1KBEA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinase Suppressor of Ras
publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbeA00
3UFFA 1PTRA 2UZ3A 4B6DA 1R79A 2WVJA 1KBEA 1PTQA 2B8TA 2DB6A 4UXHA 1XA6A 3UGDA 3KY9A 2QPOA 2ORWA 1FAQA 2ROWA 5FUWA 5FUVA 2QQ0A 1KBFA 2YUUA 1XX6A 1XBTA 2FNFX 2QQEA 1RFHA 2E73A 4FKDA 2J87A 2GVIA 2J9RA 3UGLA 1FARA 1TBOA 3E2IA 3BJIA 1TBNA 4L9MA 2VRWB 5FUXA 3UEJA 1W4RA 5FUYA 2ORVA 4UXJA 1Y8FA 2ENZA 2JA1A 3CXLA 3UEYA 4UXIA 3UGIA 2ELIA 2ENNA
chains in the Genus database with same CATH superfamily
1Q9BA 2OVOA 2NU1I 1CSOI 2BUSA 1K7VA 3OXGA 1OMUA 2ODDA 2NU3I 1W3SA 1Z2IA 1NXUA 1LR8A 3QAHA 4UXHA 1P9ZA 1TOTA 1NUBA 1OMTA 3UGDA 3KY9A 1CT0I 2L7XA 2KMQA 4JCVE 3FC3A 2LUYA 1IY6A 1WTJA 1XX6A 3OL0A 3TO6A 2KCXA 5EX0A 1SGNI 4OVOA 1OYVI 1SGDI 1PJUA 2GVIA 3RU0A 3UOEA 1IW4A 5EX3A 1SGEI 1LR9A 1UVGA 4MPIA 3UEJA 1AN1I 1W4RA 1WGCA 2ORVA 1M8CA 2Y0MA 4UXJA 2GKVA 1Y8FA 1WKXA 1ULNA 2WGCA 2JZMA 3HH2C 2N71A 4E1RA 1TGSI 2WVJA 1UUCA 2CWHA 1K7TA 1PTRA 2K9HA 2UVOA 2UZ3A 2W0TA 2KMOA 3TO7A 4B6DA 2OU2A 1TIHA 1TBQR 2RIJA 2CWGA 3FSYA 1K7UA 1TURA 1ULMA 9WGAA 2YQPA 1FYBA 1H0ZA 1KMAA 2GIVA 1BMOA 1OVOA 3R5AA 2M5XA 1HEVA 2PQ8A 2ROWA 3MEKA 2QQ0A 2E5RA 2P6AC 2KMPA 2YUUA 2FNFX 3QWPA 1RFHA 1SGYI 4FKDA 3TOBA 1MT1A 5CCLA 1S20A 5E3QA 2JW6A 2WCYA 1FARA 4SGBI 2OD1A 4WP4A 2N17A 2DKVA 2VRWB 1SGPI 1Y1CA 2QQDA 5FUYA 2ERWA 7WGAA 1UVFA 1V1HA 2ENZA 3UEYA 3UGIA 1HPTA 1CGJI 2NU2I 3FSXA 2SGQI 1UHAA 3OXFA 1SGRI 2V1CC 1R79A 1KBEA 1MJ9A 3SGQI 1DS2I 3VDPA 1CT4I 1MJBA 2V1CA 2L8EA 3B4VC 5E3PA 1SGQI 3R5DA 1FAQA 4A24A 1KBFA 4GI3C 1N13A 2N52A 2RC4A 1CE3A 1Y1BA 2QQEA 3VE5A 1HJAI 2E73A 2NU0I 2X52A 1R0RI 2NU4I 1BUSA 2F3CI 2V53A 1TBNA 5FUXA 1YTPA 2N1AB 1PPFI 1VDDA 3PDNA 1X74A 2OZUA 5HQ8A 2QQCA 2ARPF 2XRCA 4HGUA 1FY7A 1MJAA 4UXIA 2JXDA 5HI7A 3E59A 1TUSA 1X4SA 2ENNA 1U5KA 2LB7A 3R5CA 3SGBI 3UFFA 1CHOI 2JYYA 2SGFI 3VDUA 1IY5A 1PTQA 2B8TA 2DB6A 2B0UC 2SGDI 5JHWC 2LEOA 2SGPI 1CT2I 3QTLD 1HDLA 1CGII 1XA6A 2QPOA 2X3TA 2ORWA 3OVOA 3SEKC 3TO9A 1YU6C 5FUWA 5FUVA 5J8CA 2DIPA 2GKTI 4E1PA 1V1IA 2A20A 1XBTA 3R5BA 1LR7A 1TBRR 1PCEA 2J87A 3D00A 2J9RA 3TOAA 3UGLA 2KMRA 1TBOA 1Z7KB 3E2IA 1ULKA 1P9GA 3BJIA 5J8FA 4L9MA 2SGEI 5CCMA 1WGTA 3TJQA 4AMLA 2CWFA 2JA1A 3CXLA 2GKRI 3GOXA 1M8BA 2CJSC 2ELIA 4DNCA 1DS3I 5DAEA 3OXLA 5E3RA
