2DIPA

Solution structure of the zz domain of zinc finger swim domain containing protein 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
b'GSSGSSGLEEFKNSSKLVAAAEKERLDKHLGIPCNNCKQFPIEGKCYKCTECIEYHLCQECFDSYCHLSHTFTFREKRNQKWRSLEKRADEVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger SWIM domain-containing protein 2
publication title Solution structure of the ZZ domain of Zinc finger SWIM domain containing protein 2
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2dipA01
2DIPA 2E5RA 2N1AB 1TOTA
chains in the Genus database with same CATH superfamily
1PJUA 1SGYI 3QWPA 2SGEI 1M8BA 1IY6A 1TIHA 2LEOA 5HQ8A 3FSYA 5FUXA 1KMAA 2JW6A 3SEKC 1CE3A 4UXHA 1V1IA 1CGII 2V53A 1AN1I 3E59A 1WGTA 4FKDA 3TOAA 3TO9A 2P6AC 1HDLA 3TO7A 3UFFA 1M8CA 3SGBI 2L7XA 2LUYA 1W4RA 3R5AA 3FC3A 1NUBA 2QQDA 1H0ZA 1FAQA 2ROWA 4UXJA 1TBRR 1X74A 2W0TA 1FY7A 5E3QA 3HH2C 2NU2I 1SGNI 1P9ZA 4B6DA 2F3CI 2PQ8A 1DS2I 1UVFA 9WGAA 3VE5A 1N13A 2NU0I 1K7VA 1PTQA 1WKXA 3OVOA 2FNFX 3R5BA 2UVOA 1SGRI 3R5DA 4MPIA 2NU1I 1VDDA 4L9MA 1PTRA 2J87A 1OMTA 1MT1A 3KY9A 1P9GA 1MJ9A 4E1PA 3OXFA 1CGJI 3QAHA 3B4VC 4WP4A 1OVOA 3MEKA 2ARPF 1RFHA 1TBOA 2GKTI 3UGIA 2BUSA 1FARA 2B8TA 2ODDA 3UEJA 2DIPA 5J8CA 2N52A 2RIJA 2CWHA 2NU3I 1OYVI 2WVJA 3R5CA 1XA6A 1UHAA 1MJBA 1CT4I 1CT0I 3UOEA 3OL0A 2B0UC 3OXLA 5DAEA 1R0RI 3BJIA 1HJAI 1W3SA 1KBEA 2K9HA 1K7UA 1SGDI 2ELIA 4UXIA 2GIVA 5FUVA 2QQCA 1UVGA 2SGDI 1SGPI 5EX3A 1LR9A 2CWFA 1IW4A 1TUSA 2SGFI 1KBFA 1DS3I 4DNCA 4SGBI 1OMUA 5JHWC 3D00A 2GKVA 2KMOA 2M5XA 3VDPA 2SGQI 1S20A 1CSOI 1U5KA 4JCVE 3OXGA 1Z7KB 1YU6C 2DB6A 2QQ0A 2QQEA 2V1CA 3E2IA 4OVOA 3TJQA 2N17A 3VDUA 1XBTA 4E1RA 1Y1BA 2NU4I 2OVOA 1PCEA 4GI3C 1FYBA 1MJAA 1SGEI 2OD1A 2V1CC 2WGCA 3UGLA 4HGUA 2CJSC 2OU2A 1HPTA 1HEVA 5EX0A 1X4SA 2ENZA 1ULMA 2ERWA 5E3PA 5FUWA 1LR7A 1TBNA 1V1HA 1Y1CA 1IY5A 1CHOI 2SGPI 3TO6A 2JZMA 3UGDA 1CT2I 1BUSA 1ULNA 2JXDA 2Y0MA 2GKRI 2X52A 1Z2IA 2WCYA 2N1AB 3TOBA 2JYYA 5CCMA 2E5RA 2YQPA 2DKVA 3GOXA 3UEYA 1WGCA 2OZUA 1WTJA 2J9RA 1YTPA 1BMOA 2KCXA 4AMLA 2ENNA 1XX6A 1Y8FA 1K7TA 2KMRA 2X3TA 2L8EA 2UZ3A 1UUCA 5FUYA 1TGSI 1SGQI 2JA1A 2ORVA 1PPFI 1TURA 3PDNA 5CCLA 3RU0A 5E3RA 2LB7A 3FSXA 2CWGA 2YUUA 3SGQI 3QTLD 7WGAA 1Q9BA 2VRWB 1TOTA 3CXLA 2XRCA 2N71A 5J8FA 1R79A 4A24A 2GVIA 1TBQR 2A20A 2KMQA 5HI7A 1NXUA 2ORWA 1ULKA 2E73A 2QPOA 1LR8A 2KMPA 2RC4A
