3UFFA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVTNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein kinase C delta type
publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uffA01
2VRWB 3BJIA 4UXIA 2QQEA 2WVJA 1R79A 1FARA 2GVIA 2ROWA 2JA1A 3UGLA 1XBTA 5FUVA 4L9MA 1TBOA 1PTRA 2J9RA 2ELIA 2DB6A 3E2IA 3UEJA 2ENZA 3KY9A 2B8TA 1RFHA 1KBEA 2ORWA 2YUUA 2QQ0A 5FUWA 4FKDA 2UZ3A 1PTQA 1XX6A 2ENNA 4B6DA 1FAQA 1KBFA 2FNFX 2ORVA 5FUYA 1XA6A 2J87A 2E73A 3UGIA 3CXLA 5FUXA 3UGDA 4UXHA 4UXJA 2QPOA 1Y8FA 3UFFA 1W4RA 1TBNA 3UEYA
chains in the Genus database with same CATH superfamily
1SGNI 2W0TA 3D00A 1OVOA 1MJBA 1S20A 2F3CI 2ROWA 3E59A 2LEOA 1NXUA 1TBOA 1DS3I 2RC4A 2DB6A 1R0RI 4GI3C 1UVGA 3UEJA 1K7TA 1TURA 2L7XA 5E3PA 3TO7A 4HGUA 1WTJA 2ORWA 3R5CA 3TOBA 2ODDA 2SGEI 4E1PA 1MT1A 3OXFA 2GKVA 3B4VC 1IW4A 2N17A 1PTQA 1V1IA 4B6DA 2N71A 1KBFA 1BUSA 2L8EA 1HPTA 2CWGA 2V1CA 2OU2A 1NUBA 1AN1I 2KMOA 1PCEA 3QAHA 4DNCA 5HQ8A 1XA6A 2K9HA 1CT4I 1TBQR 2E73A 2GIVA 4SGBI 1K7UA 2BUSA 1OYVI 2PQ8A 1TBRR 2CJSC 1IY5A 1OMTA 3OL0A 4UXJA 1X4SA 3VDPA 1KMAA 2GKRI 2WCYA 1MJ9A 3BJIA 1CT0I 5EX0A 1OMUA 1CE3A 1H0ZA 1YU6C 2GVIA 1BMOA 1SGDI 1XBTA 5FUVA 4L9MA 4AMLA 2J9RA 3OXGA 9WGAA 1WGTA 2ENZA 2QQDA 3TOAA 2JYYA 2QQ0A 1FYBA 1Y1CA 3SGBI 1YTPA 2V1CC 4FKDA 2NU1I 2UZ3A 1CT2I 4E1RA 2CWHA 2LB7A 3HH2C 3QTLD 7WGAA 1W3SA 2QQCA 2KMRA 1UUCA 5CCLA 3MEKA 2DKVA 2M5XA 2SGPI 3R5BA 1V1HA 4MPIA 1K7VA 1UHAA 2SGQI 2KCXA 1N13A 2KMPA 1SGYI 3UFFA 2SGFI 3OVOA 2ORVA 1M8CA 1WKXA 2VRWB 3VDUA 2QQEA 2YQPA 1R79A 2JXDA 2JZMA 1FARA 2JA1A 3UGLA 3R5AA 1IY6A 2OVOA 4WP4A 3SEKC 2ELIA 1CGJI 1Z2IA 2NU4I 3QWPA 2RIJA 1SGPI 2N1AB 3TJQA 1X74A 2E5RA 2B8TA 1RFHA 1KBEA 2KMQA 2YUUA 1LR8A 1WGCA 3FSYA 5EX3A 3UOEA 1VDDA 1ULKA 5FUWA 3R5DA 5DAEA 1HDLA 2ENNA 2LUYA 1FAQA 2NU2I 1TIHA 2JW6A 5HI7A 1SGQI 2V53A 3FSXA 1UVFA 5FUYA 3TO9A 1Z7KB 5JHWC 1CSOI 1HJAI 1SGEI 3PDNA 2X52A 3UGIA 2P6AC 3GOXA 2WGCA 5CCMA 1FY7A 2QPOA 1Y8FA 1W4RA 1Q9BA 1TBNA 1LR9A 4UXIA 2WVJA 1HEVA 1PPFI 1LR7A 1PJUA 3TO6A 1P9ZA 1PTRA 1TGSI 2NU3I 2X3TA 1DS2I 3E2IA 2A20A 2DIPA 2CWFA 3KY9A 1ULMA 2NU0I 2OZUA 5E3QA 2ARPF 2UVOA 1CGII 1U5KA 2OD1A 1MJAA 4OVOA 5E3RA 5J8CA 3VE5A 5J8FA 3SGQI 1XX6A 1ULNA 1CHOI 2GKTI 1M8BA 4JCVE 1SGRI 2FNFX 2B0UC 1P9GA 2ERWA 1Y1BA 2N52A 1TOTA 3OXLA 2J87A 3FC3A 3CXLA 1TUSA 5FUXA 3UGDA 4UXHA 2XRCA 4A24A 3RU0A 2SGDI 2Y0MA 3UEYA
