2WGCA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin (agglutinin)
molecule keywords WHEAT GERM LECTIN
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
total genus 41
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2wgcA01
1P9ZA 9WGAA 4MPIA 2CWGA 1ULNA 1P9GA 1ULKA 2LB7A 2WGCA 4WP4A 7WGAA 4AMLA 2UVOA 1UHAA 1WGTA 1WKXA 1K7VA 1HEVA 1ULMA 2X3TA 1K7TA 1K7UA 1WGCA 2DKVA 1Q9BA 2X52A
chains in the Genus database with same CATH superfamily
3FC3A 2GKRI 3SEKC 2LUYA 1SGEI 1UVGA 2RIJA 1ULNA 3UGIA 3QAHA 1VDDA 1P9GA 2RC4A 4OVOA 3GOXA 3OL0A 1MJ9A 2NU4I 2LB7A 1YU6C 2FNFX 1CGII 3R5DA 2GKVA 2V53A 1Y1CA 2N17A 3KY9A 7WGAA 1X74A 2JYYA 3QWPA 1UUCA 1WGTA 2QQDA 1SGNI 1ULMA 2X3TA 1K7TA 1LR8A 5J8CA 1PJUA 1CT2I 1WGCA 4SGBI 2KMPA 1NUBA 1PTQA 4B6DA 1BUSA 1FARA 1LR9A 1SGYI 1TGSI 1Z7KB 2XRCA 5EX3A 3VDPA 3CXLA 2QPOA 2WCYA 1H0ZA 2DIPA 1P9ZA 3OXLA 4UXHA 1X4SA 2KMQA 1CT0I 2OVOA 2QQCA 1TBOA 1PTRA 5DAEA 1NXUA 1TBQR 5E3QA 2ODDA 1OYVI 1CGJI 3R5BA 1HJAI 5CCLA 5FUVA 2SGEI 1SGPI 3R5AA 1SGRI 2JZMA 2YUUA 3B4VC 4WP4A 3SGQI 1HDLA 4L9MA 1TOTA 1WKXA 1W4RA 2B0UC 2OU2A 4UXJA 1IY5A 5HI7A 5EX0A 1Z2IA 4E1RA 1K7UA 1SGQI 2KCXA 2NU2I 1TUSA 3UOEA 1PCEA 3UFFA 1DS3I 3TO7A 1DS2I 2ELIA 1W3SA 2DKVA 1PPFI 2JXDA 2V1CA 2E5RA 2L8EA 1BMOA 2X52A 2SGPI 1OVOA 2P6AC 9WGAA 3RU0A 2ERWA 1FAQA 2KMOA 3TOBA 2ENNA 4JCVE 1FYBA 1N13A 3UEYA 3TOAA 3HH2C 1ULKA 1FY7A 1OMUA 5FUXA 1M8CA 2A20A 1U5KA 2UZ3A 2F3CI 1R79A 1CE3A 3OVOA 2QQEA 5FUWA 3TJQA 2OZUA 3OXGA 3OXFA 1V1IA 2J87A 2ORVA 1CSOI 1CT4I 2PQ8A 1OMTA 2UVOA 2VRWB 1K7VA 3D00A 2ORWA 5JHWC 2NU3I 2LEOA 4HGUA 3UGLA 4E1PA 2V1CC 2SGDI 1KBEA 2B8TA 4GI3C 4A24A 2ROWA 3MEKA 1KMAA 1Q9BA 2DB6A 2L7XA 3E2IA 5E3PA 2E73A 2JA1A 3VE5A 5J8FA 2QQ0A 2N71A 1KBFA 4MPIA 1HPTA 2W0TA 2Y0MA 2CWGA 3TO6A 1TIHA 1HEVA 1XA6A 1WTJA 3QTLD 1XBTA 2M5XA 1TBRR 2JW6A 1CHOI 2CWFA 1MJAA 2KMRA 1R0RI 1Y1BA 2WVJA 3BJIA 2ARPF 3PDNA 3E59A 2WGCA 4DNCA 3UGDA 3FSYA 5CCMA 2GKTI 5E3RA 1LR7A 2ENZA 2J9RA 4AMLA 3FSXA 1UHAA 1V1HA 1SGDI 3VDUA 2GIVA 2N1AB 2SGFI 2SGQI 5FUYA 2N52A 2CWHA 2NU1I 1TBNA 4FKDA 3TO9A 1Y8FA 2OD1A 2BUSA 3R5CA 3UEJA 5HQ8A 4UXIA 3SGBI 1IW4A 1AN1I 1XX6A 2K9HA 2YQPA 2CJSC 1IY6A 1UVFA 2NU0I 1M8BA 1MJBA 2GVIA 1YTPA 1MT1A 1TURA 1RFHA 1S20A
chains in the Genus database with same CATH topology
1P9ZA 9WGAA 4MPIA 2CWGA 1ULNA 1P9GA 1ULKA 2LB7A 2WGCA 4WP4A 7WGAA 4AMLA 2UVOA 1UHAA 1WGTA 1WKXA 1K7VA 1HEVA 1ULMA 2X3TA 1K7TA 1K7UA 1WGCA 2DKVA 1Q9BA 2X52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P9Z A;  9WGA A;  4MPI A;  2CWG A;  1ULN A;  1P9G A;  1ULK A;  2LB7 A;  2WGC A;  4WP4 A;  7WGA A;  4AML A;  2UVO A;  1UHA A;  1WGT A;  1WKX A;  1K7V A;  1HEV A;  1ULM A;  2X3T A;  1K7T A;  1K7U A;  1WGC A;  2DKV A;  1Q9B A;  2X52 A; 
#chains in the Genus database with same CATH topology
