1UUCA

Solution structure of a chimeric lekti-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
KNEDQEMCHEFQAFMKNGKLFCPQDKKPIQSLDGIMFINKCATCKMILEKEAKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE INHIBITOR KAZAL-TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine proteinase inhibitor
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uucA00
1Y1BA 2SGDI 1HPTA 1LR7A 1CGJI 2F3CI 1IW4A 2NU2I 1HDLA 2KMPA 1CT0I 1M8CA 1TGSI 2JXDA 1CSOI 1TURA 2SGPI 3HH2C 2P6AC 1OVOA 1OMTA 1FYBA 1SGQI 2NU3I 2KMQA 1N13A 2LEOA 2N17A 2SGFI 2BUSA 1TIHA 5DAEA 3TJQA 2V53A 1PJUA 2SGQI 2GKRI 1HJAI 2ARPF 2QQCA 2XRCA 4OVOA 1SGNI 2ERWA 1CHOI 1PCEA 1CT2I 3OVOA 3SGQI 1IY6A 1YTPA 2N52A 1SGYI 2OVOA 1BUSA 4GI3C 1YU6C 1LR9A 1Y1CA 1PPFI 2NU4I 5JHWC 2B0UC 2JZMA 2WCYA 3QTLD 1OYVI 3SGBI 1OMUA 1TUSA 1M8BA 2GKVA 2KCXA 1R0RI 2JYYA 1MT1A 4SGBI 1CE3A 1DS2I 1CGII 3SEKC 2QQDA 1CT4I 1UVFA 1TBRR 1H0ZA 1UUCA 2SGEI 1SGRI 1SGEI 1IY5A 1KMAA 3B4VC 1SGDI 2NU1I 1SGPI 2KMOA 1NUBA 2NU0I 2KMRA 1DS3I 2N71A 4HGUA 1LR8A 1TBQR 1UVGA 1BMOA 1Z7KB 2GKTI 2M5XA 1AN1I
chains in the Genus database with same CATH superfamily
1Y1BA 3OL0A 1PTRA 2LB7A 1HPTA 2SGDI 3UFFA 2FNFX 1LR7A 1CGJI 2F3CI 1Q9BA 1IW4A 2J87A 2NU2I 2Y0MA 4AMLA 2N1AB 1HDLA 2KMPA 1CT0I 1M8CA 1KBFA 2WVJA 1K7VA 3UEJA 1TGSI 2JXDA 3R5BA 1CSOI 1TURA 4MPIA 2SGPI 3HH2C 1P9ZA 2P6AC 1OVOA 1OMTA 1FYBA 1SGQI 2CWHA 2KMQA 2NU3I 1XX6A 4E1RA 2DB6A 4UXHA 1N13A 2JW6A 2LEOA 2N17A 3UGLA 2SGFI 2A20A 2BUSA 3PDNA 1XA6A 1TIHA 2L8EA 1ULMA 1ULNA 2JA1A 2YQPA 5DAEA 1PTQA 3TJQA 1W4RA 2RC4A 2V53A 3TO7A 1PJUA 3R5CA 2SGQI 2OD1A 1R79A 2OU2A 2GKRI 1HJAI 2ARPF 2QQ0A 1FARA 5J8CA 2QQCA 2UVOA 2XRCA 5HI7A 3BJIA 3OXLA 1V1HA 1XBTA 2ODDA 2ENZA 2ELIA 3R5DA 4OVOA 5FUVA 4E1PA 1SGNI 2ERWA 1CHOI 1P9GA 1PCEA 3UEYA 3E59A 1CT2I 4DNCA 3R5AA 9WGAA 5FUYA 5E3RA 1WGCA 5FUWA 5EX0A 3FC3A 1UHAA 5E3PA 1NXUA 1TBOA 2ENNA 2RIJA 3OVOA 2QPOA 5E3QA 2PQ8A 4JCVE 3SGQI 1IY6A 3TOAA 1YTPA 1U5KA 2GIVA 2N52A 2DIPA 2V1CC 3TOBA 1SGYI 3KY9A 2OVOA 1BUSA 2E5RA 4FKDA 3QAHA 4GI3C 4L9MA 