1UUCA

Solution structure of a chimeric lekti-domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
KNEDQEMCHEFQAFMKNGKLFCPQDKKPIQSLDGIMFINKCATCKMILEKEAKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase inhibitor
molecule keywords SERINE PROTEASE INHIBITOR KAZAL-TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uucA00
2M5XA 2KCXA 1TBRR 1Y1BA 2KMPA 1BUSA 3B4VC 1MT1A 1SGDI 1KMAA 2N71A 1SGYI 1SGNI 1PJUA 2GKVA 2LEOA 1TUSA 3SEKC 2BUSA 1IY5A 1TURA 3HH2C 1HDLA 2QQCA 3SGQI 2ERWA 4HGUA 1CE3A 1OYVI 1SGPI 1R0RI 5DAEA 2JZMA 1IY6A 1TBQR 2XRCA 2SGDI 5JHWC 1PPFI 2JXDA 4OVOA 1FYBA 1OMTA 2B0UC 1CT4I 2N17A 1YTPA 1OMUA 1AN1I 2QQDA 1SGEI 3SGBI 1SGQI 1BMOA 1LR9A 4GI3C 2WCYA 2SGFI 2KMOA 2KMRA 2SGEI 2OVOA 1M8BA 1TIHA 1UVGA 1PCEA 1N13A 2GKTI 1CSOI 1OVOA 1LR8A 1SGRI 2NU0I 2JYYA 1CHOI 2NU1I 1M8CA 1CGJI 1LR7A 2NU4I 1UUCA 1HJAI 1H0ZA 2KMQA 2F3CI 1DS3I 2P6AC 2N52A 2NU2I 3QTLD 1NUBA 1CT2I 1CGII 1CT0I 1Y1CA 1IW4A 4SGBI 2V53A 2GKRI 1UVFA 1YU6C 1TGSI 2ARPF 1DS2I 2SGPI 3TJQA 1HPTA 2SGQI 1Z7KB 2NU3I 3OVOA
chains in the Genus database with same CATH superfamily
3MEKA 2PQ8A 4L9MA 2M5XA 2KCXA 1WTJA 2E5RA 2UVOA 1TBRR 2V1CA 1Y1BA 2DKVA 2KMPA 3QWPA 2VRWB 2X52A 1ULMA 1BUSA 1K7UA 2QPOA 2DIPA 3UGIA 1TOTA 1Q9BA 3B4VC 3RU0A 1MT1A 1XA6A 1X74A 2UZ3A 1SGDI 1HEVA 1KMAA 2N71A 1SGYI 3UEJA 1SGNI 1PJUA 1MJ9A 2GKVA 2LEOA 2K9HA 4UXIA 1TUSA 3SEKC 2BUSA 3TO9A 5J8FA 1Z2IA 1IY5A 1TURA 3HH2C 5EX3A 4AMLA 1HDLA 2L7XA 4E1PA 2QQCA 3SGQI 3VDUA 2ERWA 1RFHA 4HGUA 1UHAA 2B8TA 1CE3A 1OYVI 1SGPI 1MJAA 2X3TA 1R0RI 3D00A 1P9ZA 5DAEA 2ELIA 2JZMA 1IY6A 3R5AA 1TBQR 1U5KA 2XRCA 3UGDA 1K7VA 2ODDA 2SGDI 2JA1A 1PPFI 2YUUA 5FUYA 4WP4A 3TO6A 7WGAA 5JHWC 2JXDA 2ENZA 4OVOA 5FUVA 1ULNA 5FUWA 1OMTA 2B0UC 3FSYA 1FYBA 1CT4I 2N17A 2OD1A 2Y0MA 3R5BA 2ORVA 1YTPA 3E59A 1OMUA 1AN1I 2QQDA 2V1CC 2WVJA 3R5DA 1SGEI 1V1HA 1W4RA 3QAHA 1PTQA 3TOBA 5HQ8A 3SGBI 3PDNA 1SGQI 1BMOA 1LR9A 2CWGA 3UOEA 9WGAA 4GI3C 2WCYA 2L8EA 2SGFI 1TBOA 5FUXA 2OZUA 4FKDA 2KMOA 2KMRA 5HI7A 2N1AB 2SGEI 1XBTA 2OVOA 5E3RA 