 3FC3 A;  2GKR I;  3SEK C;  2LUY A;  1SGE I;  1UVG A;  2RIJ A;  1ULN A;  3UGI A;  3QAH A;  1VDD A;  1P9G A;  2RC4 A;  4OVO A;  3GOX A;  3OL0 A;  1MJ9 A;  2NU4 I;  2LB7 A;  1YU6 C;  2FNF X;  1CGI I;  3R5D A;  2GKV A;  2V53 A;  1Y1C A;  2N17 A;  3KY9 A;  7WGA A;  1X74 A;  2JYY A;  3QWP A;  1UUC A;  1WGT A;  2QQD A;  1SGN I;  1ULM A;  2X3T A;  1K7T A;  1LR8 A;  5J8C A;  1PJU A;  1CT2 I;  1WGC A;  4SGB I;  2KMP A;  1NUB A;  1PTQ A;  4B6D A;  1BUS A;  1FAR A;  1LR9 A;  1SGY I;  1TGS I;  1Z7K B;  2XRC A;  5EX3 A;  3VDP A;  3CXL A;  2QPO A;  2WCY A;  1H0Z A;  2DIP A;  1P9Z A;  3OXL A;  4UXH A;  1X4S A;  2KMQ A;  1CT0 I;  2OVO A;  2QQC A;  1TBO A;  1PTR A;  5DAE A;  1NXU A;  1TBQ R;  5E3Q A;  2ODD A;  1OYV I;  1CGJ I;  3R5B A;  1HJA I;  5CCL A;  5FUV A;  2SGE I;  1SGP I;  3R5A A;  1SGR I;  2JZM A;  2YUU A;  3B4V C;  4WP4 A;  3SGQ I;  1HDL A;  4L9M A;  1TOT A;  1WKX A;  1W4R A;  2B0U C;  2OU2 A;  4UXJ A;  1IY5 A;  5HI7 A;  5EX0 A;  1Z2I A;  4E1R A;  1K7U A;  1SGQ I;  2KCX A;  2NU2 I;  1TUS A;  3UOE A;  1PCE A;  3UFF A;  1DS3 I;  3TO7 A;  1DS2 I;  2ELI A;  1W3S A;  2DKV A;  1PPF I;  2JXD A;  2V1C A;  2E5R A;  2L8E A;  1BMO A;  2X52 A;  2SGP I;  1OVO A;  2P6A C;  9WGA A;  3RU0 A;  2ERW A;  1FAQ A;  2KMO A;  3TOB A;  2ENN A;  4JCV E;  1FYB A;  1N13 A;  3UEY A;  3TOA A;  3HH2 C;  1ULK A;  1FY7 A;  1OMU A;  5FUX A;  1M8C A;  2A20 A;  1U5K A;  2UZ3 A;  2F3C I;  1R79 A;  1CE3 A;  3OVO A;  2QQE A;  5FUW A;  3TJQ A;  2OZU A;  3OXG A;  3OXF A;  1V1I A;  2J87 A;  2ORV A;  1CSO I;  1CT4 I;  2PQ8 A;  1OMT A;  2UVO A;  2VRW B;  1K7V A;  3D00 A;  2ORW A;  5JHW C;  2NU3 I;  2LEO A;  4HGU A;  3UGL A;  4E1P A;  2V1C C;  2SGD I;  1KBE A;  2B8T A;  4GI3 C;  4A24 A;  2ROW A;  3MEK A;  1KMA A;  1Q9B A;  2DB6 A;  2L7X A;  3E2I A;  5E3P A;  2E73 A;  2JA1 A;  3VE5 A;  5J8F A;  2QQ0 A;  2N71 A;  1KBF A;  4MPI A;  1HPT A;  2W0T A;  2Y0M A;  2CWG A;  3TO6 A;  1TIH A;  1HEV A;  1XA6 A;  1WTJ A;  3QTL D;  1XBT A;  2M5X A;  1TBR R;  2JW6 A;  1CHO I;  2CWF A;  1MJA A;  2KMR A;  1R0R I;  1Y1B A;  2WVJ A;  3BJI A;  2ARP F;  3PDN A;  3E59 A;  2WGC A;  4DNC A;  3UGD A;  3FSY A;  5CCM A;  2GKT I;  5E3R A;  1LR7 A;  2ENZ A;  2J9R A;  4AML A;  3FSX A;  1UHA A;  1V1H A;  1SGD I;  3VDU A;  2GIV A;  2N1A B;  2SGF I;  2SGQ I;  5FUY A;  2N52 A;  2CWH A;  2NU1 I;  1TBN A;  4FKD A;  3TO9 A;  1Y8F A;  2OD1 A;  2BUS A;  3R5C A;  3UEJ A;  5HQ8 A;  4UXI A;  3SGB I;  1IW4 A;  1AN1 I;  1XX6 A;  2K9H A;  2YQP A;  2CJS C;  1IY6 A;  1UVF A;  2NU0 I;  1M8B A;  1MJB A;  2GVI A;  1YTP A;  1MT1 A;  1TUR A;  1RFH A;  1S20 A; 
#chains in the Genus database with same CATH homology
 1P9Z A;  9WGA A;  4MPI A;  2CWG A;  1ULN A;  1P9G A;  1ULK A;  2LB7 A;  2WGC A;  4WP4 A;  7WGA A;  4AML A;  2UVO A;  1UHA A;  1WGT A;  1WKX A;  1K7V A;  1HEV A;  1ULM A;  2X3T A;  1K7T A;  1K7U A;  1WGC A;  2DKV A;  1Q9B A;  2X52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...