2DIPA

Solution structure of the zz domain of zinc finger swim domain containing protein 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLEEFKNSSKLVAAAEKERLDKHLGIPCNNCKQFPIEGKCYKCTECIEYHLCQECFDSYCHLSHTFTFREKRNQKWRSLEKRADEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Zinc finger SWIM domain-containing protein 2
publication title Solution structure of the ZZ domain of Zinc finger SWIM domain containing protein 2
rcsb
source organism Homo sapiens
total genus 8
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2dipA01
1TOTA 2N1AB 2DIPA 2E5RA
chains in the Genus database with same CATH superfamily
1TGSI 2NU1I 2VRWB 3OL0A 3UOEA 2NU4I 2RC4A 2SGDI 3R5DA 3SEKC 1BMOA 3TO7A 1UVFA 3SGBI 2DIPA 2CWFA 2W0TA 3UFFA 5E3RA 1MJAA 2QQDA 1MJBA 2KMPA 1NXUA 1CT4I 1MT1A 2WVJA 2V53A 1LR8A 4HGUA 3R5BA 3TO9A 1VDDA 3QTLD 1Z7KB 2NU0I 2OU2A 2YUUA 5DAEA 1S20A 2A20A 3E2IA 1UUCA 3OXGA 1AN1I 2NU3I 1YU6C 1OMUA 5HI7A 1UVGA 2KMQA 1U5KA 3TJQA 1IY6A 1OVOA 3E59A 3FC3A 2K9HA 1R0RI 1M8CA 4OVOA 4E1PA 1N13A 3PDNA 3QAHA 1XA6A 3UGIA 2YQPA 5CCMA 4GI3C 2JZMA 3HH2C 1FYBA 2GIVA 1SGDI 3D00A 3UEYA 1FARA 1BUSA 1CGII 1DS3I 3OXLA 1WGTA 5FUXA 1SGNI 2UZ3A 1H0ZA 5HQ8A 2ROWA 1CHOI 5JHWC 1CGJI 1SGEI 4DNCA 2ORWA 1LR9A 2QPOA 1CT0I 1V1HA 2LEOA 1HEVA 2PQ8A 5FUWA 3OVOA 1FY7A 2JXDA 2M5XA 2B0UC 4L9MA 3VE5A 2ENNA 2CJSC 1DS2I 3BJIA 2GKRI 2ERWA 2N1AB 2CWGA 1TURA 1KMAA 4UXHA 1XX6A 2N52A 3R5AA 3CXLA 1WTJA 2ENZA 5E3QA 1K7TA 1PCEA 1MJ9A 1Y1CA 2WCYA 1M8BA 2Y0MA 2SGQI 1V1IA 2WGCA 1HDLA 2LUYA 4UXJA 2ARPF 2SGFI 1ULNA 5EX0A 1ULKA 1HJAI 1WGCA 2V1CC 4MPIA 1LR7A 3KY9A 4SGBI 2OZUA 1NUBA 4UXIA 2UVOA 1W4RA 4WP4A 2J87A 2L7XA 1R79A 1SGYI 1TOTA 2E5RA 2JW6A 1P9GA 5J8FA 1K7UA 3TOAA 3UEJA 3QWPA 2OD1A 3FSYA 2ELIA 1XBTA 1Y1BA 1KBFA 2FNFX 5CCLA 3MEKA 1TBQR 4A24A 2ODDA 1X4SA 1SGPI 2QQCA 1YTPA 1PTQA 2N17A 2L8EA 2BUSA 5FUVA 1WKXA 1TIHA 2F3CI 4E1RA 2SGEI 1TBNA 1FAQA 5EX3A 1ULMA 2DB6A 2GKTI 3TO6A 1CT2I 1IW4A 7WGAA 2CWHA 3R5CA 2JYYA 1HPTA 1K7VA 2KMRA 2J9RA 2QQEA 1Q9BA 2P6AC 2X3TA 1TBOA 3RU0A 1TUSA 4B6DA 5E3PA 1Z2IA 1IY5A 1PTRA 2ORVA 5J8CA 1Y8FA 3FSXA 2N71A 1P9ZA 1CSOI 3SGQI 2KMOA 3VDPA 2LB7A 1CE3A 2X52A 2GKVA 2XRCA 4FKDA 4AMLA 3TOBA 3UGLA 1X74A 2OVOA 1OYVI 1PJUA 2KCXA 3VDUA 2DKVA 1OMTA 2RIJA 4JCVE 1KBEA 3UGDA 1W3SA 3B4VC 2GVIA 2V1CA 1SGQI 2SGPI 1RFHA 2JA1A 2NU2I 3OXFA 2B8TA 1SGRI 2E73A 9WGAA 1TBRR 1UHAA 1PPFI 5FUYA 3GOXA 2QQ0A