chains in the Genus database with same CATH topology
2OVOA 2NU1I 1CSOI 2BUSA 3OXGA 1OMUA 2ODDA 2NU3I 1W3SA 1LR8A 4UXHA 1TOTA 1NUBA 1OMTA 3UGDA 3KY9A 1CT0I 2L7XA 2KMQA 4JCVE 3FC3A 2LUYA 1IY6A 1XX6A 3OL0A 2KCXA 5EX0A 1SGNI 4OVOA 1OYVI 1SGDI 1PJUA 2GVIA 3RU0A 1IW4A 5EX3A 1SGEI 1LR9A 1UVGA 3UEJA 1AN1I 1W4RA 2ORVA 1M8CA 4UXJA 2GKVA 1Y8FA 2JZMA 3HH2C 2N71A 4E1RA 1TGSI 2WVJA 1UUCA 1PTRA 2K9HA 2UZ3A 2W0TA 4B6DA 2KMOA 1TIHA 1TBQR 1FYBA 1TURA 1KMAA 2YQPA 1H0ZA 1BMOA 1OVOA 2M5XA 2ROWA 3MEKA 2QQ0A 2E5RA 2P6AC 2KMPA 2YUUA 2FNFX 3QWPA 1RFHA 1SGYI 4FKDA 5CCLA 1MT1A 2JW6A 2WCYA 1FARA 4SGBI 2OD1A 2N17A 2VRWB 1SGPI 1Y1CA 2QQDA 5FUYA 2ERWA 1UVFA 1V1HA 2ENZA 3UEYA 3UGIA 1HPTA 1CGJI 2NU2I 2SGQI 3OXFA 1SGRI 2V1CC 1R79A 1KBEA 3SGQI 1DS2I 3VDPA 1CT4I 2V1CA 2L8EA 3B4VC 1SGQI 1FAQA 4A24A 1KBFA 4GI3C 1N13A 2N52A 1CE3A 1Y1BA 2QQEA 3VE5A 1HJAI 2E73A 2NU0I 1R0RI 2NU4I 1BUSA 2F3CI 2V53A 1TBNA 5FUXA 1YTPA 2N1AB 1PPFI 1VDDA 3PDNA 1X74A 5HQ8A 2QQCA 2ARPF 2XRCA 4HGUA 4UXIA 5HI7A 2JXDA 3E59A 1TUSA 1X4SA 2ENNA 1U5KA 3SGBI 3UFFA 1CHOI 2JYYA 2SGFI 3VDUA 1IY5A 1PTQA 2B8TA 2DB6A 2B0UC 2SGDI 5JHWC 2LEOA 2SGPI 1CT2I 3QTLD 1HDLA 1CGII 1XA6A 2QPOA 2ORWA 3OVOA 3SEKC 1YU6C 5FUWA 5FUVA 2DIPA 2GKTI 4E1PA 1V1IA 2A20A 1XBTA 1LR7A 1TBRR 1PCEA 2J87A 3D00A 2J9RA 3UGLA 2KMRA 1TBOA 1Z7KB 3E2IA 3BJIA 4L9MA 2SGEI 5CCMA 3TJQA 2JA1A 3CXLA 2GKRI 3GOXA 1M8BA 2CJSC 2ELIA 1DS3I 5DAEA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFF A;  1PTR A;  2UZ3 A;  4B6D A;  1R79 A;  2WVJ A;  1KBE A;  1PTQ A;  2B8T A;  2DB6 A;  4UXH A;  1XA6 A;  3UGD A;  3KY9 A;  2QPO A;  2ORW A;  1FAQ A;  2ROW A;  5FUW A;  5FUV A;  2QQ0 A;  1KBF A;  2YUU A;  1XX6 A;  1XBT A;  2FNF X;  2QQE A;  1RFH A;  2E73 A;  4FKD A;  2J87 A;  2GVI A;  2J9R A;  3UGL A;  1FAR A;  1TBO A;  3E2I A;  3BJI A;  1TBN A;  4L9M A;  2VRW B;  5FUX A;  3UEJ A;  1W4R A;  5FUY A;  2ORV A;  4UXJ A;  1Y8F A;  2ENZ A;  2JA1 A;  3CXL A;  3UEY A;  4UXI A;  3UGI A;  2ELI A;  2ENN A; 
#chains in the Genus database with same CATH topology
