2NU3I

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu3I00
2KMRA 1PPFI 1R0RI 2B0UC 1HDLA 1SGNI 2KMOA 1PCEA 2NU1I 2KMPA 2ERWA 2BUSA 1HJAI 2N17A 4HGUA 1N13A 2GKRI 1TBQR 1TURA 1LR9A 1TBRR 2GKVA 1OMUA 2SGPI 1H0ZA 1PJUA 1SGDI 1DS2I 1HPTA 2OVOA 1DS3I 1BUSA 1SGQI 2QQDA 1LR7A 3SEKC 1CT2I 1YTPA 1SGEI 1OYVI 2NU3I 2NU0I 3SGQI 2N71A 1CT4I 2NU2I 4GI3C 1M8CA 1CSOI 1CT0I 5JHWC 1Z7KB 4SGBI 1SGYI 2V53A 1MT1A 1TGSI 1UUCA 3QTLD 2SGEI 2JZMA 1AN1I 2GKTI 1BMOA 1OMTA 1IW4A 2SGQI 2NU4I 1CGII 4OVOA 1TUSA 1CHOI 1NUBA 1CE3A 1CGJI 2SGDI 1KMAA 1SGPI 2KMQA 1Y1BA 2F3CI 1IY6A 2LEOA 5DAEA 1Y1CA 3TJQA 3HH2C 2JXDA 2ARPF 1UVFA 2N52A 1YU6C 2QQCA 2JYYA 2M5XA 1OVOA 1IY5A 3OVOA 3B4VC 2KCXA 1FYBA 2WCYA 3SGBI 1SGRI 1LR8A 2XRCA 2P6AC 1M8BA 2SGFI 1UVGA 1TIHA
chains in the Genus database with same CATH superfamily
2KMRA 1KBFA 1PPFI 5FUYA 3TOBA 1R0RI 2B0UC 1UHAA 1HDLA 2DIPA 3TO6A 5EX3A 2J87A 2V1CC 1SGNI 2W0TA 3E59A 2K9HA 2KMOA 1PCEA 2NU1I 2KMPA 3OL0A 2ERWA 2BUSA 1HJAI 2N17A 2QQ0A 1K7VA 4UXIA 4HGUA 1MJBA 2VRWB 3E2IA 1N13A 2UZ3A 2GKRI 1TBQR 1TURA 2RIJA 3VDPA 1LR9A 1TBRR 1WTJA 4MPIA 1HEVA 1KBEA 1OMUA 1ULMA 1W4RA 2GKVA 2ROWA 2SGPI 3UGIA 2N1AB 1H0ZA 3FSYA 3UGDA 1PJUA 2GVIA 4E1RA 5J8FA 1SGDI 1S20A 2JA1A 9WGAA 2QPOA 5E3PA 3VDUA 3OXGA 5J8CA 1P9ZA 1DS2I 1HPTA 1TBNA 1TOTA 2OVOA 5FUXA 1DS3I 2OU2A 2V1CA 4L9MA 2QQEA 2ENNA 2UVOA 1BUSA 2FNFX 4B6DA 2YUUA 4E1PA 2JW6A 1SGQI 1X74A 1ULNA 2QQDA 1V1IA 1LR7A 3SEKC 1CT2I 1YTPA 2L7XA 1SGEI 1PTRA 1OYVI 1V1HA 3UOEA 1W3SA 1WKXA 3R5AA 2ENZA 5CCLA 2E73A 2NU3I 2X3TA 3UFFA 2CWHA 4UXHA 2NU0I 3FSXA 3TOAA 1MJ9A 3SGQI 2N71A 3CXLA 4AMLA 1CT4I 1R79A 2NU2I 3QAHA 1M8CA 1CSOI 1CT0I 4GI3C 4JCVE 1RFHA 4WP4A 1NXUA 5JHWC 1Z7KB 1K7TA 2J9RA 4SGBI 5E3QA 1SGYI 2A20A 2V53A 1XA6A 1MT1A 1TGSI 1UUCA 1P9GA 2LB7A 2PQ8A 3FC3A 3QTLD 2SGEI 2CWGA 2JZMA 1AN1I 1WGCA 2GKTI 1BMOA 1OMTA 3UEJA 1IW4A 2SGQI 1FARA 2YQPA 5EX0A 1MJAA 1XBTA 3TO7A 2NU4I 4FKDA 1CGII 5CCMA 1U5KA 4OVOA 3KY9A 1TUSA 1CHOI 1NUBA 1Y8FA 3MEKA 4DNCA 2ODDA 2E5RA 2WVJA 