1YU6C 3GOXA 3FSYA 2GVIA 1LR9A 3E2IA 3FSXA 1Y1CA 3VE5A 4WP4A 1PPFI 2NU4I 2ORVA 2WGCA 1S20A 2L7XA 4A24A 2CWFA 5JHWC 2B0UC 2JZMA 2ORWA 2WCYA 2J9RA 3QTLD 1OYVI 2YUUA 5FUXA 5CCMA 1RFHA 1HEVA 1MJBA 3SGBI 1WKXA 2W0TA 1OMUA 1TUSA 1TOTA 2ROWA 1VDDA 1Y8FA 3QWPA 1M8BA 2X3TA 2E73A 3UGIA 3MEKA 3D00A 1TBNA 2GKVA 3UOEA 2KCXA 2CJSC 2VRWB 5EX3A 1MJAA 3OXGA 2UZ3A 3CXLA 1R0RI 2JYYA 1MT1A 2V1CA 4SGBI 4UXIA 1CE3A 2B8TA 1DS2I 1W3SA 1CGII 3RU0A 1FY7A 3VDUA 3SEKC 5J8FA 1FAQA 3TO6A 2QQDA 1X4SA 2LUYA 1CT4I 1K7TA 1UVFA 2CWGA 2K9HA 1TBRR 1H0ZA 2OZUA 2QQEA 4UXJA 1UUCA 5HQ8A 2DKVA 1SGRI 2SGEI 1WGTA 1SGEI 3UGDA 5CCLA 1V1IA 1IY5A 3B4VC 1KMAA 1Z2IA 4B6DA 1SGDI 2NU1I 1SGPI 1K7UA 1ULKA 1WTJA 2KMOA 1NUBA 2NU0I 2KMRA 1DS3I 2N71A 4HGUA 1LR8A 3TO9A 7WGAA 1TBQR 1MJ9A 1UVGA 1BMOA 1X74A 1Z7KB 2GKTI 1KBEA 3VDPA 2X52A 2M5XA 1AN1I 3OXFA
chains in the Genus database with same CATH topology
1Y1BA 3OL0A 1PTRA 2SGDI 1HPTA 3UFFA 2FNFX 1LR7A 1CGJI 2F3CI 1IW4A 2J87A 2NU2I 2N1AB 1HDLA 2KMPA 1CT0I 1M8CA 1KBFA 2WVJA 3UEJA 1TGSI 2JXDA 1CSOI 1TURA 2SGPI 3HH2C 2P6AC 1OVOA 1OMTA 1FYBA 1SGQI 2NU3I 2KMQA 1XX6A 4E1RA 2DB6A 4UXHA 1N13A 2JW6A 2LEOA 2N17A 3UGLA 2SGFI 2A20A 2BUSA 3PDNA 1XA6A 1TIHA 2L8EA 2YQPA 5DAEA 2JA1A 1PTQA 3TJQA 1W4RA 2V53A 1PJUA 2SGQI 2OD1A 1R79A 2GKRI 1HJAI 2ARPF 2QQ0A 1FARA 2QQCA 2XRCA 5HI7A 3BJIA 3OXLA 1V1HA 1XBTA 2ODDA 2ENZA 2ELIA 4OVOA 5FUVA 4E1PA 1SGNI 2ERWA 1CHOI 1PCEA 3UEYA 3E59A 1CT2I 5FUYA 5FUWA 5EX0A 3FC3A 1TBOA 2ENNA 3OVOA 2QPOA 4JCVE 3SGQI 1IY6A 1YTPA 1U5KA 2N52A 2V1CC 2DIPA 1SGYI 3KY9A 2OVOA 1BUSA 2E5RA 4FKDA 4GI3C 3GOXA 4L9MA 1YU6C 2GVIA 1LR9A 3E2IA 3VE5A 1Y1CA 1PPFI 2NU4I 2ORVA 2L7XA 4A24A 5JHWC 2B0UC 2JZMA 2ORWA 2WCYA 2J9RA 3QTLD 1OYVI 2YUUA 5FUXA 5CCMA 1RFHA 3SGBI 2W0TA 3QWPA 1OMUA 1TUSA 1TOTA 2ROWA 1VDDA 1Y8FA 1M8BA 2E73A 3UGIA 3MEKA 3D00A 1TBNA 2GKVA 2KCXA 2CJSC 2VRWB 5EX3A 3OXGA 2UZ3A 3CXLA 1R0RI 2JYYA 1MT1A 2V1CA 4SGBI 4UXIA 1CE3A 2B8TA 1DS2I 1W3SA 1CGII 3RU0A 3VDUA 3SEKC 1FAQA 2QQDA 1X4SA 2LUYA 1CT4I 1UVFA 2K9HA 1TBRR 1H0ZA 2QQEA 4UXJA 