2NU3I

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu3I00
1KMAA 2KMQA 1CGJI 1HPTA 3OVOA 3B4VC 2XRCA 2SGPI 1BUSA 1IY5A 2SGFI 1SGEI 2JZMA 1AN1I 2WCYA 4SGBI 3QTLD 1Y1CA 2JXDA 2KMOA 1SGQI 3SEKC 1TBRR 1SGPI 1PPFI 1Z7KB 1CT4I 3TJQA 1DS3I 1SGDI 1TIHA 1H0ZA 1PCEA 1FYBA 2KMRA 1CHOI 2SGQI 3SGQI 1UVFA 1UUCA 1YTPA 1DS2I 1YU6C 2M5XA 1HDLA 1BMOA 4OVOA 5DAEA 1LR9A 1M8CA 1SGRI 2V53A 5JHWC 2B0UC 2SGDI 2P6AC 2OVOA 1N13A 2GKTI 2N17A 1SGNI 2SGEI 1TUSA 1CSOI 1MT1A 1OVOA 1HJAI 2N52A 2QQDA 1CT0I 2LEOA 3SGBI 2KCXA 1TBQR 4HGUA 1CT2I 1LR7A 2NU0I 1PJUA 1OMUA 1UVGA 1NUBA 2F3CI 1TURA 2KMPA 2BUSA 2NU2I 1M8BA 2GKRI 1R0RI 1IW4A 1CGII 1OYVI 1OMTA 2QQCA 1IY6A 1CE3A 2GKVA 1LR8A 2JYYA 2NU3I 1SGYI 3HH2C 2ERWA 2ARPF 2N71A 2NU4I 1Y1BA 4GI3C 2NU1I 1TGSI
chains in the Genus database with same CATH superfamily
2LB7A 3GOXA 1WGCA 1FY7A 1V1HA 2WGCA 1ULNA 2PQ8A 1KMAA 2KMQA 1CGJI 1HPTA 3OVOA 3B4VC 1P9ZA 2XRCA 3BJIA 2SGPI 3R5BA 3TOBA 1BUSA 1TBNA 2UZ3A 3FSXA 1IY5A 2SGFI 1SGEI 2JZMA 1WTJA 2X52A 3R5DA 1AN1I 3R5CA 4JCVE 3RU0A 3FSYA 2WCYA 3TO7A 3UFFA 4SGBI 3UGIA 3QTLD 2ROWA 3UEYA 5J8CA 2CWGA 1Y1CA 2JXDA 2KMOA 1SGQI 2E73A 3UOEA 3SEKC 1TBRR 1SGPI 1Z2IA 1PPFI 2CWFA 1Z7KB 1CT4I 3TJQA 1XBTA 4WP4A 3UEJA 3TOAA 3E2IA 1DS3I 1SGDI 1TIHA 3R5AA 3PDNA 1Q9BA 2JA1A 4AMLA 1Y8FA 1ULMA 3OL0A 5FUVA 3UGLA 1H0ZA 1U5KA 5E3RA 1PCEA 3QWPA 2QQEA 1WGTA 1FYBA 2KMRA 1CHOI 1RFHA 3MEKA 2DKVA 2SGQI 3SGQI 3QAHA 1MJAA 1HEVA 1UVFA 1K7UA 2UVOA 2DIPA 4E1PA 1UUCA 1KBEA 2GIVA 2ENZA 2OZUA 5E3PA 1PTQA 3VDUA 5E3QA 2L8EA 1YTPA 1DS2I 1V1IA 1YU6C 2JW6A 2M5XA 2QPOA 4UXIA 1HDLA 1BMOA 4OVOA 5DAEA 1ULKA 2L7XA 2N1AB 2V1CA 3OXLA 1LR9A 2OD1A 1M8CA 5EX0A 2DB6A 1SGRI 5CCLA 3UGDA 3KY9A 2V53A 1KBFA 1XX6A 4FKDA 5FUWA 1WKXA 2B0UC 2Y0MA 4DNCA 5JHWC 2SGDI 1NXUA 2GVIA 1W3SA 2ORVA 2P6AC 2ENNA 2OVOA 4A24A 1MJBA 1N13A 1TOTA 1X4SA 9WGAA 3VE5A 1P9GA 2WVJA 2E5RA 2W0TA 2LUYA 5J8FA 2GKTI 2VRWB 1FAQA 2ODDA 2N17A 1SGNI 2SGEI 1TUSA 1CSOI 1MT1A 2CJSC 4UXHA 5FUXA 1OVOA 1HJAI 