5HQ8A 3BJIA 2B8TA 3VE5A 2GIVA 3QWPA 3OXLA 1CE3A 1CGJI 2WGCA 2SGDI 1Q9BA 2LUYA 1SGPI 1ULKA 5E3RA 5FUWA 2KMQA 1KMAA 1Y1BA 2F3CI 2L8EA 3R5CA 3UEYA 2OD1A 1IY6A 2LEOA 1X4SA 1XX6A 1Y1CA 2OZUA 5DAEA 2Y0MA 3TJQA 1VDDA 2CWFA 2DB6A 1FAQA 1Z2IA 3HH2C 5HI7A 2JXDA 3OXFA 2ARPF 3TO9A 1UVFA 2N52A 2CJSC 3PDNA 3R5BA 4A24A 1YU6C 2QQCA 2JYYA 2DKVA 1OVOA 2M5XA 2ORWA 5FUVA 1IY5A 1WGTA 3UGLA 3OVOA 1PTQA 1FY7A 3GOXA 3B4VC 2KCXA 1FYBA 7WGAA 2WCYA 3R5DA 3SGBI 1K7UA 1SGRI 2X52A 1LR8A 2XRCA 3D00A 2P6AC 1M8BA 2ORVA 2ELIA 2RC4A 2SGFI 3RU0A 1UVGA 1TBOA 4UXJA 1TIHA
chains in the Genus database with same CATH topology
2KMRA 1KBFA 1PPFI 5FUYA 1R0RI 2B0UC 1HDLA 2DIPA 5EX3A 2J87A 2V1CC 1SGNI 2W0TA 3E59A 2K9HA 2KMOA 1PCEA 2NU1I 2KMPA 3OL0A 2ERWA 2BUSA 1HJAI 2N17A 2QQ0A 4UXIA 4HGUA 2VRWB 3E2IA 1N13A 2UZ3A 2GKRI 1TBQR 1TURA 3VDPA 1LR9A 1TBRR 1KBEA 1OMUA 1W4RA 2GKVA 2SGPI 2ROWA 3UGIA 2N1AB 1H0ZA 3UGDA 1PJUA 2GVIA 4E1RA 1SGDI 2JA1A 2QPOA 3VDUA 3OXGA 1DS2I 1HPTA 1TBNA 1TOTA 2OVOA 5FUXA 1DS3I 2V1CA 4L9MA 2QQEA 2ENNA 1BUSA 2FNFX 4B6DA 2YUUA 4E1PA 2JW6A 1SGQI 1X74A 2QQDA 1V1IA 1LR7A 3SEKC 1CT2I 1YTPA 2L7XA 1SGEI 1PTRA 1OYVI 1V1HA 1W3SA 2ENZA 5CCLA 2E73A 2NU3I 3UFFA 4UXHA 2NU0I 3SGQI 2N71A 3CXLA 1CT4I 1R79A 2NU2I 4GI3C 1M8CA 1CSOI 1CT0I 4JCVE 1RFHA 5JHWC 1Z7KB 2J9RA 4SGBI 1SGYI 2A20A 2V53A 1XA6A 1MT1A 1TGSI 1UUCA 3FC3A 3QTLD 2SGEI 2JZMA 1AN1I 2GKTI 1BMOA 1OMTA 3UEJA 1IW4A 2SGQI 1FARA 2YQPA 5EX0A 1XBTA 2NU4I 4FKDA 1CGII 5CCMA 1U5KA 4OVOA 3KY9A 1TUSA 1CHOI 1NUBA 1Y8FA 3MEKA 2ODDA 2E5RA 2WVJA 5HQ8A 3BJIA 2B8TA 3VE5A 3QWPA 3OXLA 1CE3A 1CGJI 2SGDI 5FUWA 2LUYA 1SGPI 1KMAA 2KMQA 1Y1BA 2F3CI 2L8EA 3UEYA 2OD1A 1IY6A 2LEOA 1X4SA 1XX6A 1Y1CA 5DAEA 3TJQA 1VDDA 2DB6A 1FAQA 3HH2C 5HI7A 2JXDA 3OXFA 2ARPF 1UVFA 2N52A 2CJSC 3PDNA 4A24A 1YU6C 2QQCA 2JYYA 2M5XA 1OVOA 2ORWA 5FUVA 1IY5A 3UGLA 3OVOA 1PTQA 3GOXA 3B4VC 2KCXA 1FYBA 2WCYA 3SGBI 1SGRI 1LR8A 2XRCA 3D00A 2P6AC 1M8BA 2ORVA 2ELIA 2SGFI 3RU0A 1UVGA 1TBOA 4UXJA 1TIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMR A;  1PPF I;  1R0R I;  2B0U C;  1HDL A;  1SGN I;  2KMO A;  1PCE A;  2NU1 I;  2KMP A;  2ERW A;  2BUS A;  1HJA I;  2N17 A;  4HGU A;  1N13 A;  2GKR I;  1TBQ R;  1TUR A;  1LR9 A;  1TBR R;  2GKV A;  1OMU A;  2SGP I;  1H0Z A;  1PJU A;  1SGD I;  1DS2 I;  1HPT A;  2OVO A;  1DS3 I;  1BUS A;  1SGQ I;  2QQD A;  1LR7 A;  3SEK C;  1CT2 I;  1YTP A;  1SGE I;  1OYV I;  2NU3 I;  2NU0 I;  3SGQ I;  2N71 A;  1CT4 I;  2NU2 I;  4GI3 C;  1M8C A;  1CSO I;  1CT0 I;  5JHW C;  1Z7K B;  4SGB I;  1SGY I;  2V53 A;  1MT1 A;  1TGS I;  1UUC A;  3QTL D;  2SGE I;  2JZM A;  1AN1 I;  2GKT I;  1BMO A;  1OMT A;  1IW4 A;  2SGQ I;  2NU4 I;  1CGI I;  4OVO A;  1TUS A;  1CHO I;  1NUB A;  1CE3 A;  1CGJ I;  2SGD I;  1KMA A;  1SGP I;  2KMQ A;  1Y1B A;  2F3C I;  1IY6 A;  2LEO A;  5DAE A;  1Y1C A;  3TJQ A;  3HH2 C;  2JXD A;  2ARP F;  1UVF A;  2N52 A;  1YU6 C;  2QQC A;  2JYY A;  2M5X A;  1OVO A;  1IY5 A;  3OVO A;  3B4V C;  2KCX A;  1FYB A;  2WCY A;  3SGB I;  1SGR I;  1LR8 A;  2XRC A;  2P6A C;  1M8B A;  2SGF I;  1UVG A;  1TIH A; 
#chains in the Genus database with same CATH topology
 2KMR A;  1KBF A;  1PPF I;  5FUY A;  3TOB A;  1R0R I;  2B0U C;  1UHA A;  1HDL A;  2DIP A;  3TO6 A;  5EX3 A;  2J87 A;  2V1C C;  1SGN I;  2W0T A;  3E59 A;  2K9H A;  2KMO A;  1PCE A;  2NU1 I;  2KMP A;  3OL0 A;  2ERW A;  2BUS A;  1HJA I;  2N17 A;  2QQ0 A;  1K7V A;  4UXI A;  4HGU A;  1MJB A;  2VRW B;  3E2I A;  1N13 A;  2UZ3 A;  2GKR I;  1TBQ R;  1TUR A;  2RIJ A;  3VDP A;  1LR9 A;  1TBR R;  1WTJ A;  4MPI A;  1HEV A;  1KBE A;  1OMU A;  1ULM A;  1W4R A;  2GKV A;  2ROW A;  2SGP I;  3UGI A;  2N1A B;  1H0Z A;  3FSY A;  3UGD A;  1PJU A;  2GVI A;  4E1R A;  5J8F A;  1SGD I;  1S20 A;  2JA1 A;  9WGA A;  2QPO A;  5E3P A;  3VDU A;  3OXG A;  5J8C A;  1P9Z A;  1DS2 I;  1HPT A;  1TBN A;  1TOT A;  2OVO A;  5FUX A;  1DS3 I;  2OU2 A;  2V1C A;  4L9M A;  2QQE A;  2ENN A;  2UVO A;  1BUS A;  2FNF X;  4B6D A;  2YUU A;  4E1P A;  2JW6 A;  1SGQ I;  1X74 