1UUCA 5HQ8A 2SGEI 1SGRI 3UGDA 1SGEI 5CCLA 1IY5A 1V1IA 1KMAA 3B4VC 4B6DA 1SGDI 2NU1I 1SGPI 2KMOA 1NUBA 2NU0I 2KMRA 1DS3I 2N71A 4HGUA 1LR8A 1TBQR 1UVGA 1BMOA 1X74A 1Z7KB 2GKTI 1KBEA 3VDPA 2M5XA 1AN1I 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1B A;  2SGD I;  1HPT A;  1LR7 A;  1CGJ I;  2F3C I;  1IW4 A;  2NU2 I;  1HDL A;  2KMP A;  1CT0 I;  1M8C A;  1TGS I;  2JXD A;  1CSO I;  1TUR A;  2SGP I;  3HH2 C;  2P6A C;  1OVO A;  1OMT A;  1FYB A;  1SGQ I;  2NU3 I;  2KMQ A;  1N13 A;  2LEO A;  2N17 A;  2SGF I;  2BUS A;  1TIH A;  5DAE A;  3TJQ A;  2V53 A;  1PJU A;  2SGQ I;  2GKR I;  1HJA I;  2ARP F;  2QQC A;  2XRC A;  4OVO A;  1SGN I;  2ERW A;  1CHO I;  1PCE A;  1CT2 I;  3OVO A;  3SGQ I;  1IY6 A;  1YTP A;  2N52 A;  1SGY I;  2OVO A;  1BUS A;  4GI3 C;  1YU6 C;  1LR9 A;  1Y1C A;  1PPF I;  2NU4 I;  5JHW C;  2B0U C;  2JZM A;  2WCY A;  3QTL D;  1OYV I;  3SGB I;  1OMU A;  1TUS A;  1M8B A;  2GKV A;  2KCX A;  1R0R I;  2JYY A;  1MT1 A;  4SGB I;  1CE3 A;  1DS2 I;  1CGI I;  3SEK C;  2QQD A;  1CT4 I;  1UVF A;  1TBR R;  1H0Z A;  1UUC A;  2SGE I;  1SGR I;  1SGE I;  1IY5 A;  1KMA A;  3B4V C;  1SGD I;  2NU1 I;  1SGP I;  2KMO A;  1NUB A;  2NU0 I;  2KMR A;  1DS3 I;  2N71 A;  4HGU A;  1LR8 A;  1TBQ R;  1UVG A;  1BMO A;  1Z7K B;  2GKT I;  2M5X A;  1AN1 I; 
#chains in the Genus database with same CATH topology
 1Y1B A;  3OL0 A;  1PTR A;  2LB7 A;  1HPT A;  2SGD I;  3UFF A;  2FNF X;  1LR7 A;  1CGJ I;  2F3C I;  1Q9B A;  1IW4 A;  2J87 A;  2NU2 I;  2Y0M A;  4AML A;  2N1A B;  1HDL A;  2KMP A;  1CT0 I;  1M8C A;  1KBF A;  2WVJ A;  1K7V A;  3UEJ A;  1TGS I;  2JXD A;  3R5B A;  1CSO I;  1TUR A;  4MPI A;  2SGP I;  3HH2 C;  1P9Z A;  2P6A C;  1OVO A;  1OMT A;  1FYB A;  1SGQ I;  2CWH A;  2KMQ A;  2NU3 I;  1XX6 A;  4E1R A;  2DB6 A;  4UXH A;  1N13 A;  2JW6 A;  2LEO A;  2N17 A;  3UGL A;  2SGF I;  2A20 A;  2BUS A;  3PDN A;  1XA6 A;  1TIH A;  2L8E A;  1ULM A;  1ULN A;  2JA1 A;  2YQP A;  5DAE A;  1PTQ A;  3TJQ A;  1W4R A;  2RC4 A;  2V53 A;  3TO7 A;  1PJU A;  3R5C A;  