chains in the Genus database with same CATH topology
1TGSI 2NU1I 2VRWB 3OL0A 2NU4I 2SGDI 3SEKC 1BMOA 1UVFA 3SGBI 2DIPA 3UFFA 2W0TA 2QQDA 2KMPA 1CT4I 1MT1A 2WVJA 2V53A 1LR8A 4HGUA 1VDDA 3QTLD 1Z7KB 2NU0I 2YUUA 5DAEA 3E2IA 2A20A 3OXGA 1UUCA 1AN1I 2NU3I 1YU6C 1OMUA 5HI7A 1UVGA 2KMQA 1U5KA 3TJQA 1IY6A 1OVOA 3E59A 3FC3A 2K9HA 1R0RI 1M8CA 4OVOA 4E1PA 1N13A 3PDNA 1XA6A 3UGIA 2YQPA 5CCMA 4GI3C 2JZMA 3HH2C 1FYBA 1SGDI 3D00A 3UEYA 1FARA 1BUSA 1CGII 1DS3I 3OXLA 5FUXA 1SGNI 2UZ3A 1H0ZA 5HQ8A 2ROWA 1CHOI 5JHWC 1CGJI 1SGEI 2ORWA 1LR9A 2QPOA 1CT0I 1V1HA 2LEOA 5FUWA 3OVOA 2JXDA 2M5XA 2B0UC 4L9MA 3VE5A 2ENNA 2CJSC 1DS2I 3BJIA 2GKRI 2ERWA 2N1AB 1TURA 1KMAA 4UXHA 1XX6A 2N52A 3CXLA 2ENZA 1PCEA 1Y1CA 2WCYA 1M8BA 2SGQI 1V1IA 1HDLA 2LUYA 4UXJA 2ARPF 2SGFI 5EX0A 2V1CC 1HJAI 4SGBI 1LR7A 3KY9A 1NUBA 4UXIA 1W4RA 2J87A 2L7XA 1R79A 1SGYI 1TOTA 2E5RA 2JW6A 3UEJA 3QWPA 2OD1A 2ELIA 1XBTA 1Y1BA 1KBFA 2FNFX 5CCLA 3MEKA 1TBQR 4A24A 2ODDA 1X4SA 1SGPI 2QQCA 1YTPA 1PTQA 2N17A 2L8EA 2BUSA 5FUVA 1TIHA 2F3CI 4E1RA 2SGEI 1TBNA 1FAQA 5EX3A 2DB6A 2GKTI 1CT2I 1IW4A 2JYYA 1HPTA 2KMRA 2QQEA 2J9RA 4B6DA 2P6AC 1TBOA 3RU0A 1TUSA 1IY5A 1PTRA 2ORVA 1Y8FA 2N71A 1CSOI 3SGQI 2KMOA 3VDPA 1CE3A 4FKDA 2GKVA 2XRCA 3UGLA 1X74A 2OVOA 1OYVI 1PJUA 2KCXA 3VDUA 1OMTA 4JCVE 1KBEA 3UGDA 1W3SA 3B4VC 2GVIA 2V1CA 1SGQI 2SGPI 1RFHA 2JA1A 2NU2I 3OXFA 2B8TA 1SGRI 2E73A 1TBRR 1PPFI 5FUYA 3GOXA 2QQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOT A;  2N1A B;  2DIP A;  2E5R A; 
#chains in the Genus database with same CATH topology
 1TGS I;  2NU1 I;  2VRW B;  3OL0 A;  3UOE A;  2NU4 I;  2RC4 A;  2SGD I;  3R5D A;  3SEK C;  1BMO A;  3TO7 A;  1UVF A;  3SGB I;  2DIP A;  2CWF A;  2W0T A;  3UFF A;  5E3R A;  1MJA A;  2QQD A;  1MJB A;  2KMP A;  1NXU A;  1CT4 I;  1MT1 A;  2WVJ A;  2V53 A;  1LR8 A;  4HGU A;  3R5B A;  3TO9 A;  1VDD A;  3QTL D;  1Z7K B;  2NU0 I;  2OU2 A;  2YUU A;  5DAE A;  1S20 A;  2A20 A;  3E2I A;  1UUC A;  3OXG