2N52A 2ORWA 2QQDA 2X3TA 1CT0I 7WGAA 2LEOA 4E1RA 3SGBI 4MPIA 3FC3A 2KCXA 1TBQR 4HGUA 5HQ8A 1XA6A 2K9HA 1CT2I 2V1CC 1R79A 1K7VA 1MJ9A 1LR7A 2J87A 1X74A 2J9RA 2NU0I 1PJUA 2RIJA 3TO9A 2YQPA 1UHAA 2RC4A 3TO6A 1OMUA 3OXFA 1UVGA 1NUBA 2F3CI 1TURA 2KMPA 2CWHA 2BUSA 2NU2I 1W4RA 3CXLA 4L9MA 5EX3A 1M8BA 4UXJA 1PTRA 4B6DA 5HI7A 2GKRI 1R0RI 1VDDA 1CGII 1OYVI 1IW4A 1OMTA 2QQCA 5CCMA 1IY6A 1FARA 1CE3A 3E59A 2GKVA 1LR8A 2JYYA 1S20A 2NU3I 2FNFX 2YUUA 1SGYI 3HH2C 3OXGA 2ERWA 2ARPF 2N71A 2QQ0A 2A20A 2B8TA 2OU2A 1TBOA 2NU4I 1Y1BA 3D00A 1K7TA 4GI3C 5FUYA 2NU1I 3VDPA 1TGSI 2ELIA
chains in the Genus database with same CATH topology
3GOXA 1V1HA 1KMAA 2KMQA 1CGJI 1HPTA 3OVOA 3B4VC 2XRCA 3BJIA 2SGPI 1BUSA 1TBNA 2UZ3A 1IY5A 2SGFI 1SGEI 2JZMA 1AN1I 4JCVE 3RU0A 2WCYA 3UFFA 4SGBI 3UGIA 3QTLD 2ROWA 3UEYA 1Y1CA 2JXDA 2KMOA 1SGQI 2E73A 3SEKC 1TBRR 1SGPI 1PPFI 1Z7KB 1CT4I 3TJQA 1XBTA 3UEJA 3E2IA 1DS3I 1SGDI 1TIHA 3PDNA 2JA1A 1Y8FA 3OL0A 5FUVA 3UGLA 1H0ZA 1U5KA 1PCEA 3QWPA 2QQEA 1FYBA 2KMRA 1CHOI 1RFHA 3MEKA 2SGQI 3SGQI 1UVFA 2DIPA 4E1PA 1UUCA 1KBEA 2ENZA 1PTQA 3VDUA 2L8EA 1YTPA 1DS2I 1V1IA 1YU6C 2JW6A 2M5XA 2QPOA 4UXIA 1HDLA 1BMOA 4OVOA 5DAEA 2L7XA 2N1AB 2V1CA 3OXLA 1LR9A 2OD1A 1M8CA 5EX0A 2DB6A 1SGRI 5CCLA 3UGDA 3KY9A 2V53A 1KBFA 1XX6A 4FKDA 5FUWA 5JHWC 2B0UC 2SGDI 2GVIA 1W3SA 2ORVA 2P6AC 2ENNA 2OVOA 4A24A 1N13A 1TOTA 1X4SA 3VE5A 2WVJA 2E5RA 2W0TA 2LUYA 1FAQA 2GKTI 2VRWB 2ODDA 2N17A 1SGNI 2SGEI 1TUSA 1CSOI 1MT1A 2CJSC 4UXHA 5FUXA 1OVOA 1HJAI 2N52A 2ORWA 2QQDA 1CT0I 2LEOA 4E1RA 3SGBI 3FC3A 2KCXA 1TBQR 4HGUA 5HQ8A 1XA6A 2K9HA 1CT2I 2V1CC 1R79A 1LR7A 2J87A 1X74A 2J9RA 2NU0I 1PJUA 2YQPA 1OMUA 3OXFA 1UVGA 1NUBA 2F3CI 1TURA 2KMPA 3CXLA 2BUSA 2NU2I 1W4RA 4L9MA 5EX3A 1M8BA 4UXJA 1PTRA 4B6DA 5HI7A 2GKRI 1R0RI 1VDDA 1CGII 1OYVI 1IW4A 1OMTA 2QQCA 5CCMA 1IY6A 1FARA 1CE3A 3E59A 2GKVA 1LR8A 2JYYA 2NU3I 2FNFX 2YUUA 1SGYI 3HH2C 3OXGA 2ERWA 2ARPF 2N71A 2QQ0A 2A20A 2B8TA 1TBOA 2NU4I 1Y1BA 3D00A 4GI3C 5FUYA 