1UUCA

Solution structure of a chimeric lekti-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
KNEDQEMCHEFQAFMKNGKLFCPQDKKPIQSLDGIMFINKCATCKMILEKEAKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE INHIBITOR KAZAL-TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine proteinase inhibitor
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uucA00
1PCEA 1SGQI 2NU0I 2N71A 1CGJI 3SGQI 1R0RI 2BUSA 1FYBA 2KMPA 2SGFI 2N52A 2GKRI 2M5XA 1M8CA 1OVOA 5JHWC 1PJUA 2F3CI 1OYVI 2NU1I 3HH2C 3SEKC 3SGBI 1CE3A 1TURA 1OMUA 1TBRR 3QTLD 1M8BA 2WCYA 1HDLA 1CSOI 2SGEI 1SGDI 1CGII 2JYYA 1TIHA 1LR7A 2QQDA 1CT4I 1BMOA 2SGPI 2KMOA 2P6AC 2OVOA 1CHOI 2ERWA 1DS3I 1UUCA 2KCXA 1SGYI 1BUSA 2GKTI 2V53A 1AN1I 1DS2I 2ARPF 1YU6C 1SGEI 1Y1CA 2NU4I 1LR8A 1IW4A 1Z7KB 1SGRI 2GKVA 2XRCA 2NU2I 1MT1A 1N13A 2KMRA 4OVOA 3TJQA 1NUBA 4SGBI 2SGDI 4HGUA 4GI3C 2JZMA 2KMQA 1OMTA 2JXDA 2LEOA 1YTPA 2SGQI 1H0ZA 1UVGA 1HJAI 2QQCA 1SGNI 2NU3I 1KMAA 1LR9A 5DAEA 1IY5A 1UVFA 1PPFI 1TBQR 1Y1BA 3B4VC 1IY6A 3OVOA 2N17A 1SGPI 1TGSI 1CT2I 2B0UC 1CT0I 1TUSA 1HPTA
chains in the Genus database with same CATH superfamily
1FY7A 1ULNA 2JW6A 2ROWA 2X52A 5EX0A 3R5BA 3TOAA 1PCEA 1SGQI 2NU0I 3KY9A 2N71A 1CGJI 3SGQI 1W3SA 3VE5A 1R0RI 2BUSA 1PTRA 2QPOA 1FYBA 2PQ8A 2KMPA 2ODDA 2DB6A 1K7TA 2SGFI 2N52A 3VDPA 3TO9A 2GKRI 2M5XA 5J8CA 2DIPA 2L8EA 1M8CA 1OVOA 2VRWB 3MEKA 5JHWC 4B6DA 2J9RA 1PJUA 2CWFA 1UHAA 2F3CI 1OYVI 2NU1I 3BJIA 3HH2C 3R5CA 4UXHA 3SEKC 3SGBI 1CE3A 2L7XA 1TURA 1MJ9A 1OMUA 1KBEA 1MJBA 3TO7A 1Y8FA 2FNFX 1TBRR 3QTLD 1M8BA 2WCYA 2ENNA 1HDLA 4WP4A 3RU0A 1CSOI 1V1HA 2ENZA 3GOXA 1VDDA 2J87A 2SGEI 2YUUA 1SGDI 1R79A 2CWGA 4UXJA 4E1PA 1CGII 1ULKA 1NXUA 2WVJA 3D00A 2JYYA 3QWPA 3UGLA 3R5AA 1TIHA 1LR7A 2E73A 3PDNA 5FUYA 3VDUA 1HEVA 2LUYA 7WGAA 2QQDA 2X3TA 1CT4I 3UGDA 1BMOA 2JA1A 2SGPI 1U5KA 2KMOA 5FUXA 2YQPA 1P9GA 5HI7A 1TUSA 2RIJA 2P6AC 1S20A 4FKDA 3FC3A 4AMLA 2OVOA 1CHOI 2ERWA 2V1CC 1DS3I 3R5DA 1FAQA 2B8TA 1WKXA 1UUCA 2KCXA 1TOTA 2V1CA 1WTJA 5HQ8A 2N1AB 1SGYI 1X74A 2ORVA 2DKVA 