2DIPA

Solution structure of the zz domain of zinc finger swim domain containing protein 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLEEFKNSSKLVAAAEKERLDKHLGIPCNNCKQFPIEGKCYKCTECIEYHLCQECFDSYCHLSHTFTFREKRNQKWRSLEKRADEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger SWIM domain-containing protein 2
publication title Solution structure of the ZZ domain of Zinc finger SWIM domain containing protein 2
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2dipA01
2E5RA 2DIPA 1TOTA 2N1AB
chains in the Genus database with same CATH superfamily
2M5XA 1FY7A 1Y1BA 1WGTA 3QAHA 5HQ8A 2WVJA 2SGDI 3OXLA 2QQCA 3PDNA 5EX0A 1SGEI 2QQEA 5DAEA 2JYYA 2Y0MA 2W0TA 3QWPA 1SGDI 2NU2I 1K7TA 1S20A 1UUCA 1SGRI 1W4RA 2UVOA 2YQPA 3FSYA 4L9MA 1FYBA 1TBOA 3MEKA 3TO7A 1ULMA 4MPIA 4OVOA 2JA1A 3E59A 1IY6A 1Z2IA 3RU0A 1FAQA 4UXIA 1K7VA 2JXDA 3VDPA 1PTRA 2CJSC 1SGYI 9WGAA 1KBFA 1CGII 1MJBA 3B4VC 1LR9A 1CGJI 2GIVA 2LEOA 1ULNA 1WGCA 2UZ3A 1UHAA 2DKVA 3KY9A 2GKVA 2OU2A 1Y1CA 1X74A 1W3SA 2SGQI 2SGEI 3OVOA 2L8EA 3OXFA 1TBQR 1M8CA 2KMPA 2ENZA 1IW4A 1Y8FA 1YU6C 2OZUA 3TO9A 4A24A 1XBTA 2E5RA 2KMQA 4GI3C 3VDUA 2DB6A 3UEYA 1K7UA 1VDDA 1OVOA 2J9RA 2ROWA 1HDLA 2WGCA 1P9GA 2JW6A 2PQ8A 2QQ0A 2X52A 3OXGA 1SGPI 1M8BA 4WP4A 2L7XA 3HH2C 1LR8A 2NU1I 5CCLA 1X4SA 3CXLA 1CSOI 3QTLD 1SGNI 5FUXA 4E1PA 1V1IA 2GKRI 1BMOA 3R5DA 1OYVI 1WKXA 2E73A 4UXHA 2ARPF 2A20A 3TOAA 2RIJA 4E1RA 1Q9BA 3UGLA 2J87A 2ODDA 3UGIA 1P9ZA 2X3TA 2SGPI 3UEJA 4UXJA 1H0ZA 5CCMA 1OMUA 1KMAA 2N71A 3OL0A 3R5CA 1UVGA 1NXUA 1PPFI 2B0UC 2KMRA 2LUYA 2NU0I 2YUUA 2JZMA 3E2IA 1HPTA 3SEKC 1TBRR 2QQDA 2NU4I 1CHOI 2XRCA 1R79A 3GOXA 2QPOA 5EX3A 1HJAI 4FKDA 3SGBI 3SGQI 1WTJA 1CT4I 4SGBI 3TJQA 3FC3A 1MT1A 1R0RI 1Z7KB 1CT2I 2LB7A 2CWHA 1PCEA 1AN1I 1TOTA 1OMTA 1ULKA 1V1HA 1YTPA 5E3PA 5JHWC 1DS3I 2N52A 2ENNA 1TURA 2CWFA 2F3CI 2NU3I 5J8FA 5FUWA 1PTQA 1FARA 2WCYA 1TUSA 3UOEA 1U5KA 2VRWB 3UFFA 2SGFI 4DNCA 2ELIA 2N1AB 2K9HA 2GVIA 7WGAA 1MJAA 2ERWA 1TGSI 2OD1A 2RC4A 4AMLA 1KBEA 5HI7A 1RFHA 3TOBA 1N13A 1IY5A 2BUSA 1SGQI 3D00A 2N17A 2V1CA 1LR7A 2GKTI 2KMOA 1NUBA 1PJUA 2CWGA 4B6DA 1XA6A 2DIPA 2OVOA 3BJIA 3TO6A 3VE5A 2P6AC 2B8TA 2KCXA 2ORVA 2V53A 5E3RA 1CE3A 5J8CA 1UVFA 2ORWA 4JCVE 5FUVA 1BUSA 1CT0I 1XX6A 2V1CC 4HGUA 2FNFX 1MJ9A 5E3QA 5FUYA 3FSXA 3R5BA 1TIHA 3UGDA 1DS2I 1TBNA 3R5AA 1HEVA