chains in the Genus database with same CATH topology
1PJUA 1SGYI 3QWPA 2SGEI 1M8BA 1IY6A 1TIHA 2LEOA 5HQ8A 5FUXA 1KMAA 2JW6A 3SEKC 1CE3A 4UXHA 1V1IA 1CGII 2V53A 1AN1I 3E59A 4FKDA 2P6AC 1HDLA 3UFFA 1M8CA 3SGBI 2L7XA 2LUYA 1W4RA 3FC3A 1H0ZA 1NUBA 2QQDA 1FAQA 2ROWA 4UXJA 1TBRR 1X74A 2W0TA 3HH2C 2NU2I 1SGNI 4B6DA 2F3CI 1DS2I 1UVFA 3VE5A 1N13A 2NU0I 1PTQA 3OVOA 2FNFX 1SGRI 2NU1I 1VDDA 4L9MA 1PTRA 2J87A 1OMTA 1MT1A 3KY9A 4E1PA 3OXFA 1CGJI 3B4VC 1OVOA 3MEKA 2ARPF 1RFHA 1TBOA 2GKTI 3UGIA 2BUSA 1FARA 2B8TA 2ODDA 3UEJA 2DIPA 2N52A 2NU3I 1OYVI 2WVJA 1XA6A 1CT4I 1CT0I 3OL0A 2B0UC 3OXLA 5DAEA 1R0RI 3BJIA 1HJAI 1W3SA 1KBEA 2K9HA 1SGDI 2ELIA 4UXIA 5FUVA 2QQCA 1UVGA 2SGDI 1SGPI 5EX3A 1LR9A 1IW4A 1TUSA 2SGFI 1KBFA 1DS3I 4SGBI 1OMUA 5JHWC 3D00A 2GKVA 2KMOA 2M5XA 3VDPA 2SGQI 1CSOI 1U5KA 4JCVE 3OXGA 1Z7KB 1YU6C 2DB6A 2QQ0A 2QQEA 2V1CA 3E2IA 4OVOA 3TJQA 2N17A 3VDUA 1XBTA 4E1RA 1Y1BA 2NU4I 2OVOA 1PCEA 4GI3C 1FYBA 1SGEI 2OD1A 2V1CC 3UGLA 4HGUA 2CJSC 1HPTA 5EX0A 1X4SA 2ENZA 2ERWA 5FUWA 1LR7A 1TBNA 1V1HA 1Y1CA 1IY5A 1CHOI 2SGPI 3UGDA 2JZMA 1BUSA 1CT2I 2JXDA 2GKRI 2WCYA 2N1AB 2JYYA 5CCMA 2E5RA 2YQPA 3GOXA 3UEYA 2J9RA 1YTPA 1BMOA 2KCXA 2ENNA 1XX6A 1Y8FA 2KMRA 2L8EA 2UZ3A 1UUCA 5FUYA 1TGSI 1SGQI 2JA1A 2ORVA 1PPFI 1TURA 3PDNA 5CCLA 3RU0A 3SGQI 2YUUA 3QTLD 2VRWB 1TOTA 3CXLA 2XRCA 2N71A 1R79A 4A24A 2GVIA 1TBQR 2A20A 2KMQA 5HI7A 2ORWA 2E73A 2QPOA 1LR8A 2KMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIP A;  2E5R A;  2N1A B;  1TOT A; 
#chains in the Genus database with same CATH topology
 1PJU A;  1SGY I;  3QWP A;  2SGE I;  1M8B A;  1IY6 A;  1TIH A;  2LEO A;  5HQ8 A;  3FSY A;  5FUX A;  1KMA A;  2JW6 A;  3SEK C;  1CE3 A;  4UXH A;  1V1I A;  1CGI I;  2V53 A;  1AN1 I;  3E59 A;  1WGT A;  4FKD A;  3TOA A;  3TO9 A;  2P6A C;  1HDL A;  3TO7 A;  3UFF A;  1M8C A;  3SGB I;  2L7X A;  2LUY A;  1W4R A;  3R5A A;  3FC3 A;  1NUB A;  2QQD A;  1H0Z A;  1FAQ A;  2ROW A;  4UXJ A;  1TBR R;  1X74 A;  2W0T A;  