2Y0MA 4DNCA 1BUSA 2GKTI 2A20A 2V53A 1MJAA 2CWHA 3TOBA 1TBOA 2QQ0A 3E2IA 1AN1I 1DS2I 4E1RA 2ARPF 1YU6C 3UOEA 1V1IA 1Z2IA 1SGEI 1Q9BA 1Y1CA 3OL0A 2NU4I 1LR8A 9WGAA 1IW4A 1Z7KB 1TBNA 1SGRI 1XA6A 2OU2A 1X4SA 3OXFA 3FSYA 2GKVA 4MPIA 1XX6A 2XRCA 2NU2I 1MT1A 1N13A 3CXLA 3TO6A 2KMRA 1RFHA 4OVOA 5E3RA 2OD1A 2OZUA 5E3PA 3TJQA 2ORWA 1NUBA 4SGBI 1ULMA 2UVOA 2SGDI 4HGUA 3UFFA 2K9HA 4GI3C 3UEYA 2JZMA 3E59A 2W0TA 2GIVA 2KMQA 1KBFA 1OMTA 5EX3A 1FARA 5CCLA 2JXDA 2LEOA 2LB7A 2ELIA 1YTPA 2SGQI 4L9MA 3UEJA 1H0ZA 5FUWA 1UVGA 1HJAI 2CJSC 3OXLA 5FUVA 2QQCA 1SGNI 2NU3I 1W4RA 3OXGA 1PTQA 5J8FA 1KMAA 1LR9A 2RC4A 2UZ3A 4JCVE 5DAEA 4UXIA 1IY5A 1WGCA 1UVFA 1PPFI 1WGTA 2WGCA 2GVIA 1TBQR 1Y1BA 2QQEA 3B4VC 5E3QA 1IY6A 3FSXA 3OVOA 2N17A 1SGPI 1TGSI 1CT2I 2B0UC 2E5RA 3QAHA 4A24A 5CCMA 1CT0I 1K7UA 1P9ZA 1K7VA 3UGIA 1XBTA 1HPTA
chains in the Genus database with same CATH topology
2ROWA 2JW6A 5EX0A 1PCEA 1SGQI 2NU0I 3KY9A 2N71A 1CGJI 3SGQI 1W3SA 3VE5A 1R0RI 2BUSA 1PTRA 2QPOA 1FYBA 2KMPA 2ODDA 2DB6A 2SGFI 2N52A 3VDPA 2GKRI 2M5XA 2DIPA 2L8EA 1M8CA 1OVOA 2VRWB 3MEKA 5JHWC 4B6DA 2J9RA 1PJUA 2F3CI 1OYVI 2NU1I 3BJIA 3HH2C 4UXHA 3SEKC 3SGBI 1CE3A 2L7XA 1TURA 1OMUA 1KBEA 1Y8FA 2FNFX 1TBRR 3QTLD 1M8BA 2WCYA 2ENNA 1HDLA 3RU0A 1CSOI 1V1HA 2ENZA 3GOXA 1VDDA 2J87A 2SGEI 2YUUA 1SGDI 1R79A 4UXJA 4E1PA 1CGII 2WVJA 3D00A 2JYYA 3QWPA 3UGLA 1TIHA 1LR7A 2E73A 3PDNA 5FUYA 3VDUA 2LUYA 2QQDA 1CT4I 3UGDA 1BMOA 2JA1A 2SGPI 1U5KA 2KMOA 5FUXA 2YQPA 5HI7A 4FKDA 2P6AC 3FC3A 2OVOA 1CHOI 2ERWA 2V1CC 1DS3I 1FAQA 2B8TA 2V1CA 1UUCA 2KCXA 1TOTA 5HQ8A 2N1AB 1SGYI 1X74A 2ORVA 1BUSA 2GKTI 2A20A 2V53A 1TBOA 2QQ0A 3E2IA 1AN1I 1DS2I 4E1RA 2ARPF 1YU6C 1V1IA 1SGEI 1Y1CA 3OL0A 2NU4I 1LR8A 1IW4A 1Z7KB 1TBNA 1SGRI 1XA6A 1X4SA 3OXFA 2GKVA 1XX6A 2XRCA 2NU2I 1MT1A 1N13A 3CXLA 2KMRA 1RFHA 4OVOA 2OD1A 3TJQA 2ORWA 1NUBA 4SGBI 2SGDI 4HGUA 3UFFA 2K9HA 4GI3C 3UEYA 2JZMA 3E59A 2W0TA 2KMQA 1KBFA 1OMTA 5EX3A 1FARA 5CCLA 2JXDA 2LEOA 2ELIA 1YTPA 2SGQI 4L9MA 3UEJA 1H0ZA 5FUWA 1UVGA 1HJAI 2CJSC 3OXLA 5FUVA 2QQCA 