chains in the Genus database with same CATH topology
2M5XA 1Y1BA 5HQ8A 2WVJA 2SGDI 3OXLA 2QQCA 3PDNA 5EX0A 1SGEI 2QQEA 5DAEA 2JYYA 2W0TA 3QWPA 1SGDI 2NU2I 1UUCA 1SGRI 1W4RA 2YQPA 1DS2I 4L9MA 1FYBA 1TBOA 3MEKA 4OVOA 2JA1A 3E59A 1IY6A 3RU0A 4UXIA 2JXDA 3VDPA 1PTRA 2CJSC 1SGYI 1KBFA 1CGII 3B4VC 1LR9A 1CGJI 2LEOA 2UZ3A 3KY9A 2GKVA 1Y1CA 1X74A 1W3SA 2SGQI 2SGEI 3OVOA 2L8EA 3OXFA 1TBQR 1M8CA 2KMPA 2ENZA 1IW4A 1Y8FA 1YU6C 4A24A 1XBTA 2E5RA 2KMQA 4GI3C 3VDUA 2DB6A 3UEYA 1VDDA 1OVOA 2J9RA 2ROWA 1HDLA 2JW6A 2QQ0A 3OXGA 1SGPI 1M8BA 2L7XA 3HH2C 1LR8A 2NU1I 5CCLA 1X4SA 3CXLA 1CSOI 3QTLD 1SGNI 5FUXA 4E1PA 1V1IA 2GKRI 1BMOA 4UXHA 1OYVI 2E73A 2ARPF 2A20A 4E1RA 3UGLA 2J87A 2ODDA 3UGIA 3UEJA 2SGPI 4UXJA 1H0ZA 5CCMA 1OMUA 1KMAA 2N71A 3OL0A 1UVGA 1PPFI 2B0UC 2KMRA 2NU0I 2LUYA 2YUUA 3E2IA 2JZMA 3SEKC 1HPTA 3UFFA 1TBRR 2QQDA 2NU4I 1CHOI 2XRCA 1R79A 3GOXA 2QPOA 5EX3A 1HJAI 4FKDA 3SGBI 3SGQI 1CT4I 4SGBI 3FC3A 1MT1A 1R0RI 1Z7KB 1CT2I 1FAQA 1PCEA 1AN1I 1TOTA 1YTPA 1OMTA 1V1HA 5JHWC 1DS3I 2N52A 2ENNA 1TURA 2NU3I 2F3CI 5FUWA 1PTQA 1FARA 2WCYA 1TUSA 1U5KA 2VRWB 2SGFI 2ELIA 2N1AB 2K9HA 2GVIA 2ERWA 1TGSI 2OD1A 1KBEA 5HI7A 1RFHA 1N13A 1IY5A 2BUSA 1SGQI 3D00A 2N17A 2V1CA 1LR7A 2GKTI 2KMOA 1NUBA 1PJUA 4B6DA 1XA6A 2DIPA 2OVOA 3BJIA 3VE5A 2P6AC 2B8TA 2KCXA 2ORVA 2V53A 1CE3A 1UVFA 2ORWA 4JCVE 5FUVA 1BUSA 1CT0I 2V1CC 4HGUA 2FNFX 5FUYA 3UGDA 1TIHA 1XX6A 1TBNA 3TJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5R A;  2DIP A;  1TOT A;  2N1A B; 
#chains in the Genus database with same CATH topology
 2M5X A;  1FY7 A;  1Y1B A;  1WGT A;  3QAH A;  5HQ8 A;  2WVJ A;  2SGD I;  3OXL A;  2QQC A;  3PDN A;  5EX0 A;  1SGE I;  2QQE A;  5DAE A;  2JYY A;  2Y0M A;  2W0T A;  3QWP A;  1SGD I;  2NU2 I;  1K7T A;  1S20 A;  1UUC A;  1SGR I;  1W4R A;  2UVO A;  2YQP A;  3FSY A;  4L9M A;  1FYB A;  1TBO A;  3MEK A;  3TO7 A;  1ULM A;  4MPI A;  4OVO A;  2JA1 A;  3E59 A;  1IY6 A;  1Z2I A;  3RU0 A;  1FAQ A;  4UXI A;  1K7V A;  2JXD A;  3VDP