1KBEA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Kinase Suppressor of Ras
publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
source organism Mus musculus
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbeA00
3KY9A 1R79A 2ENZA 2J9RA 1RFHA 2FNFX 4UXJA 1KBEA 2J87A 3CXLA 2YUUA 4UXIA 3UGLA 2UZ3A 4L9MA 5FUXA 3UGDA 2DB6A 2QPOA 1XX6A 2ORWA 1XA6A 2WVJA 1TBOA 3BJIA 1FAQA 1PTQA 4UXHA 3E2IA 2QQ0A 4FKDA 1W4RA 3UGIA 3UFFA 1PTRA 5FUYA 3UEJA 1TBNA 2B8TA 2QQEA 3UEYA 2JA1A 2ELIA 2GVIA 1FARA 2ORVA 5FUWA 2ROWA 1XBTA 1Y8FA 2E73A 5FUVA 2ENNA 4B6DA 1KBFA 2VRWB
chains in the Genus database with same CATH superfamily
4UXJA 2J9RA 3QAHA 1RFHA 2FNFX 1IW4A 1N13A 2L7XA 1HJAI 2NU1I 2YUUA 4UXIA 1K7VA 5CCMA 1SGDI 3UGDA 2ERWA 2SGEI 3OXLA 2LEOA 2OD1A 1XA6A 2WVJA 2V1CC 2WCYA 1CT2I 1X74A 2K9HA 3BJIA 1OMTA 5J8FA 5HQ8A 1PTQA 2UVOA 3QTLD 2WGCA 1VDDA 1HDLA 3UFFA 4E1RA 1CE3A 1ULNA 2KMQA 1HEVA 1PTRA 3UEJA 2SGPI 1ULKA 4DNCA 1TBNA 1UHAA 1ULMA 2RIJA 1OVOA 2QQDA 5JHWC 3R5BA 1W3SA 3UEYA 1PJUA 2ELIA 1PPFI 2SGQI 2NU2I 5CCLA 1YTPA 1P9ZA 1PCEA 2ODDA 1LR8A 2GKRI 2E73A 2ENNA 4B6DA 2N1AB 3OXGA 2JYYA 1MJBA 2VRWB 1DS3I 1SGRI 2GIVA 1UVGA 2J87A 2LB7A 1FY7A 3CXLA 2UZ3A 2N17A 2SGFI 4GI3C 5FUXA 1DS2I 2QPOA 1FYBA 1WGCA 1Y1BA 2LUYA 1TBOA 2NU4I 2OU2A 1SGNI 3E59A 2L8EA 1S20A 3GOXA 2KMOA 4UXHA 3SGQI 1K7UA 1NXUA 1OMUA 2CWHA 5J8CA 1SGYI 1AN1I 1SGPI 1UVFA 1SGQI 1V1HA 5FUYA 1MJAA 3SEKC 1IY6A 2N52A 2B8TA 2BUSA 1LR9A 2JA1A 1X4SA 1SGEI 3OXFA 3TO6A 2GVIA 3FC3A 2F3CI 1Z2IA 3B4VC 2CWFA 5FUWA 1XBTA 1Y8FA 1M8BA 2XRCA 5FUVA 3VE5A 2A20A 2GKVA 3HH2C 1R79A 3KY9A 1WTJA 1Z7KB 2YQPA 5EX3A 3UGLA 2OZUA 4L9MA 1U5KA 2NU0I 2DB6A 1XX6A 1TBQR 2CJSC 2KCXA 2ORWA 5DAEA 5E3QA 3VDPA 4AMLA 4HGUA 3FSYA 5E3RA 2B0UC 1FAQA 2QQCA 3R5AA 1BMOA 1K7TA 2M5XA 4FKDA 1W4RA 3UGIA 2X3TA 5HI7A 2JW6A 1CGJI 2CWGA 1WKXA 3TO9A 2DKVA 2X52A 1V1IA 1Q9BA 2Y0MA 1UUCA 5EX0A 5E3PA 1TOTA 2PQ8A 1FARA 2SGDI 4E1PA 3D00A 1YU6C 2ROWA 9WGAA 3OL0A 1CT0I 1KBFA 3MEKA 1CGII 2ENZA 3QWPA 1TGSI 4OVOA 3OVOA 3PDNA 1KBEA 2NU3I 1TURA 2GKTI 2KMPA 2V1CA 3TJQA 7WGAA 1H0ZA 1HPTA 2JXDA 2N71A 1BUSA 1P9GA 1M8CA 1MT1A 1R0RI 1TBRR 4MPIA 4SGBI 1OYVI 3E2IA 1MJ9A 2QQ0A 1TUSA 3FSXA 3VDUA 2V53A 3TO7A 2ARPF 2JZMA 2OVOA 1IY5A 1WGTA 1CT4I 3TOAA 2QQEA 3R5DA 3SGBI 1KMAA 1NUBA 1Y1CA 3R5CA 1CHOI 4A24A 2ORVA 4WP4A 3UOEA 1CSOI 4JCVE 2W0TA 2P6AC 3RU0A 1LR7A 2DIPA 3TOBA 2RC4A 1TIHA 2KMRA 2E5RA