1SGNI 2NU3I 1W4RA 3OXGA 1PTQA 1KMAA 1LR9A 2UZ3A 4JCVE 5DAEA 4UXIA 1IY5A 1UVFA 1PPFI 2GVIA 1TBQR 1Y1BA 2QQEA 3B4VC 1IY6A 3OVOA 2N17A 1SGPI 1TGSI 1CT2I 2B0UC 2E5RA 4A24A 5CCMA 1CT0I 3UGIA 1TUSA 1XBTA 1HPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCE A;  1SGQ I;  2NU0 I;  2N71 A;  1CGJ I;  3SGQ I;  1R0R I;  2BUS A;  1FYB A;  2KMP A;  2SGF I;  2N52 A;  2GKR I;  2M5X A;  1M8C A;  1OVO A;  5JHW C;  1PJU A;  2F3C I;  1OYV I;  2NU1 I;  3HH2 C;  3SEK C;  3SGB I;  1CE3 A;  1TUR A;  1OMU A;  1TBR R;  3QTL D;  1M8B A;  2WCY A;  1HDL A;  1CSO I;  2SGE I;  1SGD I;  1CGI I;  2JYY A;  1TIH A;  1LR7 A;  2QQD A;  1CT4 I;  1BMO A;  2SGP I;  2KMO A;  2P6A C;  2OVO A;  1CHO I;  2ERW A;  1DS3 I;  1UUC A;  2KCX A;  1SGY I;  1BUS A;  2GKT I;  2V53 A;  1AN1 I;  1DS2 I;  2ARP F;  1YU6 C;  1SGE I;  1Y1C A;  2NU4 I;  1LR8 A;  1IW4 A;  1Z7K B;  1SGR I;  2GKV A;  2XRC A;  2NU2 I;  1MT1 A;  1N13 A;  2KMR A;  4OVO A;  3TJQ A;  1NUB A;  4SGB I;  2SGD I;  4HGU A;  4GI3 C;  2JZM A;  2KMQ A;  1OMT A;  2JXD A;  2LEO A;  1YTP A;  2SGQ I;  1H0Z A;  1UVG A;  1HJA I;  2QQC A;  1SGN I;  2NU3 I;  1KMA A;  1LR9 A;  5DAE A;  1IY5 A;  1UVF A;  1PPF I;  1TBQ R;  1Y1B A;  3B4V C;  1IY6 A;  3OVO A;  2N17 A;  1SGP I;  1TGS I;  1CT2 I;  2B0U C;  1CT0 I;  1TUS A;  1HPT A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  1ULN A;  2JW6 A;  2ROW A;  2X52 A;  5EX0 A;  3R5B A;  3TOA A;  1PCE A;  1SGQ I;  2NU0 I;  3KY9 A;  2N71 A;  1CGJ I;  3SGQ I;  1W3S A;  3VE5 A;  1R0R I;  2BUS A;  1PTR A;  2QPO A;  1FYB A;  2PQ8 A;  2KMP A;  2ODD A;  2DB6 A;  1K7T A;  2SGF I;  2N52 A;  3VDP A;  3TO9 A;  2GKR I;  2M5X A;  5J8C A;  2DIP A;  2L8E A;  1M8C A;  1OVO A;  2VRW B;  3MEK A;  5JHW C;  4B6D A;  2J9R A;  1PJU A;  2CWF A;  1UHA A;  2F3C I;  1OYV I;  2NU1 I;  3BJI A;  3HH2 C;  3R5C A;  4UXH A;  3SEK C;  3SGB I;  1CE3 A;  2L7X A;  1TUR A;  1MJ9 A;  1OMU A;  1KBE A;  1MJB A;  3TO7 A;  1Y8F A;  2FNF X;  1TBR R;  3QTL D;  1M8B A;  2WCY A;  2ENN A;  1HDL A;  4WP4 A;  3RU0 