1M8BA 4MPIA 2CWFA 4A24A 3FSXA 4UXJA 4UXHA 1TIHA 1Y8FA 4JCVE 2LB7A 1UVGA 5CCLA 1XX6A 3OXFA 1PCEA 2YQPA 1FARA 1N13A 2GKTI 1FY7A 2OU2A 1CSOI 3TOAA 1OVOA 1LR8A 2RIJA 1SGRI 2NU0I 2JYYA 1CHOI 1MJBA 1WGCA 2J9RA 2NU1I 2W0TA 3UFFA 1M8CA 1FAQA 2ROWA 3E2IA 1CGJI 1WGTA 1P9GA 2CWHA 1LR7A 3VDPA 1NXUA 2NU4I 3UEYA 4B6DA 4DNCA 5J8CA 1WKXA 1UUCA 1HJAI 3OVOA 5EX0A 2KMQA 3OL0A 5CCMA 1H0ZA 3KY9A 2F3CI 2QQEA 3OXLA 1DS3I 2J87A 2P6AC 2N52A 2NU2I 3UGLA 3FC3A 3OXGA 3VE5A 2FNFX 1VDDA 3QTLD 1NUBA 5E3QA 1CT2I 2DB6A 2QQ0A 1CGII 2CJSC 1CT0I 1S20A 2GVIA 2RC4A 1Y1CA 1V1IA 1IW4A 4SGBI 2V53A 2GIVA 2ORWA 2GKRI 3R5CA 2WGCA 1UVFA 1YU6C 1TGSI 2ARPF 1K7TA 2JW6A 3BJIA 1DS2I 2SGPI 2A20A 4E1RA 3CXLA 3TJQA 5E3PA 1X4SA 1HPTA 1KBEA 1W3SA 3TO7A 2SGQI 1TBNA 1PTRA 1ULKA 1Z7KB 1R79A 2LUYA 3GOXA 2NU3I 2ENNA 2E73A 1KBFA
chains in the Genus database with same CATH topology
3MEKA 4L9MA 2M5XA 2KCXA 2E5RA 2V1CA 1TBRR 1Y1BA 2KMPA 3QWPA 2VRWB 1BUSA 2QPOA 2DIPA 3UGIA 1TOTA 3B4VC 3RU0A 1MT1A 1XA6A 1X74A 2UZ3A 1SGDI 1KMAA 2N71A 1SGYI 3UEJA 1SGNI 1PJUA 2GKVA 2LEOA 2K9HA 4UXIA 1TUSA 3SEKC 2BUSA 1IY5A 1TURA 3HH2C 5EX3A 1HDLA 2L7XA 4E1PA 2QQCA 3SGQI 3VDUA 2ERWA 1RFHA 4HGUA 2B8TA 1CE3A 1OYVI 1SGPI 3D00A 1R0RI 5DAEA 2ELIA 2JZMA 1IY6A 1TBQR 1U5KA 2XRCA 3UGDA 2ODDA 2SGDI 2JA1A 1PPFI 2YUUA 5FUYA 5JHWC 2JXDA 2ENZA 4OVOA 5FUVA 5FUWA 1OMTA 2B0UC 1FYBA 1CT4I 2N17A 2OD1A 2ORVA 1YTPA 3E59A 1OMUA 1AN1I 2QQDA 2V1CC 2WVJA 1SGEI 1V1HA 1W4RA 1PTQA 5HQ8A 3SGBI 3PDNA 1SGQI 1BMOA 1LR9A 4GI3C 2WCYA 2L8EA 2SGFI 1TBOA 5FUXA 4FKDA 2KMOA 2KMRA 5HI7A 2N1AB 2SGEI 1XBTA 2OVOA 1M8BA 4A24A 4UXJA 4UXHA 1TIHA 1Y8FA 4JCVE 5CCLA 1UVGA 1XX6A 3OXFA 1PCEA 2YQPA 1FARA 1N13A 2GKTI 1CSOI 1OVOA 1LR8A 1SGRI 2NU0I 2JYYA 1CHOI 2NU1I 2J9RA 2W0TA 3UFFA 1FAQA 1M8CA 2ROWA 3E2IA 1CGJI 1LR7A 3VDPA 2NU4I 3UEYA 4B6DA 5EX0A 1UUCA 1HJAI 3OVOA 5CCMA 2KMQA 3OL0A 1H0ZA 3KY9A 2F3CI 2QQEA 3OXLA 1DS3I 2J87A 2P6AC 2N52A 2NU2I 3UGLA 3FC3A 3OXGA 3VE5A 2FNFX 1VDDA 3QTLD 1NUBA 1CT2I 2DB6A 2QQ0A 1CGII 2CJSC 1CT0I 2GVIA 1Y1CA 1V1IA 1IW4A 4SGBI 