 1Q9B A;  2OVO A;  2NU1 I;  1CSO I;  2BUS A;  1K7V A;  3OXG A;  1OMU A;  2ODD A;  2NU3 I;  1W3S A;  1Z2I A;  1NXU A;  1LR8 A;  3QAH A;  4UXH A;  1P9Z A;  1TOT A;  1NUB A;  1OMT A;  3UGD A;  3KY9 A;  1CT0 I;  2L7X A;  2KMQ A;  4JCV E;  3FC3 A;  2LUY A;  1IY6 A;  1WTJ A;  1XX6 A;  3OL0 A;  3TO6 A;  2KCX A;  5EX0 A;  1SGN I;  4OVO A;  1OYV I;  1SGD I;  1PJU A;  2GVI A;  3RU0 A;  3UOE A;  1IW4 A;  5EX3 A;  1SGE I;  1LR9 A;  1UVG A;  4MPI A;  3UEJ A;  1AN1 I;  1W4R A;  1WGC A;  2ORV A;  1M8C A;  2Y0M A;  4UXJ A;  2GKV A;  1Y8F A;  1WKX A;  1ULN A;  2WGC A;  2JZM A;  3HH2 C;  2N71 A;  4E1R A;  1TGS I;  2WVJ A;  1UUC A;  2CWH A;  1K7T A;  1PTR A;  2K9H A;  2UVO A;  2UZ3 A;  2W0T A;  2KMO A;  3TO7 A;  4B6D A;  2OU2 A;  1TIH A;  1TBQ R;  2RIJ A;  2CWG A;  3FSY A;  1K7U A;  1TUR A;  1ULM A;  9WGA A;  2YQP A;  1FYB A;  1H0Z A;  1KMA A;  2GIV A;  1BMO A;  1OVO A;  3R5A A;  2M5X A;  1HEV A;  2PQ8 A;  2ROW A;  3MEK A;  2QQ0 A;  2E5R A;  2P6A C;  2KMP A;  2YUU A;  2FNF X;  3QWP A;  1RFH A;  1SGY I;  4FKD A;  3TOB A;  1MT1 A;  5CCL A;  1S20 A;  5E3Q A;  2JW6 A;  2WCY A;  1FAR A;  4SGB I;  2OD1 A;  4WP4 A;  2N17 A;  2DKV A;  2VRW B;  1SGP I;  1Y1C A;  2QQD A;  5FUY A;  2ERW A;  7WGA A;  1UVF A;  1V1H A;  2ENZ A;  3UEY A;  3UGI A;  1HPT A;  1CGJ I;  2NU2 I;  3FSX A;  2SGQ I;  1UHA A;  3OXF A;  1SGR I;  2V1C C;  1R79 A;  1KBE A;  1MJ9 A;  3SGQ I;  1DS2 I;  3VDP A;  1CT4 I;  1MJB A;  2V1C A;  2L8E A;  3B4V C;  5E3P A;  1SGQ I;  3R5D A;  1FAQ A;  4A24 A;  1KBF A;  4GI3 C;  1N13 A;  2N52 A;  2RC4 A;  1CE3 A;  1Y1B A;  2QQE A;  3VE5 A;  1HJA I;  2E73 A;  2NU0 I;  2X52 A;  1R0R I;  2NU4 I;  1BUS A;  2F3C I;  2V53 A;  1TBN A;  5FUX A;  1YTP A;  2N1A B;  1PPF I;  1VDD A;  3PDN A;  1X74 A;  2OZU A;  5HQ8 A;  2QQC A;  2ARP F;  2XRC A;  4HGU A;  1FY7 A;  1MJA A;  4UXI A;  2JXD A;  5HI7 A;  3E59 A;  1TUS A;  1X4S A;  2ENN A;  1U5K A;  2LB7 A;  3R5C A;  3SGB I;  3UFF A;  1CHO I;  2JYY A;  2SGF I;  3VDU A;  1IY5 A;  1PTQ A;  2B8T A;  2DB6 A;  2B0U C;  2SGD I;  5JHW C;  2LEO A;  2SGP I;  1CT2 I;  3QTL D;  1HDL A;  1CGI I;  1XA6 A;  2QPO A;  2X3T A;  2ORW A;  3OVO A;  3SEK C;  3TO9 A;  1YU6 C;  5FUW A;  5FUV A;  5J8C A;  2DIP A;  2GKT I;  4E1P A;  1V1I A;  2A20 A;  1XBT A;  3R5B A;  1LR7 A;  1TBR R;  1PCE A;  2J87 A;  3D00 A;  2J9R A;  3TOA A;  3UGL A;  2KMR A;  1TBO A;  1Z7K B;  3E2I A;  1ULK A;  1P9G A;  3BJI A;  5J8F A;  4L9M A;  2SGE I;  5CCM A;  1WGT A;  3TJQ A;  4AML A;  2CWF A;  2JA1 A;  3CXL A;  2GKR I;  3GOX A;  1M8B A;  2CJS C;  2ELI A;  4DNC A;  1DS3 I;  5DAE A;  3OXL A;  5E3R A; 