chains in the Genus database with same CATH topology
4UXJA 2J9RA 1RFHA 2FNFX 1IW4A 1N13A 2L7XA 1HJAI 2NU1I 2YUUA 4UXIA 5CCMA 1SGDI 3UGDA 2ERWA 2SGEI 3OXLA 2LEOA 2OD1A 1XA6A 2WVJA 2V1CC 2WCYA 1CT2I 1X74A 2K9HA 3BJIA 1OMTA 5HQ8A 1PTQA 3QTLD 1VDDA 1HDLA 3UFFA 4E1RA 1CE3A 2KMQA 1PTRA 3UEJA 2SGPI 1TBNA 1OVOA 2QQDA 5JHWC 1W3SA 3UEYA 1PJUA 2ELIA 1PPFI 2SGQI 2NU2I 5CCLA 1YTPA 1PCEA 2ODDA 1LR8A 2GKRI 2E73A 2ENNA 4B6DA 2N1AB 3OXGA 2JYYA 2VRWB 1DS3I 1SGRI 1UVGA 2J87A 3CXLA 2UZ3A 2N17A 2SGFI 4GI3C 5FUXA 1DS2I 2QPOA 1FYBA 1Y1BA 2LUYA 1TBOA 2NU4I 3E59A 1SGNI 2L8EA 3GOXA 2KMOA 4UXHA 3SGQI 1OMUA 1SGYI 1AN1I 1SGPI 1UVFA 1SGQI 1V1HA 5FUYA 3SEKC 1IY6A 2N52A 2B8TA 2BUSA 1LR9A 2JA1A 1X4SA 1SGEI 3OXFA 2GVIA 3FC3A 2F3CI 3B4VC 5FUWA 1XBTA 1Y8FA 1M8BA 2XRCA 5FUVA 3VE5A 2A20A 2GKVA 3HH2C 1R79A 3KY9A 5EX3A 1Z7KB 2YQPA 3UGLA 4L9MA 1U5KA 2NU0I 2DB6A 1XX6A 1TBQR 2CJSC 2KCXA 2ORWA 5DAEA 3VDPA 4HGUA 2B0UC 1FAQA 2QQCA 1BMOA 2M5XA 4FKDA 1W4RA 3UGIA 5HI7A 2JW6A 1CGJI 1V1IA 5EX0A 1UUCA 1TOTA 1FARA 2SGDI 4E1PA 3D00A 1YU6C 2ROWA 3OL0A 1CT0I 1KBFA 3MEKA 1CGII 2ENZA 3QWPA 1TGSI 4OVOA 3OVOA 3PDNA 1KBEA 2NU3I 1TURA 2GKTI 2KMPA 2V1CA 3TJQA 1H0ZA 1HPTA 2JXDA 2N71A 1BUSA 1M8CA 1MT1A 1R0RI 1TBRR 4SGBI 1OYVI 3E2IA 2QQ0A 1TUSA 3VDUA 2V53A 2ARPF 2JZMA 2OVOA 1IY5A 1CT4I 2QQEA 1KMAA 3SGBI 1NUBA 1Y1CA 1CHOI 4A24A 2ORVA 1CSOI 4JCVE 2W0TA 2P6AC 3RU0A 1LR7A 2DIPA 1TIHA 2KMRA 2E5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KY9 A;  1R79 A;  2ENZ A;  2J9R A;  1RFH A;  2FNF X;  4UXJ A;  1KBE A;  2J87 A;  3CXL A;  2YUU A;  4UXI A;  3UGL A;  2UZ3 A;  4L9M A;  5FUX A;  3UGD A;  2DB6 A;  2QPO A;  1XX6 A;  2ORW A;  1XA6 A;  2WVJ A;  1TBO A;  3BJI A;  1FAQ A;  1PTQ A;  4UXH A;  3E2I A;  2QQ0 A;  4FKD A;  1W4R A;  3UGI A;  3UFF A;  1PTR A;  5FUY A;  3UEJ A;  1TBN A;  2B8T A;  2QQE A;  3UEY A;  2JA1 A;  2ELI A;  2GVI A;  1FAR A;  2ORV A;  5FUW A;  2ROW A;  1XBT A;  1Y8F A;  2E73 A;  5FUV A;  2ENN A;  4B6D A;  1KBF A;  2VRW B; 
#chains in the Genus database with same CATH topology