chains in the Genus database with same CATH topology
1SGNI 2W0TA 3D00A 1OVOA 2F3CI 2ROWA 3E59A 2LEOA 1TBOA 1DS3I 2DB6A 1R0RI 4GI3C 1UVGA 3UEJA 1TURA 2L7XA 4HGUA 2ORWA 4E1PA 2ODDA 2SGEI 1MT1A 3OXFA 2GKVA 3B4VC 1IW4A 2N17A 1PTQA 1V1IA 4B6DA 2N71A 1KBFA 1BUSA 2L8EA 1HPTA 2V1CA 1NUBA 1AN1I 2KMOA 1PCEA 5HQ8A 1XA6A 2K9HA 1CT4I 1TBQR 2E73A 4SGBI 2BUSA 1OYVI 1TBRR 2CJSC 1IY5A 1OMTA 3OL0A 4UXJA 1X4SA 3VDPA 1KMAA 2GKRI 2WCYA 1H0ZA 3BJIA 1CT0I 5EX0A 1OMUA 1CE3A 1YU6C 2GVIA 1BMOA 1SGDI 1XBTA 5FUVA 4L9MA 2J9RA 3OXGA 2ENZA 2QQDA 2JYYA 2QQ0A 1FYBA 1Y1CA 3SGBI 1YTPA 2V1CC 4FKDA 2NU1I 2UZ3A 1CT2I 4E1RA 3HH2C 3QTLD 1W3SA 2QQCA 2KMRA 1UUCA 5CCLA 3MEKA 2SGPI 2M5XA 1V1HA 2SGQI 2KCXA 1N13A 2KMPA 1SGYI 3UFFA 2SGFI 3OVOA 2ORVA 1M8CA 2VRWB 3VDUA 2QQEA 2YQPA 1R79A 2JXDA 2JZMA 1FARA 2JA1A 3UGLA 1IY6A 2OVOA 3SEKC 2ELIA 1CGJI 2NU4I 3QWPA 1SGPI 2N1AB 3TJQA 1X74A 2E5RA 2B8TA 1RFHA 1KBEA 2KMQA 2YUUA 1LR8A 5EX3A 1VDDA 5FUWA 5DAEA 1HDLA 2ENNA 2LUYA 1FAQA 2NU2I 1TIHA 2JW6A 5HI7A 1SGQI 2V53A 1UVFA 5FUYA 1Z7KB 5JHWC 1CSOI 1HJAI 1SGEI 3PDNA 3UGIA 2P6AC 3GOXA 5CCMA 2QPOA 1Y8FA 1W4RA 1TBNA 1LR9A 4UXIA 2WVJA 1PPFI 1LR7A 1PJUA 1PTRA 1TGSI 2NU3I 1DS2I 3E2IA 2A20A 2DIPA 3KY9A 2NU0I 2ARPF 1CGII 1U5KA 2OD1A 4OVOA 3VE5A 3SGQI 1XX6A 1CHOI 2GKTI 1M8BA 4JCVE 1SGRI 2FNFX 2B0UC 2ERWA 1Y1BA 2N52A 1TOTA 3OXLA 2J87A 3FC3A 3CXLA 1TUSA 5FUXA 3UGDA 4UXHA 2XRCA 4A24A 3RU0A 2SGDI 3UEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRW B;  3BJI A;  4UXI A;  2QQE A;  2WVJ A;  1R79 A;  1FAR A;  2GVI A;  2ROW A;  2JA1 A;  3UGL A;  1XBT A;  5FUV A;  4L9M A;  1TBO A;  1PTR A;  2J9R A;  2ELI A;  2DB6 A;  3E2I A;  3UEJ A;  2ENZ A;  3KY9 A;  2B8T A;  1RFH A;  1KBE A;  2ORW A;  2YUU A;  2QQ0 A;  5FUW A;  4FKD A;  2UZ3 A;  1PTQ A;  1XX6 A;  2ENN A;  4B6D A;  1FAQ A;  1KBF A;  2FNF X;  2ORV A;  5FUY A;  1XA6 A;  2J87 A;  2E73 A;  3UGI A;  3CXL A;  5FUX A;  3UGD A;  4UXH A;  4UXJ A;  2QPO A;  1Y8F A;  3UFF A;  1W4R A;  1TBN A;  3UEY A; 
#chains in the Genus database with same CATH topology