#chains in the Genus database with same CATH homology
 2OVO A;  2NU1 I;  1CSO I;  2BUS A;  3OXG A;  1OMU A;  2ODD A;  2NU3 I;  1W3S A;  1LR8 A;  4UXH A;  1TOT A;  1NUB A;  1OMT A;  3UGD A;  3KY9 A;  1CT0 I;  2L7X A;  2KMQ A;  4JCV E;  3FC3 A;  2LUY A;  1IY6 A;  1XX6 A;  3OL0 A;  2KCX A;  5EX0 A;  1SGN I;  4OVO A;  1OYV I;  1SGD I;  1PJU A;  2GVI A;  3RU0 A;  1IW4 A;  5EX3 A;  1SGE I;  1LR9 A;  1UVG A;  3UEJ A;  1AN1 I;  1W4R A;  2ORV A;  1M8C A;  4UXJ A;  2GKV A;  1Y8F A;  2JZM A;  3HH2 C;  2N71 A;  4E1R A;  1TGS I;  2WVJ A;  1UUC A;  1PTR A;  2K9H A;  2UZ3 A;  2W0T A;  4B6D A;  2KMO A;  1TIH A;  1TBQ R;  1FYB A;  1TUR A;  1KMA A;  2YQP A;  1H0Z A;  1BMO A;  1OVO A;  2M5X A;  2ROW A;  3MEK A;  2QQ0 A;  2E5R A;  2P6A C;  2KMP A;  2YUU A;  2FNF X;  3QWP A;  1RFH A;  1SGY I;  4FKD A;  5CCL A;  1MT1 A;  2JW6 A;  2WCY A;  1FAR A;  4SGB I;  2OD1 A;  2N17 A;  2VRW B;  1SGP I;  1Y1C A;  2QQD A;  5FUY A;  2ERW A;  1UVF A;  1V1H A;  2ENZ A;  3UEY A;  3UGI A;  1HPT A;  1CGJ I;  2NU2 I;  2SGQ I;  3OXF A;  1SGR I;  2V1C C;  1R79 A;  1KBE A;  3SGQ I;  1DS2 I;  3VDP A;  1CT4 I;  2V1C A;  2L8E A;  3B4V C;  1SGQ I;  1FAQ A;  4A24 A;  1KBF A;  4GI3 C;  1N13 A;  2N52 A;  1CE3 A;  1Y1B A;  2QQE A;  3VE5 A;  1HJA I;  2E73 A;  2NU0 I;  1R0R I;  2NU4 I;  1BUS A;  2F3C I;  2V53 A;  1TBN A;  5FUX A;  1YTP A;  2N1A B;  1PPF I;  1VDD A;  3PDN A;  1X74 A;  5HQ8 A;  2QQC A;  2ARP F;  2XRC A;  4HGU A;  4UXI A;  5HI7 A;  2JXD A;  3E59 A;  1TUS A;  1X4S A;  2ENN A;  1U5K A;  3SGB I;  3UFF A;  1CHO I;  2JYY A;  2SGF I;  3VDU A;  1IY5 A;  1PTQ A;  2B8T A;  2DB6 A;  2B0U C;  2SGD I;  5JHW C;  2LEO A;  2SGP I;  1CT2 I;  3QTL D;  1HDL A;  1CGI I;  1XA6 A;  2QPO A;  2ORW A;  3OVO A;  3SEK C;  1YU6 C;  5FUW A;  5FUV A;  2DIP A;  2GKT I;  4E1P A;  1V1I A;  2A20 A;  1XBT A;  1LR7 A;  1TBR R;  1PCE A;  2J87 A;  3D00 A;  2J9R A;  3UGL A;  2KMR A;  1TBO A;  1Z7K B;  3E2I A;  3BJI A;  4L9M A;  2SGE I;  5CCM A;  3TJQ A;  2JA1 A;  3CXL A;  2GKR I;  3GOX A;  1M8B A;  2CJS C;  2ELI A;  1DS3 I;  5DAE A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...