2WGCA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WHEAT GERM LECTIN
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Lectin (agglutinin)
total genus 41
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA01
1K7TA 2DKVA 1ULMA 1Q9BA 7WGAA 2X52A 1WGCA 1ULNA 2X3TA 1WKXA 1K7UA 4MPIA 1P9GA 2LB7A 1ULKA 1WGTA 1HEVA 4AMLA 1UHAA 9WGAA 4WP4A 1P9ZA 1K7VA 2UVOA 2WGCA 2CWGA
chains in the Genus database with same CATH superfamily
3FC3A 3UGIA 1K7TA 1ULMA 2CWHA 2OD1A 1TBOA 2E5RA 2J87A 3OXLA 4GI3C 4JCVE 1MT1A 2ENNA 2NU3I 1PJUA 2L8EA 4UXHA 2N52A 1CT0I 1CT4I 1YU6C 1ULNA 2OU2A 1TIHA 1SGDI 3B4VC 1SGYI 5E3PA 4UXJA 1WKXA 1X74A 1XA6A 1MJBA 4MPIA 2JYYA 2ROWA 1HJAI 3E59A 2ERWA 2JZMA 1FYBA 2QQCA 5FUVA 5DAEA 2JA1A 1HEVA 1HPTA 2JXDA 2GKTI 2XRCA 4AMLA 2YQPA 1PPFI 2E73A 1UHAA 2RIJA 9WGAA 1HDLA 1N13A 2WGCA 3KY9A 3UEJA 3VE5A 2GIVA 1LR7A 1LR9A 3UFFA 2PQ8A 3VDUA 4E1RA 5FUXA 3UGLA 2NU4I 3OL0A 1CGII 1UVGA 7WGAA 2GKRI 5EX3A 1XBTA 3UGDA 1LR8A 3R5DA 1TUSA 2KMQA 1S20A 1P9GA 1IY5A 1PTRA 3HH2C 1KBEA 1SGNI 2L7XA 4E1PA 1SGPI 4UXIA 3FSXA 2K9HA 2WVJA 2V53A 3TO9A 5HI7A 2KMPA 3MEKA 2ARPF 3TO7A 3UOEA 1SGRI 1OYVI 1XX6A 2B8TA 2QQ0A 2SGQI 2Y0MA 4L9MA 4B6DA 2P6AC 2QQDA 2UVOA 5HQ8A 1BMOA 2CWFA 2LEOA 3FSYA 1H0ZA 3SGBI 2LUYA 3RU0A 1Z2IA 1NXUA 3BJIA 1VDDA 3R5AA 1Q9BA 2GKVA 1M8BA 5FUYA 2W0TA 1KMAA 2ELIA 2X52A 1SGEI 1AN1I 1NUBA 1OMUA 1CE3A 2M5XA 1PCEA 2X3TA 1M8CA 2RC4A 3OXGA 5E3QA 4A24A 3GOXA 1UVFA 1CT2I 1K7UA 1Y1BA 2ENZA 2FNFX 3PDNA 3QWPA 2NU0I 1OVOA 1CSOI 5EX0A 1R79A 2DB6A 1FARA 1MJ9A 1ULKA 2JW6A 5JHWC 3TJQA 3TOAA 1FY7A 3R5BA 1TBNA 2WCYA 4WP4A 1WTJA 3D00A 1K7VA 3QTLD 1TBQR 3SEKC 2DIPA 2CJSC 2N71A 2CWGA 2KCXA 1TOTA 2B0UC 2KMRA 1TBRR 3OXFA 3TOBA 1FAQA 1X4SA 2DKVA 3E2IA 1CGJI 1PTQA 3R5CA 2F3CI 2ODDA 1CHOI 2QPOA 1U5KA 2VRWB 5E3RA 1IY6A 1TURA 2NU1I 2OZUA 1UUCA 2V1CC 1WGCA 1IW4A 2QQEA 1RFHA 1TGSI 1Z7KB 1V1HA 4SGBI 4HGUA 1W3SA 5CCLA 2N1AB 1R0RI 3OVOA 5J8FA 4DNCA 2J9RA 2ORWA 1YTPA 3TO6A 2A20A 1OMTA 2SGEI 3QAHA 2LB7A 2YUUA 5CCMA 1SGQI 1WGTA 1DS3I 2GVIA 2BUSA 2N17A 2NU2I 2SGFI 2OVOA 2UZ3A 4FKDA 2ORVA 2KMOA 1DS2I 2V1CA 5FUWA 3CXLA 1Y8FA 5J8CA 3SGQI 1MJAA 4OVOA 1P9ZA 1W4RA 1Y1CA 2SGPI 3UEYA 1BUSA 1KBFA 3VDPA 2SGDI 1V1IA
chains in the Genus database with same CATH topology
1K7TA 2DKVA 1ULMA 1Q9BA 7WGAA 2X52A 1WGCA 1ULNA 2X3TA 1WKXA 1K7UA 4MPIA 1P9GA 2LB7A 1ULKA 1WGTA 1HEVA 4AMLA 1UHAA 9WGAA 4WP4A 1P9ZA 1K7VA 2UVOA 2WGCA 2CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7T A;  2DKV A;  1ULM A;  1Q9B A;  7WGA A;  2X52 A;  1WGC A;  1ULN A;  2X3T A;  1WKX A;  1K7U A;  4MPI A;  1P9G A;  2LB7 A;  1ULK A;  1WGT A;  1HEV A;  4AML A;  1UHA A;  9WGA A;  4WP4 A;  1P9Z A;  1K7V A;  2UVO A;  2WGC A;  2CWG A; 
#chains in the Genus database with same CATH topology