A;  1PTR A;  2CJS C;  1SGY I;  9WGA A;  1KBF A;  1CGI I;  1MJB A;  3B4V C;  1LR9 A;  1CGJ I;  2GIV A;  2LEO A;  1ULN A;  1WGC A;  2UZ3 A;  1UHA A;  2DKV A;  3KY9 A;  2GKV A;  2OU2 A;  1Y1C A;  1X74 A;  1W3S A;  2SGQ I;  2SGE I;  3OVO A;  2L8E A;  3OXF A;  1TBQ R;  1M8C A;  2KMP A;  2ENZ A;  1IW4 A;  1Y8F A;  1YU6 C;  2OZU A;  3TO9 A;  4A24 A;  1XBT A;  2E5R A;  2KMQ A;  4GI3 C;  3VDU A;  2DB6 A;  3UEY A;  1K7U A;  1VDD A;  1OVO A;  2J9R A;  2ROW A;  1HDL A;  2WGC A;  1P9G A;  2JW6 A;  2PQ8 A;  2QQ0 A;  2X52 A;  3OXG A;  1SGP I;  1M8B A;  4WP4 A;  2L7X A;  3HH2 C;  1LR8 A;  2NU1 I;  5CCL A;  1X4S A;  3CXL A;  1CSO I;  3QTL D;  1SGN I;  5FUX A;  4E1P A;  1V1I A;  2GKR I;  1BMO A;  3R5D A;  1OYV I;  1WKX A;  2E73 A;  4UXH A;  2ARP F;  2A20 A;  3TOA A;  2RIJ A;  4E1R A;  1Q9B A;  3UGL A;  2J87 A;  2ODD A;  3UGI A;  1P9Z A;  2X3T A;  2SGP I;  3UEJ A;  4UXJ A;  1H0Z A;  5CCM A;  1OMU A;  1KMA A;  2N71 A;  3OL0 A;  3R5C A;  1UVG A;  1NXU A;  1PPF I;  2B0U C;  2KMR A;  2LUY A;  2NU0 I;  2YUU A;  2JZM A;  3E2I A;  1HPT A;  3SEK C;  1TBR R;  2QQD A;  2NU4 I;  1CHO I;  2XRC A;  1R79 A;  3GOX A;  2QPO A;  5EX3 A;  1HJA I;  4FKD A;  3SGB I;  3SGQ I;  1WTJ A;  1CT4 I;  4SGB I;  3TJQ A;  3FC3 A;  1MT1 A;  1R0R I;  1Z7K B;  1CT2 I;  2LB7 A;  2CWH A;  1PCE A;  1AN1 I;  1TOT A;  1OMT A;  1ULK A;  1V1H A;  1YTP A;  5E3P A;  5JHW C;  1DS3 I;  2N52 A;  2ENN A;  1TUR A;  2CWF A;  2F3C I;  2NU3 I;  5J8F A;  5FUW A;  1PTQ A;  1FAR A;  2WCY A;  1TUS A;  3UOE A;  1U5K A;  2VRW B;  3UFF A;  2SGF I;  4DNC A;  2ELI A;  2N1A B;  2K9H A;  2GVI A;  7WGA A;  1MJA A;  2ERW A;  1TGS I;  2OD1 A;  2RC4 A;  4AML A;  1KBE A;  5HI7 A;  1RFH A;  3TOB A;  1N13 A;  1IY5 A;  2BUS A;  1SGQ I;  3D00 A;  2N17 A;  2V1C A;  1LR7 A;  2GKT I;  2KMO A;  1NUB A;  1PJU A;  2CWG A;  4B6D A;  1XA6 A;  2DIP A;  2OVO A;  3BJI A;  3TO6 A;  3VE5 A;  2P6A C;  2B8T A;  2KCX A;  2ORV A;  2V53 A;  5E3R A;  1CE3 A;  5J8C A;  1UVF A;  2ORW A;  4JCV E;  5FUV A;  1BUS A;  1CT0 I;  1XX6 A;  2V1C C;  4HGU A;  2FNF X;  1MJ9 A;  5E3Q A;  5FUY A;  3FSX A;  3R5B A;  1TIH A;  3UGD A;  1DS2 I;  1TBN A;  3R5A A;  1HEV A; 