2NU1I 3VDPA 1TGSI 2ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMA A;  2KMQ A;  1CGJ I;  1HPT A;  3OVO A;  3B4V C;  2XRC A;  2SGP I;  1BUS A;  1IY5 A;  2SGF I;  1SGE I;  2JZM A;  1AN1 I;  2WCY A;  4SGB I;  3QTL D;  1Y1C A;  2JXD A;  2KMO A;  1SGQ I;  3SEK C;  1TBR R;  1SGP I;  1PPF I;  1Z7K B;  1CT4 I;  3TJQ A;  1DS3 I;  1SGD I;  1TIH A;  1H0Z A;  1PCE A;  1FYB A;  2KMR A;  1CHO I;  2SGQ I;  3SGQ I;  1UVF A;  1UUC A;  1YTP A;  1DS2 I;  1YU6 C;  2M5X A;  1HDL A;  1BMO A;  4OVO A;  5DAE A;  1LR9 A;  1M8C A;  1SGR I;  2V53 A;  5JHW C;  2B0U C;  2SGD I;  2P6A C;  2OVO A;  1N13 A;  2GKT I;  2N17 A;  1SGN I;  2SGE I;  1TUS A;  1CSO I;  1MT1 A;  1OVO A;  1HJA I;  2N52 A;  2QQD A;  1CT0 I;  2LEO A;  3SGB I;  2KCX A;  1TBQ R;  4HGU A;  1CT2 I;  1LR7 A;  2NU0 I;  1PJU A;  1OMU A;  1UVG A;  1NUB A;  2F3C I;  1TUR A;  2KMP A;  2BUS A;  2NU2 I;  1M8B A;  2GKR I;  1R0R I;  1IW4 A;  1CGI I;  1OYV I;  1OMT A;  2QQC A;  1IY6 A;  1CE3 A;  2GKV A;  1LR8 A;  2JYY A;  2NU3 I;  1SGY I;  3HH2 C;  2ERW A;  2ARP F;  2N71 A;  2NU4 I;  1Y1B A;  4GI3 C;  2NU1 I;  1TGS I; 
#chains in the Genus database with same CATH topology
 2LB7 A;  3GOX A;  1WGC A;  1FY7 A;  1V1H A;  2WGC A;  1ULN A;  2PQ8 A;  1KMA A;  2KMQ A;  1CGJ I;  1HPT A;  3OVO A;  3B4V C;  1P9Z A;  2XRC A;  3BJI A;  2SGP I;  3R5B A;  3TOB A;  1BUS A;  1TBN A;  2UZ3 A;  3FSX A;  1IY5 A;  2SGF I;  1SGE I;  2JZM A;  1WTJ A;  2X52 A;  3R5D A;  1AN1 I;  3R5C A;  4JCV E;  3RU0 A;  3FSY A;  2WCY A;  3TO7 A;  3UFF A;  4SGB I;  3UGI A;  3QTL D;  2ROW A;  3UEY A;  5J8C A;  2CWG A;  1Y1C A;  2JXD A;  2KMO A;  1SGQ I;  2E73 A;  3UOE A;  3SEK C;  1TBR R;  1SGP I;  1Z2I A;  1PPF I;  2CWF A;  1Z7K B;  1CT4 I;  3TJQ A;  1XBT A;  4WP4 A;  3UEJ A;  3TOA A;  3E2I A;  1DS3 I;  1SGD I;  1TIH A;  3R5A A;  3PDN A;  1Q9B A;  2JA1 A;  4AML A;  1Y8F A;  1ULM A;  3OL0 A;  5FUV A;  3UGL A;  1H0Z A;  1U5K A;  5E3R A;  1PCE A;  3QWP A;  2QQE A;  