1KBEA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinase Suppressor of Ras
publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbeA00
1TBNA 5FUWA 2ORWA 3UGLA 2QQEA 5FUVA 1R79A 2UZ3A 2YUUA 4UXIA 4FKDA 1XBTA 1Y8FA 1RFHA 2GVIA 2WVJA 3UEYA 2DB6A 1PTQA 2JA1A 2ELIA 2J87A 3UFFA 2QQ0A 3E2IA 1KBFA 2ENZA 2VRWB 1XA6A 1TBOA 1XX6A 2J9RA 2ORVA 2QPOA 3UGDA 1FAQA 2ROWA 2ENNA 4UXHA 3CXLA 4UXJA 3KY9A 1KBEA 2B8TA 1FARA 3BJIA 4B6DA 4L9MA 3UGIA 1PTRA 3UEJA 5FUXA 1W4RA 2E73A 2FNFX 5FUYA
chains in the Genus database with same CATH superfamily
2V1CC 1TBNA 5FUWA 1PJUA 5FUVA 1R79A 1WTJA 1BUSA 2UZ3A 1OVOA 1X74A 1NUBA 1V1IA 1P9GA 1Y8FA 2GIVA 2V53A 2CWFA 1RFHA 2GVIA 2X3TA 4HGUA 1LR7A 1M8BA 2LUYA 1K7UA 5EX0A 1TGSI 2JA1A 1Z7KB 2N17A 1N13A 1K7TA 1MJBA 1HPTA 1HJAI 3E2IA 2WCYA 2SGPI 3TO6A 2VRWB 2CWHA 2J9RA 2LEOA 3OXFA 1TURA 3SGQI 4OVOA 2KMRA 1SGYI 1TIHA 2ODDA 2OVOA 1MT1A 3CXLA 4UXJA 1KBEA 2B8TA 1FARA 2QQCA 3B4VC 3BJIA 1LR8A 4JCVE 4L9MA 3TOBA 3UGIA 2E73A 1OMUA 1CHOI 2JW6A 1MJAA 1ULMA 3GOXA 4GI3C 5JHWC 3D00A 2KMOA 4UXIA 2F3CI 1MJ9A 2L7XA 2SGFI 3RU0A 1CT2I 2NU2I 3VE5A 2PQ8A 7WGAA 2ELIA 3UFFA 2QQ0A 1WKXA 2CWGA 2OD1A 3TJQA 1PPFI 2NU3I 3SGBI 3OVOA 3TOAA 5CCMA 1KBFA 2V1CA 1XX6A 1TBOA 2BUSA 2KCXA 3FSYA 1W3SA 1TBRR 2GKTI 3UGDA 1OYVI 1IY5A 2ENNA 1Y1BA 1OMTA 1CSOI 1DS2I 2RC4A 2N1AB 3TO9A 1CGII 2GKRI 1IY6A 1TUSA 1W4RA 2J87A 1SGQI 1V1HA 5FUYA 2ORWA 5HQ8A 3UGLA 5HI7A 1PCEA 2N71A 3HH2C 3OXGA 3SEKC 3PDNA 3R5AA 1TBQR 2QQDA 2YUUA 1ULKA 4FKDA 1U5KA 2SGEI 1CT4I 1R0RI 2B0UC 2WVJA 3UEYA 3FC3A 1H0ZA 3R5CA 5J8FA 1BMOA 2L8EA 1UVFA 1M8CA 2ARPF 1DS3I 1S20A 1SGRI 2NU4I 1P9ZA 3QTLD 1FY7A 1SGNI 2E5RA 2KMQA 2ORVA 1K7VA 2QPOA 1SGDI 2Y0MA 2ROWA 4E1RA 1FAQA 3UOEA 4UXHA 1YU6C 9WGAA 1KMAA 3KY9A 1UHAA 2M5XA 1PTRA 2GKVA 5FUXA 3QWPA 3VDUA 1YTPA 4AMLA 3OXLA 2XRCA 1FYBA 1CE3A 2QQEA 2JXDA 2YQPA 1TOTA 2JYYA 2N52A 1NXUA 2DIPA 5J8CA 2NU1I 1HDLA 1CGJI 2A20A 2SGQI 1VDDA 1CT0I 2WGCA 4WP4A 1XBTA 1Y1CA 2W0TA 3R5BA 5E3PA 5EX3A 3MEKA 1SGPI 2CJSC 2DB6A 2OZUA 1PTQA 1X4SA 5DAEA 5E3QA 4MPIA 3R5DA 1WGCA 1LR9A 2ERWA 2K9HA 4E1PA 2RIJA 3FSXA 3VDPA 1AN1I 2NU0I 4DNCA 2ENZA 1XA6A 1Q9BA 2KMPA 2P6AC 4SGBI 1UVGA 3QAHA 3TO7A 5E3RA 2LB7A 1UUCA 1IW4A 1ULNA 3OL0A 4B6DA 1HEVA 2OU2A 1WGTA 1Z2IA 5CCLA 3UEJA 4A24A 2DKVA 2X52A 3E59A 2JZMA 2FNFX 2SGDI 2UVOA 1SGEI