#chains in the Genus database with same CATH homology
 2M5X A;  1Y1B A;  5HQ8 A;  2WVJ A;  2SGD I;  3OXL A;  2QQC A;  3PDN A;  5EX0 A;  1SGE I;  2QQE A;  5DAE A;  2JYY A;  2W0T A;  3QWP A;  1SGD I;  2NU2 I;  1UUC A;  1SGR I;  1W4R A;  2YQP A;  1DS2 I;  4L9M A;  1FYB A;  1TBO A;  3MEK A;  4OVO A;  2JA1 A;  3E59 A;  1IY6 A;  3RU0 A;  4UXI A;  2JXD A;  3VDP A;  1PTR A;  2CJS C;  1SGY I;  1KBF A;  1CGI I;  3B4V C;  1LR9 A;  1CGJ I;  2LEO A;  2UZ3 A;  3KY9 A;  2GKV A;  1Y1C A;  1X74 A;  1W3S A;  2SGQ I;  2SGE I;  3OVO A;  2L8E A;  3OXF A;  1TBQ R;  1M8C A;  2KMP A;  2ENZ A;  1IW4 A;  1Y8F A;  1YU6 C;  4A24 A;  1XBT A;  2E5R A;  2KMQ A;  4GI3 C;  3VDU A;  2DB6 A;  3UEY A;  1VDD A;  1OVO A;  2J9R A;  2ROW A;  1HDL A;  2JW6 A;  2QQ0 A;  3OXG A;  1SGP I;  1M8B A;  2L7X A;  3HH2 C;  1LR8 A;  2NU1 I;  5CCL A;  1X4S A;  3CXL A;  1CSO I;  3QTL D;  1SGN I;  5FUX A;  4E1P A;  1V1I A;  2GKR I;  1BMO A;  4UXH A;  1OYV I;  2E73 A;  2ARP F;  2A20 A;  4E1R A;  3UGL A;  2J87 A;  2ODD A;  3UGI A;  3UEJ A;  2SGP I;  4UXJ A;  1H0Z A;  5CCM A;  1OMU A;  1KMA A;  2N71 A;  3OL0 A;  1UVG A;  1PPF I;  2B0U C;  2KMR A;  2NU0 I;  2LUY A;  2YUU A;  3E2I A;  2JZM A;  3SEK C;  1HPT A;  3UFF A;  1TBR R;  2QQD A;  2NU4 I;  1CHO I;  2XRC A;  1R79 A;  3GOX A;  2QPO A;  5EX3 A;  1HJA I;  4FKD A;  3SGB I;  3SGQ I;  1CT4 I;  4SGB I;  3FC3 A;  1MT1 A;  1R0R I;  1Z7K B;  1CT2 I;  1FAQ A;  1PCE A;  1AN1 I;  1TOT A;  1YTP A;  1OMT A;  1V1H A;  5JHW C;  1DS3 I;  2N52 A;  2ENN A;  1TUR A;  2NU3 I;  2F3C I;  5FUW A;  1PTQ A;  1FAR A;  2WCY A;  1TUS A;  1U5K A;  2VRW B;  2SGF I;  2ELI A;  2N1A B;  2K9H A;  2GVI A;  2ERW A;  1TGS I;  2OD1 A;  1KBE A;  5HI7 A;  1RFH A;  1N13 A;  1IY5 A;  2BUS A;  1SGQ I;  3D00 A;  2N17 A;  2V1C A;  1LR7 A;  2GKT I;  2KMO A;  1NUB A;  1PJU A;  4B6D A;  1XA6 A;  2DIP A;  2OVO A;  3BJI A;  3VE5 A;  2P6A C;  2B8T A;  2KCX A;  2ORV A;  2V53 A;  1CE3 A;  1UVF A;  2ORW A;  4JCV E;  5FUV A;  1BUS A;  1CT0 I;  2V1C C;  4HGU A;  2FNF X;  5FUY A;  3UGD A;  1TIH A;  1XX6 A;  1TBN A;  3TJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...