 3FC3 A;  3UGI A;  1K7T A;  1ULM A;  2CWH A;  2OD1 A;  1TBO A;  2E5R A;  2J87 A;  3OXL A;  4GI3 C;  4JCV E;  1MT1 A;  2ENN A;  2NU3 I;  1PJU A;  2L8E A;  4UXH A;  2N52 A;  1CT0 I;  1CT4 I;  1YU6 C;  1ULN A;  2OU2 A;  1TIH A;  1SGD I;  3B4V C;  1SGY I;  5E3P A;  4UXJ A;  1WKX A;  1X74 A;  1XA6 A;  1MJB A;  4MPI A;  2JYY A;  2ROW A;  1HJA I;  3E59 A;  2ERW A;  2JZM A;  1FYB A;  2QQC A;  5FUV A;  5DAE A;  2JA1 A;  1HEV A;  1HPT A;  2JXD A;  2GKT I;  2XRC A;  4AML A;  2YQP A;  1PPF I;  2E73 A;  1UHA A;  2RIJ A;  9WGA A;  1HDL A;  1N13 A;  2WGC A;  3KY9 A;  3UEJ A;  3VE5 A;  2GIV A;  1LR7 A;  1LR9 A;  3UFF A;  2PQ8 A;  3VDU A;  4E1R A;  5FUX A;  3UGL A;  2NU4 I;  3OL0 A;  1CGI I;  1UVG A;  7WGA A;  2GKR I;  5EX3 A;  1XBT A;  3UGD A;  1LR8 A;  3R5D A;  1TUS A;  2KMQ A;  1S20 A;  1P9G A;  1IY5 A;  1PTR A;  3HH2 C;  1KBE A;  1SGN I;  2L7X A;  4E1P A;  1SGP I;  4UXI A;  3FSX A;  2K9H A;  2WVJ A;  2V53 A;  3TO9 A;  5HI7 A;  2KMP A;  3MEK A;  2ARP F;  3TO7 A;  3UOE A;  1SGR I;  1OYV I;  1XX6 A;  2B8T A;  2QQ0 A;  2SGQ I;  2Y0M A;  4L9M A;  4B6D A;  2P6A C;  2QQD A;  2UVO A;  5HQ8 A;  1BMO A;  2CWF A;  2LEO A;  3FSY A;  1H0Z A;  3SGB I;  2LUY A;  3RU0 A;  1Z2I A;  1NXU A;  3BJI A;  1VDD A;  3R5A A;  1Q9B A;  2GKV A;  1M8B A;  5FUY A;  2W0T A;  1KMA A;  2ELI A;  2X52 A;  1SGE I;  1AN1 I;  1NUB A;  1OMU A;  1CE3 A;  2M5X A;  1PCE A;  2X3T A;  1M8C A;  2RC4 A;  3OXG A;  5E3Q A;  4A24 A;  3GOX A;  1UVF A;  1CT2 I;  1K7U A;  1Y1B A;  2ENZ A;  2FNF X;  3PDN A;  3QWP A;  2NU0 I;  1OVO A;  1CSO I;  5EX0 A;  1R79 A;  2DB6 A;  1FAR A;  1MJ9 A;  1ULK A;  2JW6 A;  5JHW C;  3TJQ A;  3TOA A;  1FY7 A;  3R5B A;  1TBN A;  2WCY A;  4WP4 A;  1WTJ A;  3D00 A;  1K7V A;  3QTL D;  1TBQ R;  3SEK C;  2DIP A;  2CJS C;  2N71 A;  2CWG A;  2KCX A;  1TOT A;  2B0U C;  2KMR A;  1TBR R;  3OXF A;  3TOB A;  1FAQ A;  1X4S A;  2DKV A;  3E2I A;  1CGJ I;  1PTQ A;  3R5C A;  2F3C I;  2ODD A;  1CHO I;  2QPO A;  1U5K A;  2VRW B;  5E3R A;  1IY6 A;  1TUR A;  2NU1 I;  2OZU A;  1UUC A;  2V1C C;  1WGC A;  1IW4 A;  2QQE A;  1RFH A;  1TGS I;  1Z7K B;  1V1H A;  4SGB I;  4HGU A;  1W3S A;  5CCL A;  2N1A B;  1R0R I;  3OVO A;  5J8F A;  4DNC A;  2J9R A;  2ORW A;  1YTP A;  3TO6 A;  2A20 A;  1OMT A;  2SGE I;  3QAH A;  2LB7 A;  2YUU A;  5CCM A;  1SGQ I;  1WGT A;  1DS3 I;  2GVI A;  2BUS A;  2N17 A;  2NU2 I;  2SGF I;  2OVO A;  2UZ3 A;  4FKD A;  2ORV A;  2KMO A;  1DS2 I;  2V1C A;  5FUW A;  3CXL A;  1Y8F A;  5J8C A;  3SGQ I;  1MJA A;  4OVO A;  1P9Z A;  1W4R A;  1Y1C A;  2SGP I;  3UEY A;  1BUS A;  1KBF A;  3VDP A;  2SGD I;  1V1I A; 
#chains in the Genus database with same CATH homology
 1K7T A;  2DKV A;  1ULM A;  1Q9B A;  7WGA A;  2X52 A;  1WGC A;  1ULN A;  2X3T A;  1WKX A;  1K7U A;  4MPI A;  1P9G A;  2LB7 A;  1ULK A;  1WGT A;  1HEV A;  4AML A;  1UHA A;  9WGA A;  4WP4 A;  1P9Z A;  1K7V A;  2UVO A;  2WGC A;  2CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...