1WGT A;  1FYB A;  2KMR A;  1CHO I;  1RFH A;  3MEK A;  2DKV A;  2SGQ I;  3SGQ I;  3QAH A;  1MJA A;  1HEV A;  1UVF A;  1K7U A;  2UVO A;  2DIP A;  4E1P A;  1UUC A;  1KBE A;  2GIV A;  2ENZ A;  2OZU A;  5E3P A;  1PTQ A;  3VDU A;  5E3Q A;  2L8E A;  1YTP A;  1DS2 I;  1V1I A;  1YU6 C;  2JW6 A;  2M5X A;  2QPO A;  4UXI A;  1HDL A;  1BMO A;  4OVO A;  5DAE A;  1ULK A;  2L7X A;  2N1A B;  2V1C A;  3OXL A;  1LR9 A;  2OD1 A;  1M8C A;  5EX0 A;  2DB6 A;  1SGR I;  5CCL A;  3UGD A;  3KY9 A;  2V53 A;  1KBF A;  1XX6 A;  4FKD A;  5FUW A;  1WKX A;  2B0U C;  2Y0M A;  4DNC A;  5JHW C;  2SGD I;  1NXU A;  2GVI A;  1W3S A;  2ORV A;  2P6A C;  2ENN A;  2OVO A;  4A24 A;  1MJB A;  1N13 A;  1TOT A;  1X4S A;  9WGA A;  3VE5 A;  1P9G A;  2WVJ A;  2E5R A;  2W0T A;  2LUY A;  5J8F A;  2GKT I;  2VRW B;  1FAQ A;  2ODD A;  2N17 A;  1SGN I;  2SGE I;  1TUS A;  1CSO I;  1MT1 A;  2CJS C;  4UXH A;  5FUX A;  1OVO A;  1HJA I;  2N52 A;  2ORW A;  2QQD A;  2X3T A;  1CT0 I;  7WGA A;  2LEO A;  4E1R A;  3SGB I;  4MPI A;  3FC3 A;  2KCX A;  1TBQ R;  4HGU A;  5HQ8 A;  1XA6 A;  2K9H A;  1CT2 I;  2V1C C;  1R79 A;  1K7V A;  1MJ9 A;  1LR7 A;  2J87 A;  1X74 A;  2J9R A;  2NU0 I;  1PJU A;  2RIJ A;  3TO9 A;  2YQP A;  1UHA A;  2RC4 A;  3TO6 A;  1OMU A;  3OXF A;  1UVG A;  1NUB A;  2F3C I;  1TUR A;  2KMP A;  2CWH A;  2BUS A;  2NU2 I;  1W4R A;  3CXL A;  4L9M A;  5EX3 A;  1M8B A;  4UXJ A;  1PTR A;  4B6D A;  5HI7 A;  2GKR I;  1R0R I;  1VDD A;  1CGI I;  1OYV I;  1IW4 A;  1OMT A;  2QQC A;  5CCM A;  1IY6 A;  1FAR A;  1CE3 A;  3E59 A;  2GKV A;  1LR8 A;  2JYY A;  1S20 A;  2NU3 I;  2FNF X;  2YUU A;  1SGY I;  3HH2 C;  3OXG A;  2ERW A;  2ARP F;  2N71 A;  2QQ0 A;  2A20 A;  2B8T A;  2OU2 A;  1TBO A;  2NU4 I;  1Y1B A;  3D00 A;  1K7T A;  4GI3 C;  5FUY A;  2NU1 I;  3VDP A;  1TGS I;  2ELI A; 
#chains in the Genus database with same CATH homology