 4UXJ A;  2J9R A;  3QAH A;  1RFH A;  2FNF X;  1IW4 A;  1N13 A;  2L7X A;  1HJA I;  2NU1 I;  2YUU A;  4UXI A;  1K7V A;  5CCM A;  1SGD I;  3UGD A;  2ERW A;  2SGE I;  3OXL A;  2LEO A;  2OD1 A;  1XA6 A;  2WVJ A;  2V1C C;  2WCY A;  1CT2 I;  1X74 A;  2K9H A;  3BJI A;  1OMT A;  5J8F A;  5HQ8 A;  1PTQ A;  2UVO A;  3QTL D;  2WGC A;  1VDD A;  1HDL A;  3UFF A;  4E1R A;  1CE3 A;  1ULN A;  2KMQ A;  1HEV A;  1PTR A;  3UEJ A;  2SGP I;  1ULK A;  4DNC A;  1TBN A;  1UHA A;  1ULM A;  2RIJ A;  1OVO A;  2QQD A;  5JHW C;  3R5B A;  1W3S A;  3UEY A;  1PJU A;  2ELI A;  1PPF I;  2SGQ I;  2NU2 I;  5CCL A;  1YTP A;  1P9Z A;  1PCE A;  2ODD A;  1LR8 A;  2GKR I;  2E73 A;  2ENN A;  4B6D A;  2N1A B;  3OXG A;  2JYY A;  1MJB A;  2VRW B;  1DS3 I;  1SGR I;  2GIV A;  1UVG A;  2J87 A;  2LB7 A;  1FY7 A;  3CXL A;  2UZ3 A;  2N17 A;  2SGF I;  4GI3 C;  5FUX A;  1DS2 I;  2QPO A;  1FYB A;  1WGC A;  1Y1B A;  2LUY A;  1TBO A;  2NU4 I;  2OU2 A;  1SGN I;  3E59 A;  2L8E A;  1S20 A;  3GOX A;  2KMO A;  4UXH A;  3SGQ I;  1K7U A;  1NXU A;  1OMU A;  2CWH A;  5J8C A;  1SGY I;  1AN1 I;  1SGP I;  1UVF A;  1SGQ I;  1V1H A;  5FUY A;  1MJA A;  3SEK C;  1IY6 A;  2N52 A;  2B8T A;  2BUS A;  1LR9 A;  2JA1 A;  1X4S A;  1SGE I;  3OXF A;  3TO6 A;  2GVI A;  3FC3 A;  2F3C I;  1Z2I A;  3B4V C;  2CWF A;  5FUW A;  1XBT A;  1Y8F A;  1M8B A;  2XRC A;  5FUV A;  3VE5 A;  2A20 A;  2GKV A;  3HH2 C;  1R79 A;  3KY9 A;  1WTJ A;  1Z7K B;  2YQP A;  5EX3 A;  3UGL A;  2OZU A;  4L9M A;  1U5K A;  2NU0 I;  2DB6 A;  1XX6 A;  1TBQ R;  2CJS C;  2KCX A;  2ORW A;  5DAE A;  5E3Q A;  3VDP A;  4AML A;  4HGU A;  3FSY A;  5E3R A;  2B0U C;  1FAQ A;  2QQC A;  3R5A A;  1BMO A;  1K7T A;  2M5X A;  4FKD A;  1W4R A;  3UGI A;  2X3T A;  5HI7 A;  2JW6 A;  1CGJ I;  2CWG A;  1WKX A;  3TO9 A;  2DKV A;  2X52 A;  1V1I A;  1Q9B A;  2Y0M A;  1UUC A;  5EX0 A;  5E3P A;  1TOT A;  2PQ8 A;  1FAR A;  2SGD I;  4E1P A;  3D00 A;  1YU6 C;  2ROW A;  9WGA A;  3OL0 A;  1CT0 I;  1KBF A;  3MEK A;  1CGI I;  2ENZ A;  3QWP A;  1TGS I;  4OVO A;  3OVO A;  3PDN A;  1KBE A;  2NU3 I;  1TUR A;  2GKT I;  2KMP A;  2V1C A;  3TJQ A;  7WGA A;  1H0Z A;  1HPT A;  2JXD A;  2N71 A;  1BUS A;  1P9G A;  1M8C A;  1MT1 A;  1R0R I;  1TBR R;  4MPI A;  4SGB I;  1OYV I;  3E2I A;  1MJ9 A;  2QQ0 A;  1TUS A;  3FSX A;  3VDU A;  2V53 A;  3TO7 A;  2ARP F;  2JZM A;  2OVO A;  1IY5 A;  1WGT A;  1CT4 I;  3TOA A;  2QQE A;  3R5D A;  3SGB I;  1KMA A;  1NUB A;  1Y1C A;  3R5C A;  1CHO I;  4A24 A;  2ORV A;  4WP4 A;  3UOE A;  1CSO I;  4JCV E;  2W0T A;  2P6A C;  3RU0 A;  1LR7 A;  2DIP A;  3TOB A;  2RC4 A;  1TIH A;  2KMR A;  2E5R A; 