1FY7 A;  5E3Q A;  3HH2 C;  2NU2 I;  1SGN I;  1P9Z A;  4B6D A;  2F3C I;  2PQ8 A;  1DS2 I;  1UVF A;  9WGA A;  3VE5 A;  1N13 A;  2NU0 I;  1K7V A;  1PTQ A;  1WKX A;  3OVO A;  2FNF X;  3R5B A;  2UVO A;  1SGR I;  3R5D A;  4MPI A;  2NU1 I;  1VDD A;  4L9M A;  1PTR A;  2J87 A;  1OMT A;  1MT1 A;  3KY9 A;  1P9G A;  1MJ9 A;  4E1P A;  3OXF A;  1CGJ I;  3QAH A;  3B4V C;  4WP4 A;  1OVO A;  3MEK A;  2ARP F;  1RFH A;  1TBO A;  2GKT I;  3UGI A;  2BUS A;  1FAR A;  2B8T A;  2ODD A;  3UEJ A;  2DIP A;  5J8C A;  2N52 A;  2RIJ A;  2CWH A;  2NU3 I;  1OYV I;  2WVJ A;  3R5C A;  1XA6 A;  1UHA A;  1MJB A;  1CT4 I;  1CT0 I;  3UOE A;  3OL0 A;  2B0U C;  3OXL A;  5DAE A;  1R0R I;  3BJI A;  1HJA I;  1W3S A;  1KBE A;  2K9H A;  1K7U A;  1SGD I;  2ELI A;  4UXI A;  2GIV A;  5FUV A;  2QQC A;  1UVG A;  2SGD I;  1SGP I;  5EX3 A;  1LR9 A;  2CWF A;  1IW4 A;  1TUS A;  2SGF I;  1KBF A;  1DS3 I;  4DNC A;  4SGB I;  1OMU A;  5JHW C;  3D00 A;  2GKV A;  2KMO A;  2M5X A;  3VDP A;  2SGQ I;  1S20 A;  1CSO I;  1U5K A;  4JCV E;  3OXG A;  1Z7K B;  1YU6 C;  2DB6 A;  2QQ0 A;  2QQE A;  2V1C A;  3E2I A;  4OVO A;  3TJQ A;  2N17 A;  3VDU A;  1XBT A;  4E1R A;  1Y1B A;  2NU4 I;  2OVO A;  1PCE A;  4GI3 C;  1FYB A;  1MJA A;  1SGE I;  2OD1 A;  2V1C C;  2WGC A;  3UGL A;  4HGU A;  2CJS C;  2OU2 A;  1HPT A;  1HEV A;  5EX0 A;  1X4S A;  2ENZ A;  1ULM A;  2ERW A;  5E3P A;  5FUW A;  1LR7 A;  1TBN A;  1V1H A;  1Y1C A;  1IY5 A;  1CHO I;  2SGP I;  3TO6 A;  2JZM A;  3UGD A;  1CT2 I;  1BUS A;  1ULN A;  2JXD A;  2Y0M A;  2GKR I;  2X52 A;  1Z2I A;  2WCY A;  2N1A B;  3TOB A;  2JYY A;  5CCM A;  2E5R A;  2YQP A;  2DKV A;  3GOX A;  3UEY A;  1WGC A;  2OZU A;  1WTJ A;  2J9R A;  1YTP A;  1BMO A;  2KCX A;  4AML A;  2ENN A;  1XX6 A;  1Y8F A;  1K7T A;  2KMR A;  2X3T A;  2L8E A;  2UZ3 A;  1UUC A;  5FUY A;  1TGS I;  1SGQ I;  2JA1 A;  2ORV A;  1PPF I;  1TUR A;  3PDN A;  5CCL A;  3RU0 A;  5E3R A;  2LB7 A;  3FSX A;  2CWG A;  2YUU A;  3SGQ I;  3QTL D;  7WGA A;  1Q9B A;  2VRW B;  1TOT A;  3CXL A;  2XRC A;  2N71 A;  5J8F A;  1R79 A;  4A24 A;  2GVI A;  1TBQ R;  2A20 A;  2KMQ A;  5HI7 A;  1NXU A;  2ORW A;  1ULK A;  2E73 A;  2QPO