 3GOX A;  1V1H A;  1KMA A;  2KMQ A;  1CGJ I;  1HPT A;  3OVO A;  3B4V C;  2XRC A;  3BJI A;  2SGP I;  1BUS A;  1TBN A;  2UZ3 A;  1IY5 A;  2SGF I;  1SGE I;  2JZM A;  1AN1 I;  4JCV E;  3RU0 A;  2WCY A;  3UFF A;  4SGB I;  3UGI A;  3QTL D;  2ROW A;  3UEY A;  1Y1C A;  2JXD A;  2KMO A;  1SGQ I;  2E73 A;  3SEK C;  1TBR R;  1SGP I;  1PPF I;  1Z7K B;  1CT4 I;  3TJQ A;  1XBT A;  3UEJ A;  3E2I A;  1DS3 I;  1SGD I;  1TIH A;  3PDN A;  2JA1 A;  1Y8F A;  3OL0 A;  5FUV A;  3UGL A;  1H0Z A;  1U5K A;  1PCE A;  3QWP A;  2QQE A;  1FYB A;  2KMR A;  1CHO I;  1RFH A;  3MEK A;  2SGQ I;  3SGQ I;  1UVF A;  2DIP A;  4E1P A;  1UUC A;  1KBE A;  2ENZ A;  1PTQ A;  3VDU A;  2L8E A;  1YTP A;  1DS2 I;  1V1I A;  1YU6 C;  2JW6 A;  2M5X A;  2QPO A;  4UXI A;  1HDL A;  1BMO A;  4OVO A;  5DAE A;  2L7X A;  2N1A B;  2V1C A;  3OXL A;  1LR9 A;  2OD1 A;  1M8C A;  5EX0 A;  2DB6 A;  1SGR I;  5CCL A;  3UGD A;  3KY9 A;  2V53 A;  1KBF A;  1XX6 A;  4FKD A;  5FUW A;  5JHW C;  2B0U C;  2SGD I;  2GVI A;  1W3S A;  2ORV A;  2P6A C;  2ENN A;  2OVO A;  4A24 A;  1N13 A;  1TOT A;  1X4S A;  3VE5 A;  2WVJ A;  2E5R A;  2W0T A;  2LUY A;  1FAQ A;  2GKT I;  2VRW B;  2ODD A;  2N17 A;  1SGN I;  2SGE I;  1TUS A;  1CSO I;  1MT1 A;  2CJS C;  4UXH A;  5FUX A;  1OVO A;  1HJA I;  2N52 A;  2ORW A;  2QQD A;  1CT0 I;  2LEO A;  4E1R A;  3SGB I;  3FC3 A;  2KCX A;  1TBQ R;  4HGU A;  5HQ8 A;  1XA6 A;  2K9H A;  1CT2 I;  2V1C C;  1R79 A;  1LR7 A;  2J87 A;  1X74 A;  2J9R A;  2NU0 I;  1PJU A;  2YQP A;  1OMU A;  3OXF A;  1UVG A;  1NUB A;  2F3C I;  1TUR A;  2KMP A;  3CXL A;  2BUS A;  2NU2 I;  1W4R A;  4L9M A;  5EX3 A;  1M8B A;  4UXJ A;  1PTR A;  4B6D A;  5HI7 A;  2GKR I;  1R0R I;  1VDD A;  1CGI I;  1OYV I;  1IW4 A;  1OMT A;  2QQC A;  5CCM A;  1IY6 A;  1FAR A;  1CE3 A;  3E59 A;  2GKV A;  1LR8 A;  2JYY A;  2NU3 I;  2FNF X;  2YUU A;  1SGY I;  3HH2 C;  3OXG A;  2ERW A;  2ARP F;  2N71 A;  2QQ0 A;  2A20 A;  2B8T A;  1TBO A;  2NU4 I;  1Y1B A;  3D00 A;  4GI3 C;  5FUY A;  2NU1 I;  3VDP A;  1TGS I;  2ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...