  1UUC A;  1Z2I A;  1X74 A;  1LR9 A;  1K7V A;  1UVF A;  1MJB A;  2BUS A;  2KMO A;  2NU4 I;  2GKT I;  1CHO I;  1CT2 I;  2FNF X;  1SGP I;  1ULM A;  1IY6 A;  2CWG A;  2ORW A;  2P6A C;  4E1P A;  3UOE A;  3D00 A;  2N1A B;  3UGI A;  1K7T A;  1OVO A;  1CGJ I;  1SGD I;  3R5B A;  3UGD A;  5CCL A;  1OYV I;  2J87 A;  4JCV E;  1SGE I;  2JW6 A;  1FY7 A;  2ODD A;  2ORV A;  1PCE A;  1MT1 A;  1PJU A;  3PDN A;  3E59 A;  1XX6 A;  1Q9B A;  7WGA A;  1HJA I;  5J8F A;  2GKV A;  4UXH A;  1R79 A;  5E3P A;  5EX3 A;  5HI7 A;  2V1C C;  2XRC A;  3VE5 A;  3HH2 C;  2KMP A;  2DIP A;  2B0U C;  2CJS C;  2DKV A;  2SGQ I;  1TOT A;  1W3S A;  2N17 A;  1CE3 A;  1HDL A;  4L9M A;  1TBR R;  2KCX A;  2V1C A;  1TUS A;  2YQP A;  2SGD I;  2LEO A;  5CCM A;  1MJ9 A;  1SGQ I;  1TBN A;  2E5R A;  2OD1 A;  1VDD A;  5DAE A;  3SGQ I;  3TO9 A;  1UVG A;  1WGT A;  1N13 A;  4AML A;  3GOX A;  1SGN I;  1Y1C A;  2SGP I;  5FUW A;  5HQ8 A;  2K9H A;  2UVO A;  1WKX A;  4OVO A; 
#chains in the Genus database with same CATH homology
 1Q9B A;  4MPI A;  7WGA A;  1ULN A;  2LB7 A;  1P9Z A;  2X52 A;  1P9G A;  2DKV A;  9WGA A;  2X3T A;  4WP4 A;  1K7V A;  1K7U A;  1ULM A;  2CWG A;  2WGC A;  4AML A;  1WGT A;  1WGC A;  1K7T A;  1HEV A;  1UHA A;  1ULK A;  2UVO A;  1WKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...