A;  1AN1 I;  2NU3 I;  1YU6 C;  1OMU A;  5HI7 A;  1UVG A;  2KMQ A;  1U5K A;  3TJQ A;  1IY6 A;  1OVO A;  3E59 A;  3FC3 A;  2K9H A;  1R0R I;  1M8C A;  4OVO A;  4E1P A;  1N13 A;  3PDN A;  3QAH A;  1XA6 A;  3UGI A;  2YQP A;  5CCM A;  4GI3 C;  2JZM A;  3HH2 C;  1FYB A;  2GIV A;  1SGD I;  3D00 A;  3UEY A;  1FAR A;  1BUS A;  1CGI I;  1DS3 I;  3OXL A;  1WGT A;  5FUX A;  1SGN I;  2UZ3 A;  1H0Z A;  5HQ8 A;  2ROW A;  1CHO I;  5JHW C;  1CGJ I;  1SGE I;  4DNC A;  2ORW A;  1LR9 A;  2QPO A;  1CT0 I;  1V1H A;  2LEO A;  1HEV A;  2PQ8 A;  5FUW A;  3OVO A;  1FY7 A;  2JXD A;  2M5X A;  2B0U C;  4L9M A;  3VE5 A;  2ENN A;  2CJS C;  1DS2 I;  3BJI A;  2GKR I;  2ERW A;  2N1A B;  2CWG A;  1TUR A;  1KMA A;  4UXH A;  1XX6 A;  2N52 A;  3R5A A;  3CXL A;  1WTJ A;  2ENZ A;  5E3Q A;  1K7T A;  1PCE A;  1MJ9 A;  1Y1C A;  2WCY A;  1M8B A;  2Y0M A;  2SGQ I;  1V1I A;  2WGC A;  1HDL A;  2LUY A;  4UXJ A;  2ARP F;  2SGF I;  1ULN A;  5EX0 A;  1ULK A;  1HJA I;  1WGC A;  2V1C C;  4MPI A;  1LR7 A;  3KY9 A;  4SGB I;  2OZU A;  1NUB A;  4UXI A;  2UVO A;  1W4R A;  4WP4 A;  2J87 A;  2L7X A;  1R79 A;  1SGY I;  1TOT A;  2E5R A;  2JW6 A;  1P9G A;  5J8F A;  1K7U A;  3TOA A;  3UEJ A;  3QWP A;  2OD1 A;  3FSY A;  2ELI A;  1XBT A;  1Y1B A;  1KBF A;  2FNF X;  5CCL A;  3MEK A;  1TBQ R;  4A24 A;  2ODD A;  1X4S A;  1SGP I;  2QQC A;  1YTP A;  1PTQ A;  2N17 A;  2L8E A;  2BUS A;  5FUV A;  1WKX A;  1TIH A;  2F3C I;  4E1R A;  2SGE I;  1TBN A;  1FAQ A;  5EX3 A;  1ULM A;  2DB6 A;  2GKT I;  3TO6 A;  1CT2 I;  1IW4 A;  7WGA A;  2CWH A;  3R5C A;  2JYY A;  1HPT A;  1K7V A;  2KMR A;  2J9R A;  2QQE A;  1Q9B A;  2P6A C;  2X3T A;  1TBO A;  3RU0 A;  1TUS A;  4B6D A;  5E3P A;  1Z2I A;  1IY5 A;  1PTR A;  2ORV A;  5J8C A;  1Y8F A;  3FSX A;  2N71 A;  1P9Z A;  1CSO I;  3SGQ I;  2KMO A;  3VDP A;  2LB7 A;  1CE3 A;  2X52 A;  2GKV A;  2XRC A;  4FKD A;  4AML A;  3TOB A;  3UGL A;  1X74 A;  2OVO A;  1OYV I;  1PJU A;  2KCX A;  3VDU A;  2DKV A;  1OMT A;  2RIJ A;  4JCV E;  1KBE A;  3UGD A;  1W3S A;  3B4V C;  2GVI A;  2V1C A;  1SGQ I;  2SGP I;  1RFH A;  2JA1 A;  2NU2 I;  3OXF A;  2B8T A;  1SGR I;  2E73 A;  9WGA A;  1TBR R;  1UHA A;  1PPF I;  5FUY A;  3GOX A;  2QQ0 A; 