chains in the Genus database with same CATH topology
2V1CC 1TBNA 5FUWA 1PJUA 5FUVA 1R79A 1BUSA 2UZ3A 1OVOA 1X74A 1NUBA 1V1IA 1Y8FA 2V53A 1RFHA 2GVIA 4HGUA 1LR7A 1M8BA 2LUYA 5EX0A 1TGSI 2JA1A 1Z7KB 2N17A 1N13A 1HPTA 1HJAI 3E2IA 2WCYA 2SGPI 2VRWB 2J9RA 2LEOA 3OXFA 1TURA 3SGQI 4OVOA 2KMRA 1SGYI 1TIHA 2ODDA 2OVOA 1MT1A 3CXLA 4UXJA 1KBEA 2B8TA 1FARA 2QQCA 3B4VC 3BJIA 1LR8A 4JCVE 4L9MA 3UGIA 2E73A 1OMUA 1CHOI 2JW6A 3GOXA 4GI3C 5JHWC 3D00A 2KMOA 4UXIA 2F3CI 2SGFI 2L7XA 3RU0A 1CT2I 2NU2I 3VE5A 2ELIA 3UFFA 2QQ0A 2OD1A 3TJQA 1PPFI 2NU3I 3SGBI 3OVOA 5CCMA 1KBFA 2V1CA 1XX6A 1TBOA 2BUSA 2KCXA 3UGDA 1W3SA 1TBRR 2GKTI 1OYVI 1IY5A 2ENNA 1Y1BA 1OMTA 1CSOI 1DS2I 2N1AB 1CGII 2GKRI 1IY6A 1TUSA 1W4RA 2J87A 1SGQI 1V1HA 5FUYA 2ORWA 5HQ8A 3UGLA 5HI7A 1PCEA 2N71A 3HH2C 3OXGA 3SEKC 3PDNA 1TBQR 2QQDA 2YUUA 4FKDA 1U5KA 2SGEI 1CT4I 1R0RI 2B0UC 2WVJA 3UEYA 3FC3A 1H0ZA 1BMOA 2L8EA 1UVFA 1M8CA 2ARPF 1DS3I 1SGRI 2NU4I 3QTLD 1SGNI 2ORVA 2E5RA 2KMQA 2QPOA 3OL0A 4E1RA 1SGDI 1FAQA 2ROWA 4UXHA 1YU6C 1KMAA 3KY9A 2M5XA 1PTRA 2GKVA 5FUXA 3QWPA 3VDUA 1YTPA 3OXLA 2XRCA 1FYBA 1CE3A 2QQEA 2JXDA 2YQPA 1TOTA 2JYYA 2N52A 2DIPA 2NU1I 1HDLA 1CGJI 2A20A 2SGQI 1VDDA 1CT0I 1XBTA 1Y1CA 2W0TA 5EX3A 3MEKA 1SGPI 2CJSC 2DB6A 1PTQA 1X4SA 5DAEA 1LR9A 2ERWA 2K9HA 4E1PA 3VDPA 1AN1I 2NU0I 2ENZA 1XA6A 2KMPA 2P6AC 4SGBI 1UVGA 1IW4A 1UUCA 4B6DA 5CCLA 3UEJA 4A24A 3E59A 2JZMA 2FNFX 2SGDI 1SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBN A;  5FUW A;  2ORW A;  3UGL A;  2QQE A;  5FUV A;  1R79 A;  2UZ3 A;  2YUU A;  4UXI A;  4FKD A;  1XBT A;  1Y8F A;  1RFH A;  2GVI A;  2WVJ A;  3UEY A;  2DB6 A;  1PTQ A;  2JA1 A;  2ELI A;  2J87 A;  3UFF A;  2QQ0 A;  3E2I A;  1KBF A;  2ENZ A;  2VRW B;  1XA6 A;  1TBO A;  1XX6 A;  2J9R A;  2ORV A;  2QPO A;  3UGD A;  1FAQ A;  2ROW A;  2ENN A;  4UXH A;  3CXL A;  4UXJ A;  3KY9 A;  1KBE A;  2B8T A;  1FAR A;  3BJI A;  4B6D A;  4L9M A;  3UGI A;  1PTR A;  3UEJ A;  5FUX A;  1W4R A;  2E73 A;  2FNF X;  5FUY A; 
#chains in the Genus database with same CATH topology