2V53A 2ORWA 2GKRI 1UVFA 1YU6C 1TGSI 2ARPF 3BJIA 2JW6A 1DS2I 2SGPI 2A20A 4E1RA 3CXLA 3TJQA 1X4SA 1HPTA 1KBEA 1W3SA 2SGQI 1TBNA 1PTRA 1Z7KB 2LUYA 1R79A 3GOXA 2NU3I 2ENNA 2E73A 1KBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5X A;  2KCX A;  1TBR R;  1Y1B A;  2KMP A;  1BUS A;  3B4V C;  1MT1 A;  1SGD I;  1KMA A;  2N71 A;  1SGY I;  1SGN I;  1PJU A;  2GKV A;  2LEO A;  1TUS A;  3SEK C;  2BUS A;  1IY5 A;  1TUR A;  3HH2 C;  1HDL A;  2QQC A;  3SGQ I;  2ERW A;  4HGU A;  1CE3 A;  1OYV I;  1SGP I;  1R0R I;  5DAE A;  2JZM A;  1IY6 A;  1TBQ R;  2XRC A;  2SGD I;  5JHW C;  1PPF I;  2JXD A;  4OVO A;  1FYB A;  1OMT A;  2B0U C;  1CT4 I;  2N17 A;  1YTP A;  1OMU A;  1AN1 I;  2QQD A;  1SGE I;  3SGB I;  1SGQ I;  1BMO A;  1LR9 A;  4GI3 C;  2WCY A;  2SGF I;  2KMO A;  2KMR A;  2SGE I;  2OVO A;  1M8B A;  1TIH A;  1UVG A;  1PCE A;  1N13 A;  2GKT I;  1CSO I;  1OVO A;  1LR8 A;  1SGR I;  2NU0 I;  2JYY A;  1CHO I;  2NU1 I;  1M8C A;  1CGJ I;  1LR7 A;  2NU4 I;  1UUC A;  1HJA I;  1H0Z A;  2KMQ A;  2F3C I;  1DS3 I;  2P6A C;  2N52 A;  2NU2 I;  3QTL D;  1NUB A;  1CT2 I;  1CGI I;  1CT0 I;  1Y1C A;  1IW4 A;  4SGB I;  2V53 A;  2GKR I;  1UVF A;  1YU6 C;  1TGS I;  2ARP F;  1DS2 I;  2SGP I;  3TJQ A;  1HPT A;  2SGQ I;  1Z7K B;  2NU3 I;  3OVO A; 
#chains in the Genus database with same CATH topology
 3MEK A;  2PQ8 A;  4L9M A;  2M5X A;  2KCX A;  1WTJ A;  2E5R A;  2UVO A;  1TBR R;  2V1C A;  1Y1B A;  2DKV A;  2KMP A;  3QWP A;  2VRW B;  2X52 A;  1ULM A;  1BUS A;  1K7U A;  2QPO A;  2DIP A;  3UGI A;  1TOT A;  1Q9B A;  3B4V C;  3RU0 A;  1MT1 A;  1XA6 A;  1X74 A;  2UZ3 A;  1SGD I;  1HEV A;  1KMA A;  2N71 A;  1SGY I;  3UEJ A;  1SGN I;  1PJU A;  1MJ9 A;  2GKV A;  2LEO A;  2K9H A;  4UXI A;  1TUS A;  3SEK C;  2BUS A;  3TO9 A;  5J8F A;  1Z2I A;  1IY5 A;  1TUR A;  3HH2 C;  5EX3 A;  4AML A;  1HDL A;  2L7X A;  4E1P A;  2QQC A;  3SGQ I;  3VDU A;  2ERW A;  1RFH A;  4HGU A;  1UHA A;  2B8T A;  1CE3 A;  1OYV I;  1SGP I;  1MJA A;  2X3T A;  1R0R I;  3D00 A;  1P9Z A;  5DAE