#chains in the Genus database with same CATH homology
 1TGS I;  2NU1 I;  2VRW B;  3OL0 A;  2NU4 I;  2SGD I;  3SEK C;  1BMO A;  1UVF A;  3SGB I;  2DIP A;  3UFF A;  2W0T A;  2QQD A;  2KMP A;  1CT4 I;  1MT1 A;  2WVJ A;  2V53 A;  1LR8 A;  4HGU A;  1VDD A;  3QTL D;  1Z7K B;  2NU0 I;  2YUU A;  5DAE A;  3E2I A;  2A20 A;  3OXG A;  1UUC A;  1AN1 I;  2NU3 I;  1YU6 C;  1OMU A;  5HI7 A;  1UVG A;  2KMQ A;  1U5K A;  3TJQ A;  1IY6 A;  1OVO A;  3E59 A;  3FC3 A;  2K9H A;  1R0R I;  1M8C A;  4OVO A;  4E1P A;  1N13 A;  3PDN A;  1XA6 A;  3UGI A;  2YQP A;  5CCM A;  4GI3 C;  2JZM A;  3HH2 C;  1FYB A;  1SGD I;  3D00 A;  3UEY A;  1FAR A;  1BUS A;  1CGI I;  1DS3 I;  3OXL A;  5FUX A;  1SGN I;  2UZ3 A;  1H0Z A;  5HQ8 A;  2ROW A;  1CHO I;  5JHW C;  1CGJ I;  1SGE I;  2ORW A;  1LR9 A;  2QPO A;  1CT0 I;  1V1H A;  2LEO A;  5FUW A;  3OVO A;  2JXD A;  2M5X A;  2B0U C;  4L9M A;  3VE5 A;  2ENN A;  2CJS C;  1DS2 I;  3BJI A;  2GKR I;  2ERW A;  2N1A B;  1TUR A;  1KMA A;  4UXH A;  1XX6 A;  2N52 A;  3CXL A;  2ENZ A;  1PCE A;  1Y1C A;  2WCY A;  1M8B A;  2SGQ I;  1V1I A;  1HDL A;  2LUY A;  4UXJ A;  2ARP F;  2SGF I;  5EX0 A;  2V1C C;  1HJA I;  4SGB I;  1LR7 A;  3KY9 A;  1NUB A;  4UXI A;  1W4R A;  2J87 A;  2L7X A;  1R79 A;  1SGY I;  1TOT A;  2E5R A;  2JW6 A;  3UEJ A;  3QWP A;  2OD1 A;  2ELI A;  1XBT A;  1Y1B A;  1KBF A;  2FNF X;  5CCL A;  3MEK A;  1TBQ R;  4A24 A;  2ODD A;  1X4S A;  1SGP I;  2QQC A;  1YTP A;  1PTQ A;  2N17 A;  2L8E A;  2BUS A;  5FUV A;  1TIH A;  2F3C I;  4E1R A;  2SGE I;  1TBN A;  1FAQ A;  5EX3 A;  2DB6 A;  2GKT I;  1CT2 I;  1IW4 A;  2JYY A;  1HPT A;  2KMR A;  2QQE A;  2J9R A;  4B6D A;  2P6A C;  1TBO A;  3RU0 A;  1TUS A;  1IY5 A;  1PTR A;  2ORV A;  1Y8F A;  2N71 A;  1CSO I;  3SGQ I;  2KMO A;  3VDP A;  1CE3 A;  4FKD A;  2GKV A;  2XRC A;  3UGL A;  1X74 A;  2OVO A;  1OYV I;  1PJU A;  2KCX A;  3VDU A;  1OMT A;  4JCV E;  1KBE A;  3UGD A;  1W3S A;  3B4V C;  2GVI A;  2V1C A;  1SGQ I;  2SGP I;  1RFH A;  2JA1 A;  2NU2 I;  3OXF A;  2B8T A;  1SGR I;  2E73 A;  1TBR R;  1PPF I;  5FUY A;  3GOX A;  2QQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...