2SGQ I;  2OD1 A;  1R79 A;  2OU2 A;  2GKR I;  1HJA I;  2ARP F;  2QQ0 A;  1FAR A;  5J8C A;  2QQC A;  2UVO A;  2XRC A;  5HI7 A;  3BJI A;  3OXL A;  1V1H A;  1XBT A;  2ODD A;  2ENZ A;  2ELI A;  3R5D A;  4OVO A;  5FUV A;  4E1P A;  1SGN I;  2ERW A;  1CHO I;  1P9G A;  1PCE A;  3UEY A;  3E59 A;  1CT2 I;  4DNC A;  3R5A A;  9WGA A;  5FUY A;  5E3R A;  1WGC A;  5FUW A;  5EX0 A;  3FC3 A;  1UHA A;  5E3P A;  1NXU A;  1TBO A;  2ENN A;  2RIJ A;  3OVO A;  2QPO A;  5E3Q A;  2PQ8 A;  4JCV E;  3SGQ I;  1IY6 A;  3TOA A;  1YTP A;  1U5K A;  2GIV A;  2N52 A;  2DIP A;  2V1C C;  3TOB A;  1SGY I;  3KY9 A;  2OVO A;  1BUS A;  2E5R A;  4FKD A;  3QAH A;  4GI3 C;  4L9M A;  1YU6 C;  3GOX A;  3FSY A;  2GVI A;  1LR9 A;  3E2I A;  3FSX A;  1Y1C A;  3VE5 A;  4WP4 A;  1PPF I;  2NU4 I;  2ORV A;  2WGC A;  1S20 A;  2L7X A;  4A24 A;  2CWF A;  5JHW C;  2B0U C;  2JZM A;  2ORW A;  2WCY A;  2J9R A;  3QTL D;  1OYV I;  2YUU A;  5FUX A;  5CCM A;  1RFH A;  1HEV A;  1MJB A;  3SGB I;  1WKX A;  2W0T A;  1OMU A;  1TUS A;  1TOT A;  2ROW A;  1VDD A;  1Y8F A;  3QWP A;  1M8B A;  2X3T A;  2E73 A;  3UGI A;  3MEK A;  3D00 A;  1TBN A;  2GKV A;  3UOE A;  2KCX A;  2CJS C;  2VRW B;  5EX3 A;  1MJA A;  3OXG A;  2UZ3 A;  3CXL A;  1R0R I;  2JYY A;  1MT1 A;  2V1C A;  4SGB I;  4UXI A;  1CE3 A;  2B8T A;  1DS2 I;  1W3S A;  1CGI I;  3RU0 A;  1FY7 A;  3VDU A;  3SEK C;  5J8F A;  1FAQ A;  3TO6 A;  2QQD A;  1X4S A;  2LUY A;  1CT4 I;  1K7T A;  1UVF A;  2CWG A;  2K9H A;  1TBR R;  1H0Z A;  2OZU A;  2QQE A;  4UXJ A;  1UUC A;  5HQ8 A;  2DKV A;  1SGR I;  2SGE I;  1WGT A;  1SGE I;  3UGD A;  5CCL A;  1V1I A;  1IY5 A;  3B4V C;  1KMA A;  1Z2I A;  4B6D A;  1SGD I;  2NU1 I;  1SGP I;  1K7U A;  1ULK A;  1WTJ A;  2KMO A;  1NUB A;  2NU0 I;  2KMR A;  1DS3 I;  2N71 A;  4HGU A;  1LR8 A;  3TO9 A;  7WGA A;  1TBQ R;  1MJ9 A;  1UVG A;  1BMO A;  1X74 A;  1Z7K B;  2GKT I;  1KBE A;  3VDP A;  2X52 A;  2M5X A;  1AN1 I;  3OXF A; 
#chains in the Genus database with same CATH homology