A;  2ELI A;  2JZM A;  1IY6 A;  3R5A A;  1TBQ R;  1U5K A;  2XRC A;  3UGD A;  1K7V A;  2ODD A;  2SGD I;  2JA1 A;  1PPF I;  2YUU A;  5FUY A;  4WP4 A;  3TO6 A;  7WGA A;  5JHW C;  2JXD A;  2ENZ A;  4OVO A;  5FUV A;  1ULN A;  5FUW A;  1OMT A;  2B0U C;  3FSY A;  1FYB A;  1CT4 I;  2N17 A;  2OD1 A;  2Y0M A;  3R5B A;  2ORV A;  1YTP A;  3E59 A;  1OMU A;  1AN1 I;  2QQD A;  2V1C C;  2WVJ A;  3R5D A;  1SGE I;  1V1H A;  1W4R A;  3QAH A;  1PTQ A;  3TOB A;  5HQ8 A;  3SGB I;  3PDN A;  1SGQ I;  1BMO A;  1LR9 A;  2CWG A;  3UOE A;  9WGA A;  4GI3 C;  2WCY A;  2L8E A;  2SGF I;  1TBO A;  5FUX A;  2OZU A;  4FKD A;  2KMO A;  2KMR A;  5HI7 A;  2N1A B;  2SGE I;  1XBT A;  2OVO A;  5E3R A;  1M8B A;  4MPI A;  2CWF A;  4A24 A;  3FSX A;  4UXJ A;  4UXH A;  1TIH A;  1Y8F A;  4JCV E;  2LB7 A;  1UVG A;  5CCL A;  1XX6 A;  3OXF A;  1PCE A;  2YQP A;  1FAR A;  1N13 A;  2GKT I;  1FY7 A;  2OU2 A;  1CSO I;  3TOA A;  1OVO A;  1LR8 A;  2RIJ A;  1SGR I;  2NU0 I;  2JYY A;  1CHO I;  1MJB A;  1WGC A;  2J9R A;  2NU1 I;  2W0T A;  3UFF A;  1M8C A;  1FAQ A;  2ROW A;  3E2I A;  1CGJ I;  1WGT A;  1P9G A;  2CWH A;  1LR7 A;  3VDP A;  1NXU A;  2NU4 I;  3UEY A;  4B6D A;  4DNC A;  5J8C A;  1WKX A;  1UUC A;  1HJA I;  3OVO A;  5EX0 A;  2KMQ A;  3OL0 A;  5CCM A;  1H0Z A;  3KY9 A;  2F3C I;  2QQE A;  3OXL A;  1DS3 I;  2J87 A;  2P6A C;  2N52 A;  2NU2 I;  3UGL A;  3FC3 A;  3OXG A;  3VE5 A;  2FNF X;  1VDD A;  3QTL D;  1NUB A;  5E3Q A;  1CT2 I;  2DB6 A;  2QQ0 A;  1CGI I;  2CJS C;  1CT0 I;  1S20 A;  2GVI A;  2RC4 A;  1Y1C A;  1V1I A;  1IW4 A;  4SGB I;  2V53 A;  2GIV A;  2ORW A;  2GKR I;  3R5C A;  2WGC A;  1UVF A;  1YU6 C;  1TGS I;  2ARP F;  1K7T A;  2JW6 A;  3BJI A;  1DS2 I;  2SGP I;  2A20 A;  4E1R A;  3CXL A;  3TJQ A;  5E3P A;  1X4S A;  1HPT A;  1KBE A;  1W3S A;  3TO7 A;  2SGQ I;  1TBN A;  1PTR A;  1ULK A;  1Z7K B;  1R79 A;  2LUY A;  3GOX A;  2NU3 I;  2ENN A;  2E73 A;  1KBF A; 
#chains in the Genus database with same CATH homology