#chains in the Genus database with same CATH homology
 4UXJ A;  2J9R A;  1RFH A;  2FNF X;  1IW4 A;  1N13 A;  2L7X A;  1HJA I;  2NU1 I;  2YUU A;  4UXI A;  5CCM A;  1SGD I;  3UGD A;  2ERW A;  2SGE I;  3OXL A;  2LEO A;  2OD1 A;  1XA6 A;  2WVJ A;  2V1C C;  2WCY A;  1CT2 I;  1X74 A;  2K9H A;  3BJI A;  1OMT A;  5HQ8 A;  1PTQ A;  3QTL D;  1VDD A;  1HDL A;  3UFF A;  4E1R A;  1CE3 A;  2KMQ A;  1PTR A;  3UEJ A;  2SGP I;  1TBN A;  1OVO A;  2QQD A;  5JHW C;  1W3S A;  3UEY A;  1PJU A;  2ELI A;  1PPF I;  2SGQ I;  2NU2 I;  5CCL A;  1YTP A;  1PCE A;  2ODD A;  1LR8 A;  2GKR I;  2E73 A;  2ENN A;  4B6D A;  2N1A B;  3OXG A;  2JYY A;  2VRW B;  1DS3 I;  1SGR I;  1UVG A;  2J87 A;  3CXL A;  2UZ3 A;  2N17 A;  2SGF I;  4GI3 C;  5FUX A;  1DS2 I;  2QPO A;  1FYB A;  1Y1B A;  2LUY A;  1TBO A;  2NU4 I;  3E59 A;  1SGN I;  2L8E A;  3GOX A;  2KMO A;  4UXH A;  3SGQ I;  1OMU A;  1SGY I;  1AN1 I;  1SGP I;  1UVF A;  1SGQ I;  1V1H A;  5FUY A;  3SEK C;  1IY6 A;  2N52 A;  2B8T A;  2BUS A;  1LR9 A;  2JA1 A;  1X4S A;  1SGE I;  3OXF A;  2GVI A;  3FC3 A;  2F3C I;  3B4V C;  5FUW A;  1XBT A;  1Y8F A;  1M8B A;  2XRC A;  5FUV A;  3VE5 A;  2A20 A;  2GKV A;  3HH2 C;  1R79 A;  3KY9 A;  5EX3 A;  1Z7K B;  2YQP A;  3UGL A;  4L9M A;  1U5K A;  2NU0 I;  2DB6 A;  1XX6 A;  1TBQ R;  2CJS C;  2KCX A;  2ORW A;  5DAE A;  3VDP A;  4HGU A;  2B0U C;  1FAQ A;  2QQC A;  1BMO A;  2M5X A;  4FKD A;  1W4R A;  3UGI A;  5HI7 A;  2JW6 A;  1CGJ I;  1V1I A;  5EX0 A;  1UUC A;  1TOT A;  1FAR A;  2SGD I;  4E1P A;  3D00 A;  1YU6 C;  2ROW A;  3OL0 A;  1CT0 I;  1KBF A;  3MEK A;  1CGI I;  2ENZ A;  3QWP A;  1TGS I;  4OVO A;  3OVO A;  3PDN A;  1KBE A;  2NU3 I;  1TUR A;  2GKT I;  2KMP A;  2V1C A;  3TJQ A;  1H0Z A;  1HPT A;  2JXD A;  2N71 A;  1BUS A;  1M8C A;  1MT1 A;  1R0R I;  1TBR R;  4SGB I;  1OYV I;  3E2I A;  2QQ0 A;  1TUS A;  3VDU A;  2V53 A;  2ARP F;  2JZM A;  2OVO A;  1IY5 A;  1CT4 I;  2QQE A;  1KMA A;  3SGB I;  1NUB A;  1Y1C A;  1CHO I;  4A24 A;  2ORV A;  1CSO I;  4JCV E;  2W0T A;  2P6A C;  3RU0 A;  1LR7 A;  2DIP A;  1TIH A;  2KMR A;  2E5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...