A;  1CSO I;  1V1H A;  2ENZ A;  3GOX A;  1VDD A;  2J87 A;  2SGE I;  2YUU A;  1SGD I;  1R79 A;  2CWG A;  4UXJ A;  4E1P A;  1CGI I;  1ULK A;  1NXU A;  2WVJ A;  3D00 A;  2JYY A;  3QWP A;  3UGL A;  3R5A A;  1TIH A;  1LR7 A;  2E73 A;  3PDN A;  5FUY A;  3VDU A;  1HEV A;  2LUY A;  7WGA A;  2QQD A;  2X3T A;  1CT4 I;  3UGD A;  1BMO A;  2JA1 A;  2SGP I;  1U5K A;  2KMO A;  5FUX A;  2YQP A;  1P9G A;  5HI7 A;  1TUS A;  2RIJ A;  2P6A C;  1S20 A;  4FKD A;  3FC3 A;  4AML A;  2OVO A;  1CHO I;  2ERW A;  2V1C C;  1DS3 I;  3R5D A;  1FAQ A;  2B8T A;  1WKX A;  1UUC A;  2KCX A;  1TOT A;  2V1C A;  1WTJ A;  5HQ8 A;  2N1A B;  1SGY I;  1X74 A;  2ORV A;  2DKV A;  2Y0M A;  4DNC A;  1BUS A;  2GKT I;  2A20 A;  2V53 A;  1MJA A;  2CWH A;  3TOB A;  1TBO A;  2QQ0 A;  3E2I A;  1AN1 I;  1DS2 I;  4E1R A;  2ARP F;  1YU6 C;  3UOE A;  1V1I A;  1Z2I A;  1SGE I;  1Q9B A;  1Y1C A;  3OL0 A;  2NU4 I;  1LR8 A;  9WGA A;  1IW4 A;  1Z7K B;  1TBN A;  1SGR I;  1XA6 A;  2OU2 A;  1X4S A;  3OXF A;  3FSY A;  2GKV A;  4MPI A;  1XX6 A;  2XRC A;  2NU2 I;  1MT1 A;  1N13 A;  3CXL A;  3TO6 A;  2KMR A;  1RFH A;  4OVO A;  5E3R A;  2OD1 A;  2OZU A;  5E3P A;  3TJQ A;  2ORW A;  1NUB A;  4SGB I;  1ULM A;  2UVO A;  2SGD I;  4HGU A;  3UFF A;  2K9H A;  4GI3 C;  3UEY A;  2JZM A;  3E59 A;  2W0T A;  2GIV A;  2KMQ A;  1KBF A;  1OMT A;  5EX3 A;  1FAR A;  5CCL A;  2JXD A;  2LEO A;  2LB7 A;  2ELI A;  1YTP A;  2SGQ I;  4L9M A;  3UEJ A;  1H0Z A;  5FUW A;  1UVG A;  1HJA I;  2CJS C;  3OXL A;  5FUV A;  2QQC A;  1SGN I;  2NU3 I;  1W4R A;  3OXG A;  1PTQ A;  5J8F A;  1KMA A;  1LR9 A;  2RC4 A;  2UZ3 A;  4JCV E;  5DAE A;  4UXI A;  1IY5 A;  1WGC A;  1UVF A;  1PPF I;  1WGT A;  2WGC A;  2GVI A;  1TBQ R;  1Y1B A;  2QQE A;  3B4V C;  5E3Q A;  1IY6 A;  3FSX A;  3OVO A;  2N17 A;  1SGP I;  1TGS I;  1CT2 I;  2B0U C;  2E5R A;  3QAH A;  4A24 A;  5CCM A;  1CT0 I;  1K7U A;  1P9Z A;  1K7V A;  3UGI A;  1XBT A;  1HPT A; 
#chains in the Genus database with same CATH homology