 3MEK A;  4L9M A;  2M5X A;  2KCX A;  2E5R A;  2V1C A;  1TBR R;  1Y1B A;  2KMP A;  3QWP A;  2VRW B;  1BUS A;  2QPO A;  2DIP A;  3UGI A;  1TOT A;  3B4V C;  3RU0 A;  1MT1 A;  1XA6 A;  1X74 A;  2UZ3 A;  1SGD I;  1KMA A;  2N71 A;  1SGY I;  3UEJ A;  1SGN I;  1PJU A;  2GKV A;  2LEO A;  2K9H A;  4UXI A;  1TUS A;  3SEK C;  2BUS A;  1IY5 A;  1TUR A;  3HH2 C;  5EX3 A;  1HDL A;  2L7X A;  4E1P A;  2QQC A;  3SGQ I;  3VDU A;  2ERW A;  1RFH A;  4HGU A;  2B8T A;  1CE3 A;  1OYV I;  1SGP I;  3D00 A;  1R0R I;  5DAE A;  2ELI A;  2JZM A;  1IY6 A;  1TBQ R;  1U5K A;  2XRC A;  3UGD A;  2ODD A;  2SGD I;  2JA1 A;  1PPF I;  2YUU A;  5FUY A;  5JHW C;  2JXD A;  2ENZ A;  4OVO A;  5FUV A;  5FUW A;  1OMT A;  2B0U C;  1FYB A;  1CT4 I;  2N17 A;  2OD1 A;  2ORV A;  1YTP A;  3E59 A;  1OMU A;  1AN1 I;  2QQD A;  2V1C C;  2WVJ A;  1SGE I;  1V1H A;  1W4R A;  1PTQ A;  5HQ8 A;  3SGB I;  3PDN A;  1SGQ I;  1BMO A;  1LR9 A;  4GI3 C;  2WCY A;  2L8E A;  2SGF I;  1TBO A;  5FUX A;  4FKD A;  2KMO A;  2KMR A;  5HI7 A;  2N1A B;  2SGE I;  1XBT A;  2OVO A;  1M8B A;  4A24 A;  4UXJ A;  4UXH A;  1TIH A;  1Y8F A;  4JCV E;  5CCL A;  1UVG A;  1XX6 A;  3OXF A;  1PCE A;  2YQP A;  1FAR A;  1N13 A;  2GKT I;  1CSO I;  1OVO A;  1LR8 A;  1SGR I;  2NU0 I;  2JYY A;  1CHO I;  2NU1 I;  2J9R A;  2W0T A;  3UFF A;  1FAQ A;  1M8C A;  2ROW A;  3E2I A;  1CGJ I;  1LR7 A;  3VDP A;  2NU4 I;  3UEY A;  4B6D A;  5EX0 A;  1UUC A;  1HJA I;  3OVO A;  5CCM A;  2KMQ A;  3OL0 A;  1H0Z A;  3KY9 A;  2F3C I;  2QQE A;  3OXL A;  1DS3 I;  2J87 A;  2P6A C;  2N52 A;  2NU2 I;  3UGL A;  3FC3 A;  3OXG A;  3VE5 A;  2FNF X;  1VDD A;  3QTL D;  1NUB A;  1CT2 I;  2DB6 A;  2QQ0 A;  1CGI I;  2CJS C;  1CT0 I;  2GVI A;  1Y1C A;  1V1I A;  1IW4 A;  4SGB I;  2V53 A;  2ORW A;  2GKR I;  1UVF A;  1YU6 C;  1TGS I;  2ARP F;  3BJI A;  2JW6 A;  1DS2 I;  2SGP I;  2A20 A;  4E1R A;  3CXL A;  3TJQ A;  1X4S A;  1HPT A;  1KBE A;  1W3S A;  2SGQ I;  1TBN A;  1PTR A;  1Z7K B;  2LUY A;  1R79 A;  3GOX A;  2NU3 I;  2ENN A;  2E73 A;  1KBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...