 2V1C C;  1TBN A;  5FUW A;  1PJU A;  5FUV A;  1R79 A;  1WTJ A;  1BUS A;  2UZ3 A;  1OVO A;  1X74 A;  1NUB A;  1V1I A;  1P9G A;  1Y8F A;  2GIV A;  2V53 A;  2CWF A;  1RFH A;  2GVI A;  2X3T A;  4HGU A;  1LR7 A;  1M8B A;  2LUY A;  1K7U A;  5EX0 A;  1TGS I;  2JA1 A;  1Z7K B;  2N17 A;  1N13 A;  1K7T A;  1MJB A;  1HPT A;  1HJA I;  3E2I A;  2WCY A;  2SGP I;  3TO6 A;  2VRW B;  2CWH A;  2J9R A;  2LEO A;  3OXF A;  1TUR A;  3SGQ I;  4OVO A;  2KMR A;  1SGY I;  1TIH A;  2ODD A;  2OVO A;  1MT1 A;  3CXL A;  4UXJ A;  1KBE A;  2B8T A;  1FAR A;  2QQC A;  3B4V C;  3BJI A;  1LR8 A;  4JCV E;  4L9M A;  3TOB A;  3UGI A;  2E73 A;  1OMU A;  1CHO I;  2JW6 A;  1MJA A;  1ULM A;  3GOX A;  4GI3 C;  5JHW C;  3D00 A;  2KMO A;  4UXI A;  2F3C I;  1MJ9 A;  2L7X A;  2SGF I;  3RU0 A;  1CT2 I;  2NU2 I;  3VE5 A;  2PQ8 A;  7WGA A;  2ELI A;  3UFF A;  2QQ0 A;  1WKX A;  2CWG A;  2OD1 A;  3TJQ A;  1PPF I;  2NU3 I;  3SGB I;  3OVO A;  3TOA A;  5CCM A;  1KBF A;  2V1C A;  1XX6 A;  1TBO A;  2BUS A;  2KCX A;  3FSY A;  1W3S A;  1TBR R;  2GKT I;  3UGD A;  1OYV I;  1IY5 A;  2ENN A;  1Y1B A;  1OMT A;  1CSO I;  1DS2 I;  2RC4 A;  2N1A B;  3TO9 A;  1CGI I;  2GKR I;  1IY6 A;  1TUS A;  1W4R A;  2J87 A;  1SGQ I;  1V1H A;  5FUY A;  2ORW A;  5HQ8 A;  3UGL A;  5HI7 A;  1PCE A;  2N71 A;  3HH2 C;  3OXG A;  3SEK C;  3PDN A;  3R5A A;  1TBQ R;  2QQD A;  2YUU A;  1ULK A;  4FKD A;  1U5K A;  2SGE I;  1CT4 I;  1R0R I;  2B0U C;  2WVJ A;  3UEY A;  3FC3 A;  1H0Z A;  3R5C A;  5J8F A;  1BMO A;  2L8E A;  1UVF A;  1M8C A;  2ARP F;  1DS3 I;  1S20 A;  1SGR I;  2NU4 I;  1P9Z A;  3QTL D;  1FY7 A;  1SGN I;  2E5R A;  2KMQ A;  2ORV A;  1K7V A;  2QPO A;  1SGD I;  2Y0M A;  2ROW A;  4E1R A;  1FAQ A;  3UOE A;  4UXH A;  1YU6 C;  9WGA A;  1KMA A;  3KY9 A;  1UHA A;  2M5X A;  1PTR A;  2GKV A;  5FUX A;  3QWP A;  3VDU A;  1YTP A;  4AML A;  3OXL A;  2XRC A;  1FYB A;  1CE3 A;  2QQE A;  2JXD A;  2YQP A;  1TOT A;  2JYY A;  2N52 A;  1NXU A;  2DIP A;  5J8C A;  2NU1 I;  1HDL A;  1CGJ I;  2A20 A;  2SGQ I;  1VDD A;  1CT0 I;  2WGC A;  4WP4 A;  1XBT A;  1Y1C A;  2W0T A;  3R5B A;  5E3P A;  5EX3 A;  3MEK A;  1SGP I;  2CJS C;  2DB6 A;  2OZU A;  1PTQ A;  1X4S A;  5DAE A;  5E3Q A;  4MPI A;  3R5D A;  1WGC A;  1LR9 A;  2ERW A;  2K9H A;  4E1P A;  2RIJ A;  3FSX A;  3VDP A;  1AN1 I;  2NU0 I;  4DNC A;  2ENZ A;  1XA6 A;  1Q9B A;  2KMP A;  2P6A C;  4SGB I;  1UVG A;  3QAH A;  3TO7 A;  5E3R A;  2LB7 A;  1UUC A;  1IW4 A;  1ULN A;  3OL0 A;  4B6D A;  1HEV A;  2OU2 A;  1WGT A;  1Z2I A;  5CCL A;  3UEJ A;  4A24 A;  2DKV A;  2X52 A;  3E59 A;  2JZM A;  2FNF X;  2SGD I;  2UVO A;  1SGE I; 