 1SGN I;  2W0T A;  3D00 A;  1OVO A;  1MJB A;  1S20 A;  2F3C I;  2ROW A;  3E59 A;  2LEO A;  1NXU A;  1TBO A;  1DS3 I;  2RC4 A;  2DB6 A;  1R0R I;  4GI3 C;  1UVG A;  3UEJ A;  1K7T A;  1TUR A;  2L7X A;  5E3P A;  3TO7 A;  4HGU A;  1WTJ A;  2ORW A;  3R5C A;  3TOB A;  2ODD A;  2SGE I;  4E1P A;  1MT1 A;  3OXF A;  2GKV A;  3B4V C;  1IW4 A;  2N17 A;  1PTQ A;  1V1I A;  4B6D A;  2N71 A;  1KBF A;  1BUS A;  2L8E A;  1HPT A;  2CWG A;  2V1C A;  2OU2 A;  1NUB A;  1AN1 I;  2KMO A;  1PCE A;  3QAH A;  4DNC A;  5HQ8 A;  1XA6 A;  2K9H A;  1CT4 I;  1TBQ R;  2E73 A;  2GIV A;  4SGB I;  1K7U A;  2BUS A;  1OYV I;  2PQ8 A;  1TBR R;  2CJS C;  1IY5 A;  1OMT A;  3OL0 A;  4UXJ A;  1X4S A;  3VDP A;  1KMA A;  2GKR I;  2WCY A;  1MJ9 A;  3BJI A;  1CT0 I;  5EX0 A;  1OMU A;  1CE3 A;  1H0Z A;  1YU6 C;  2GVI A;  1BMO A;  1SGD I;  1XBT A;  5FUV A;  4L9M A;  4AML A;  2J9R A;  3OXG A;  9WGA A;  1WGT A;  2ENZ A;  2QQD A;  3TOA A;  2JYY A;  2QQ0 A;  1FYB A;  1Y1C A;  3SGB I;  1YTP A;  2V1C C;  4FKD A;  2NU1 I;  2UZ3 A;  1CT2 I;  4E1R A;  2CWH A;  2LB7 A;  3HH2 C;  3QTL D;  7WGA A;  1W3S A;  2QQC A;  2KMR A;  1UUC A;  5CCL A;  3MEK A;  2DKV A;  2M5X A;  2SGP I;  3R5B A;  1V1H A;  4MPI A;  1K7V A;  1UHA A;  2SGQ I;  2KCX A;  1N13 A;  2KMP A;  1SGY I;  3UFF A;  2SGF I;  3OVO A;  2ORV A;  1M8C A;  1WKX A;  2VRW B;  3VDU A;  2QQE A;  2YQP A;  1R79 A;  2JXD A;  2JZM A;  1FAR A;  2JA1 A;  3UGL A;  3R5A A;  1IY6 A;  2OVO A;  4WP4 A;  3SEK C;  2ELI A;  1CGJ I;  1Z2I A;  2NU4 I;  3QWP A;  2RIJ A;  1SGP I;  2N1A B;  3TJQ A;  1X74 A;  2E5R A;  2B8T A;  1RFH A;  1KBE A;  2KMQ A;  2YUU A;  1LR8 A;  1WGC A;  3FSY A;  5EX3 A;  3UOE A;  1VDD A;  1ULK A;  5FUW A;  3R5D A;  5DAE A;  1HDL A;  2ENN A;  2LUY A;  1FAQ A;  2NU2 I;  1TIH A;  2JW6 A;  5HI7 A;  1SGQ I;  2V53 A;  3FSX A;  1UVF A;  5FUY A;  3TO9 A;  1Z7K B;  5JHW C;  1CSO I;  1HJA I;  1SGE I;  3PDN A;  2X52 A;  3UGI A;  2P6A C;  3GOX A;  2WGC A;  5CCM A;  1FY7 A;  2QPO A;  1Y8F A;  1W4R A;  1Q9B A;  1TBN A;  1LR9 A;  4UXI A;  2WVJ A;  1HEV A;  1PPF I;  1LR7 A;  1PJU A;  3TO6 A;  1P9Z A;  1PTR A;  1TGS I;  2NU3 I;  2X3T A;  1DS2 I;  3E2I A;  2A20 A;  2DIP A;  2CWF A;  3KY9 A;  1ULM A;  2NU0 I;  2OZU A;  5E3Q A;  2ARP F;  2UVO A;  1CGI I;  1U5K A;  2OD1 A;  1MJA A;  4OVO A;  5E3R A;  5J8C A;  3VE5 A;  5J8F A;  3SGQ I;  1XX6 A;  1ULN A;  1CHO I;  2GKT I;  1M8B A;  4JCV E;  1SGR I;  2FNF X;  2B0U C;  1P9G A;  2ERW A;  1Y1B A;  2N52 A;  1TOT A;  3OXL A;  2J87 A;  3FC3 A;  3CXL A;  1TUS A;  5FUX A;  3UGD A;  4UXH A;  2XRC A;  4A24 A;  3RU0 A;  2SGD I;  2Y0M A;  3UEY A; 