 2ROW A;  2JW6 A;  5EX0 A;  1PCE A;  1SGQ I;  2NU0 I;  3KY9 A;  2N71 A;  1CGJ I;  3SGQ I;  1W3S A;  3VE5 A;  1R0R I;  2BUS A;  1PTR A;  2QPO A;  1FYB A;  2KMP A;  2ODD A;  2DB6 A;  2SGF I;  2N52 A;  3VDP A;  2GKR I;  2M5X A;  2DIP A;  2L8E A;  1M8C A;  1OVO A;  2VRW B;  3MEK A;  5JHW C;  4B6D A;  2J9R A;  1PJU A;  2F3C I;  1OYV I;  2NU1 I;  3BJI A;  3HH2 C;  4UXH A;  3SEK C;  3SGB I;  1CE3 A;  2L7X A;  1TUR A;  1OMU A;  1KBE A;  1Y8F A;  2FNF X;  1TBR R;  3QTL D;  1M8B A;  2WCY A;  2ENN A;  1HDL A;  3RU0 A;  1CSO I;  1V1H A;  2ENZ A;  3GOX A;  1VDD A;  2J87 A;  2SGE I;  2YUU A;  1SGD I;  1R79 A;  4UXJ A;  4E1P A;  1CGI I;  2WVJ A;  3D00 A;  2JYY A;  3QWP A;  3UGL A;  1TIH A;  1LR7 A;  2E73 A;  3PDN A;  5FUY A;  3VDU A;  2LUY A;  2QQD A;  1CT4 I;  3UGD A;  1BMO A;  2JA1 A;  2SGP I;  1U5K A;  2KMO A;  5FUX A;  2YQP A;  5HI7 A;  4FKD A;  2P6A C;  3FC3 A;  2OVO A;  1CHO I;  2ERW A;  2V1C C;  1DS3 I;  1FAQ A;  2B8T A;  2V1C A;  1UUC A;  2KCX A;  1TOT A;  5HQ8 A;  2N1A B;  1SGY I;  1X74 A;  2ORV A;  1BUS A;  2GKT I;  2A20 A;  2V53 A;  1TBO A;  2QQ0 A;  3E2I A;  1AN1 I;  1DS2 I;  4E1R A;  2ARP F;  1YU6 C;  1V1I A;  1SGE I;  1Y1C A;  3OL0 A;  2NU4 I;  1LR8 A;  1IW4 A;  1Z7K B;  1TBN A;  1SGR I;  1XA6 A;  1X4S A;  3OXF A;  2GKV A;  1XX6 A;  2XRC A;  2NU2 I;  1MT1 A;  1N13 A;  3CXL A;  2KMR A;  1RFH A;  4OVO A;  2OD1 A;  3TJQ A;  2ORW A;  1NUB A;  4SGB I;  2SGD I;  4HGU A;  3UFF A;  2K9H A;  4GI3 C;  3UEY A;  2JZM A;  3E59 A;  2W0T A;  2KMQ A;  1KBF A;  1OMT A;  5EX3 A;  1FAR A;  5CCL A;  2JXD A;  2LEO A;  2ELI A;  1YTP A;  2SGQ I;  4L9M A;  3UEJ A;  1H0Z A;  5FUW A;  1UVG A;  1HJA I;  2CJS C;  3OXL A;  5FUV A;  2QQC A;  1SGN I;  2NU3 I;  1W4R A;  3OXG A;  1PTQ A;  1KMA A;  1LR9 A;  2UZ3 A;  4JCV E;  5DAE A;  4UXI A;  1IY5 A;  1UVF A;  1PPF I;  2GVI A;  1TBQ R;  1Y1B A;  2QQE A;  3B4V C;  1IY6 A;  3OVO A;  2N17 A;  1SGP I;  1TGS I;  1CT2 I;  2B0U C;  2E5R A;  4A24 A;  5CCM A;  1CT0 I;  3UGI A;  1TUS A;  1XBT A;  1HPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...