#chains in the Genus database with same CATH homology
 2V1C C;  1TBN A;  5FUW A;  1PJU A;  5FUV A;  1R79 A;  1BUS A;  2UZ3 A;  1OVO A;  1X74 A;  1NUB A;  1V1I A;  1Y8F A;  2V53 A;  1RFH A;  2GVI A;  4HGU A;  1LR7 A;  1M8B A;  2LUY A;  5EX0 A;  1TGS I;  2JA1 A;  1Z7K B;  2N17 A;  1N13 A;  1HPT A;  1HJA I;  3E2I A;  2WCY A;  2SGP I;  2VRW B;  2J9R A;  2LEO A;  3OXF A;  1TUR A;  3SGQ I;  4OVO A;  2KMR A;  1SGY I;  1TIH A;  2ODD A;  2OVO A;  1MT1 A;  3CXL A;  4UXJ A;  1KBE A;  2B8T A;  1FAR A;  2QQC A;  3B4V C;  3BJI A;  1LR8 A;  4JCV E;  4L9M A;  3UGI A;  2E73 A;  1OMU A;  1CHO I;  2JW6 A;  3GOX A;  4GI3 C;  5JHW C;  3D00 A;  2KMO A;  4UXI A;  2F3C I;  2SGF I;  2L7X A;  3RU0 A;  1CT2 I;  2NU2 I;  3VE5 A;  2ELI A;  3UFF A;  2QQ0 A;  2OD1 A;  3TJQ A;  1PPF I;  2NU3 I;  3SGB I;  3OVO A;  5CCM A;  1KBF A;  2V1C A;  1XX6 A;  1TBO A;  2BUS A;  2KCX A;  3UGD A;  1W3S A;  1TBR R;  2GKT I;  1OYV I;  1IY5 A;  2ENN A;  1Y1B A;  1OMT A;  1CSO I;  1DS2 I;  2N1A B;  1CGI I;  2GKR I;  1IY6 A;  1TUS A;  1W4R A;  2J87 A;  1SGQ I;  1V1H A;  5FUY A;  2ORW A;  5HQ8 A;  3UGL A;  5HI7 A;  1PCE A;  2N71 A;  3HH2 C;  3OXG A;  3SEK C;  3PDN A;  1TBQ R;  2QQD A;  2YUU A;  4FKD A;  1U5K A;  2SGE I;  1CT4 I;  1R0R I;  2B0U C;  2WVJ A;  3UEY A;  3FC3 A;  1H0Z A;  1BMO A;  2L8E A;  1UVF A;  1M8C A;  2ARP F;  1DS3 I;  1SGR I;  2NU4 I;  3QTL D;  1SGN I;  2ORV A;  2E5R A;  2KMQ A;  2QPO A;  3OL0 A;  4E1R A;  1SGD I;  1FAQ A;  2ROW A;  4UXH A;  1YU6 C;  1KMA A;  3KY9 A;  2M5X A;  1PTR A;  2GKV A;  5FUX A;  3QWP A;  3VDU A;  1YTP A;  3OXL A;  2XRC A;  1FYB A;  1CE3 A;  2QQE A;  2JXD A;  2YQP A;  1TOT A;  2JYY A;  2N52 A;  2DIP A;  2NU1 I;  1HDL A;  1CGJ I;  2A20 A;  2SGQ I;  1VDD A;  1CT0 I;  1XBT A;  1Y1C A;  2W0T A;  5EX3 A;  3MEK A;  1SGP I;  2CJS C;  2DB6 A;  1PTQ A;  1X4S A;  5DAE A;  1LR9 A;  2ERW A;  2K9H A;  4E1P A;  3VDP A;  1AN1 I;  2NU0 I;  2ENZ A;  1XA6 A;  2KMP A;  2P6A C;  4SGB I;  1UVG A;  1IW4 A;  1UUC A;  4B6D A;  5CCL A;  3UEJ A;  4A24 A;  3E59 A;  2JZM A;  2FNF X;  2SGD I;  1SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...