#chains in the Genus database with same CATH homology
 1SGN I;  2W0T A;  3D00 A;  1OVO A;  2F3C I;  2ROW A;  3E59 A;  2LEO A;  1TBO A;  1DS3 I;  2DB6 A;  1R0R I;  4GI3 C;  1UVG A;  3UEJ A;  1TUR A;  2L7X A;  4HGU A;  2ORW A;  4E1P A;  2ODD A;  2SGE I;  1MT1 A;  3OXF A;  2GKV A;  3B4V C;  1IW4 A;  2N17 A;  1PTQ A;  1V1I A;  4B6D A;  2N71 A;  1KBF A;  1BUS A;  2L8E A;  1HPT A;  2V1C A;  1NUB A;  1AN1 I;  2KMO A;  1PCE A;  5HQ8 A;  1XA6 A;  2K9H A;  1CT4 I;  1TBQ R;  2E73 A;  4SGB I;  2BUS A;  1OYV I;  1TBR R;  2CJS C;  1IY5 A;  1OMT A;  3OL0 A;  4UXJ A;  1X4S A;  3VDP A;  1KMA A;  2GKR I;  2WCY A;  1H0Z A;  3BJI A;  1CT0 I;  5EX0 A;  1OMU A;  1CE3 A;  1YU6 C;  2GVI A;  1BMO A;  1SGD I;  1XBT A;  5FUV A;  4L9M A;  2J9R A;  3OXG A;  2ENZ A;  2QQD A;  2JYY A;  2QQ0 A;  1FYB A;  1Y1C A;  3SGB I;  1YTP A;  2V1C C;  4FKD A;  2NU1 I;  2UZ3 A;  1CT2 I;  4E1R A;  3HH2 C;  3QTL D;  1W3S A;  2QQC A;  2KMR A;  1UUC A;  5CCL A;  3MEK A;  2SGP I;  2M5X A;  1V1H A;  2SGQ I;  2KCX A;  1N13 A;  2KMP A;  1SGY I;  3UFF A;  2SGF I;  3OVO A;  2ORV A;  1M8C A;  2VRW B;  3VDU A;  2QQE A;  2YQP A;  1R79 A;  2JXD A;  2JZM A;  1FAR A;  2JA1 A;  3UGL A;  1IY6 A;  2OVO A;  3SEK C;  2ELI A;  1CGJ I;  2NU4 I;  3QWP A;  1SGP I;  2N1A B;  3TJQ A;  1X74 A;  2E5R A;  2B8T A;  1RFH A;  1KBE A;  2KMQ A;  2YUU A;  1LR8 A;  5EX3 A;  1VDD A;  5FUW A;  5DAE A;  1HDL A;  2ENN A;  2LUY A;  1FAQ A;  2NU2 I;  1TIH A;  2JW6 A;  5HI7 A;  1SGQ I;  2V53 A;  1UVF A;  5FUY A;  1Z7K B;  5JHW C;  1CSO I;  1HJA I;  1SGE I;  3PDN A;  3UGI A;  2P6A C;  3GOX A;  5CCM A;  2QPO A;  1Y8F A;  1W4R A;  1TBN A;  1LR9 A;  4UXI A;  2WVJ A;  1PPF I;  1LR7 A;  1PJU A;  1PTR A;  1TGS I;  2NU3 I;  1DS2 I;  3E2I A;  2A20 A;  2DIP A;  3KY9 A;  2NU0 I;  2ARP F;  1CGI I;  1U5K A;  2OD1 A;  4OVO A;  3VE5 A;  3SGQ I;  1XX6 A;  1CHO I;  2GKT I;  1M8B A;  4JCV E;  1SGR I;  2FNF X;  2B0U C;  2ERW A;  1Y1B A;  2N52 A;  1TOT A;  3OXL A;  2J87 A;  3FC3 A;  3CXL A;  1TUS A;  5FUX A;  3UGD A;  4UXH A;  2XRC A;  4A24 A;  3RU0 A;  2SGD I;  3UEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...