 1Y1B A;  3OL0 A;  1PTR A;  2SGD I;  1HPT A;  3UFF A;  2FNF X;  1LR7 A;  1CGJ I;  2F3C I;  1IW4 A;  2J87 A;  2NU2 I;  2N1A B;  1HDL A;  2KMP A;  1CT0 I;  1M8C A;  1KBF A;  2WVJ A;  3UEJ A;  1TGS I;  2JXD A;  1CSO I;  1TUR A;  2SGP I;  3HH2 C;  2P6A C;  1OVO A;  1OMT A;  1FYB A;  1SGQ I;  2NU3 I;  2KMQ A;  1XX6 A;  4E1R A;  2DB6 A;  4UXH A;  1N13 A;  2JW6 A;  2LEO A;  2N17 A;  3UGL A;  2SGF I;  2A20 A;  2BUS A;  3PDN A;  1XA6 A;  1TIH A;  2L8E A;  2YQP A;  5DAE A;  2JA1 A;  1PTQ A;  3TJQ A;  1W4R A;  2V53 A;  1PJU A;  2SGQ I;  2OD1 A;  1R79 A;  2GKR I;  1HJA I;  2ARP F;  2QQ0 A;  1FAR A;  2QQC A;  2XRC A;  5HI7 A;  3BJI A;  3OXL A;  1V1H A;  1XBT A;  2ODD A;  2ENZ A;  2ELI A;  4OVO A;  5FUV A;  4E1P A;  1SGN I;  2ERW A;  1CHO I;  1PCE A;  3UEY A;  3E59 A;  1CT2 I;  5FUY A;  5FUW A;  5EX0 A;  3FC3 A;  1TBO A;  2ENN A;  3OVO A;  2QPO A;  4JCV E;  3SGQ I;  1IY6 A;  1YTP A;  1U5K A;  2N52 A;  2V1C C;  2DIP A;  1SGY I;  3KY9 A;  2OVO A;  1BUS A;  2E5R A;  4FKD A;  4GI3 C;  3GOX A;  4L9M A;  1YU6 C;  2GVI A;  1LR9 A;  3E2I A;  3VE5 A;  1Y1C A;  1PPF I;  2NU4 I;  2ORV A;  2L7X A;  4A24 A;  5JHW C;  2B0U C;  2JZM A;  2ORW A;  2WCY A;  2J9R A;  3QTL D;  1OYV I;  2YUU A;  5FUX A;  5CCM A;  1RFH A;  3SGB I;  2W0T A;  3QWP A;  1OMU A;  1TUS A;  1TOT A;  2ROW A;  1VDD A;  1Y8F A;  1M8B A;  2E73 A;  3UGI A;  3MEK A;  3D00 A;  1TBN A;  2GKV A;  2KCX A;  2CJS C;  2VRW B;  5EX3 A;  3OXG A;  2UZ3 A;  3CXL A;  1R0R I;  2JYY A;  1MT1 A;  2V1C A;  4SGB I;  4UXI A;  1CE3 A;  2B8T A;  1DS2 I;  1W3S A;  1CGI I;  3RU0 A;  3VDU A;  3SEK C;  1FAQ A;  2QQD A;  1X4S A;  2LUY A;  1CT4 I;  1UVF A;  2K9H A;  1TBR R;  1H0Z A;  2QQE A;  4UXJ A;  1UUC A;  5HQ8 A;  2SGE I;  1SGR I;  3UGD A;  1SGE I;  5CCL A;  1IY5 A;  1V1I A;  1KMA A;  3B4V C;  4B6D A;  1SGD I;  2NU1 I;  1SGP I;  2KMO A;  1NUB A;  2NU0 I;  2KMR A;  1DS3 I;  2N71 A;  4HGU A;  1LR8 A;  1TBQ R;  1UVG A;  1BMO A;  1X74 A;  1Z7K B;  2GKT I;  1KBE A;  3VDP A;  2M5X A;  1AN1 I;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...