A;  1LR8 A;  2KMP A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 1PJU A;  1SGY I;  3QWP A;  2SGE I;  1M8B A;  1IY6 A;  1TIH A;  2LEO A;  5HQ8 A;  5FUX A;  1KMA A;  2JW6 A;  3SEK C;  1CE3 A;  4UXH A;  1V1I A;  1CGI I;  2V53 A;  1AN1 I;  3E59 A;  4FKD A;  2P6A C;  1HDL A;  3UFF A;  1M8C A;  3SGB I;  2L7X A;  2LUY A;  1W4R A;  3FC3 A;  1H0Z A;  1NUB A;  2QQD A;  1FAQ A;  2ROW A;  4UXJ A;  1TBR R;  1X74 A;  2W0T A;  3HH2 C;  2NU2 I;  1SGN I;  4B6D A;  2F3C I;  1DS2 I;  1UVF A;  3VE5 A;  1N13 A;  2NU0 I;  1PTQ A;  3OVO A;  2FNF X;  1SGR I;  2NU1 I;  1VDD A;  4L9M A;  1PTR A;  2J87 A;  1OMT A;  1MT1 A;  3KY9 A;  4E1P A;  3OXF A;  1CGJ I;  3B4V C;  1OVO A;  3MEK A;  2ARP F;  1RFH A;  1TBO A;  2GKT I;  3UGI A;  2BUS A;  1FAR A;  2B8T A;  2ODD A;  3UEJ A;  2DIP A;  2N52 A;  2NU3 I;  1OYV I;  2WVJ A;  1XA6 A;  1CT4 I;  1CT0 I;  3OL0 A;  2B0U C;  3OXL A;  5DAE A;  1R0R I;  3BJI A;  1HJA I;  1W3S A;  1KBE A;  2K9H A;  1SGD I;  2ELI A;  4UXI A;  5FUV A;  2QQC A;  1UVG A;  2SGD I;  1SGP I;  5EX3 A;  1LR9 A;  1IW4 A;  1TUS A;  2SGF I;  1KBF A;  1DS3 I;  4SGB I;  1OMU A;  5JHW C;  3D00 A;  2GKV A;  2KMO A;  2M5X A;  3VDP A;  2SGQ I;  1CSO I;  1U5K A;  4JCV E;  3OXG A;  1Z7K B;  1YU6 C;  2DB6 A;  2QQ0 A;  2QQE A;  2V1C A;  3E2I A;  4OVO A;  3TJQ A;  2N17 A;  3VDU A;  1XBT A;  4E1R A;  1Y1B A;  2NU4 I;  2OVO A;  1PCE A;  4GI3 C;  1FYB A;  1SGE I;  2OD1 A;  2V1C C;  3UGL A;  4HGU A;  2CJS C;  1HPT A;  5EX0 A;  1X4S A;  2ENZ A;  2ERW A;  5FUW A;  1LR7 A;  1TBN A;  1V1H A;  1Y1C A;  1IY5 A;  1CHO I;  2SGP I;  3UGD A;  2JZM A;  1BUS A;  1CT2 I;  2JXD A;  2GKR I;  2WCY A;  2N1A B;  2JYY A;  5CCM A;  2E5R A;  2YQP A;  3GOX A;  3UEY A;  2J9R A;  1YTP A;  1BMO A;  2KCX A;  2ENN A;  1XX6 A;  1Y8F A;  2KMR A;  2L8E A;  2UZ3 A;  1UUC A;  5FUY A;  1TGS I;  1SGQ I;  2JA1 A;  2ORV A;  1PPF I;  1TUR A;  3PDN A;  5CCL A;  3RU0 A;  3SGQ I;  2YUU A;  3QTL D;  2VRW B;  1TOT A;  3CXL A;  2XRC A;  2N71 A;  1R79 A;  4A24 A;  2GVI A;  1TBQ R;  2A20 A;  2KMQ A;  5HI7 A;  2ORW A;  2E73 A;  2QPO A;  1LR8 A;  2KMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...