A;  1ULN A;  2QQD A;  1V1I A;  1LR7 A;  3SEK C;  1CT2 I;  1YTP A;  2L7X A;  1SGE I;  1PTR A;  1OYV I;  1V1H A;  3UOE A;  1W3S A;  1WKX A;  3R5A A;  2ENZ A;  5CCL A;  2E73 A;  2NU3 I;  2X3T A;  3UFF A;  2CWH A;  4UXH A;  2NU0 I;  3FSX A;  3TOA A;  1MJ9 A;  3SGQ I;  2N71 A;  3CXL A;  4AML A;  1CT4 I;  1R79 A;  2NU2 I;  3QAH A;  1M8C A;  1CSO I;  1CT0 I;  4GI3 C;  4JCV E;  1RFH A;  4WP4 A;  1NXU A;  5JHW C;  1Z7K B;  1K7T A;  2J9R A;  4SGB I;  5E3Q A;  1SGY I;  2A20 A;  2V53 A;  1XA6 A;  1MT1 A;  1TGS I;  1UUC A;  1P9G A;  2LB7 A;  2PQ8 A;  3FC3 A;  3QTL D;  2SGE I;  2CWG A;  2JZM A;  1AN1 I;  1WGC A;  2GKT I;  1BMO A;  1OMT A;  3UEJ A;  1IW4 A;  2SGQ I;  1FAR A;  2YQP A;  5EX0 A;  1MJA A;  1XBT A;  3TO7 A;  2NU4 I;  4FKD A;  1CGI I;  5CCM A;  1U5K A;  4OVO A;  3KY9 A;  1TUS A;  1CHO I;  1NUB A;  1Y8F A;  3MEK A;  4DNC A;  2ODD A;  2E5R A;  2WVJ A;  5HQ8 A;  3BJI A;  2B8T A;  3VE5 A;  2GIV A;  3QWP A;  3OXL A;  1CE3 A;  1CGJ I;  2WGC A;  2SGD I;  1Q9B A;  2LUY A;  1SGP I;  1ULK A;  5E3R A;  5FUW A;  2KMQ A;  1KMA A;  1Y1B A;  2F3C I;  2L8E A;  3R5C A;  3UEY A;  2OD1 A;  1IY6 A;  2LEO A;  1X4S A;  1XX6 A;  1Y1C A;  2OZU A;  5DAE A;  2Y0M A;  3TJQ A;  1VDD A;  2CWF A;  2DB6 A;  1FAQ A;  1Z2I A;  3HH2 C;  5HI7 A;  2JXD A;  3OXF A;  2ARP F;  3TO9 A;  1UVF A;  2N52 A;  2CJS C;  3PDN A;  3R5B A;  4A24 A;  1YU6 C;  2QQC A;  2JYY A;  2DKV A;  1OVO A;  2M5X A;  2ORW A;  5FUV A;  1IY5 A;  1WGT A;  3UGL A;  3OVO A;  1PTQ A;  1FY7 A;  3GOX A;  3B4V C;  2KCX A;  1FYB A;  7WGA A;  2WCY A;  3R5D A;  3SGB I;  1K7U A;  1SGR I;  2X52 A;  1LR8 A;  2XRC A;  3D00 A;  2P6A C;  1M8B A;  2ORV A;  2ELI A;  2RC4 A;  2SGF I;  3RU0 A;  1UVG A;  1TBO A;  4UXJ A;  1TIH A; 
#chains in the Genus database with same CATH homology
 2KMR A;  1KBF A;  1PPF I;  5FUY A;  1R0R I;  2B0U C;  1HDL A;  2DIP A;  5EX3 A;  2J87 A;  2V1C C;  1SGN I;  2W0T A;  3E59 A;  2K9H A;  2KMO A;  1PCE A;  2NU1 I;  2KMP A;  3OL0 A;  2ERW A;  2BUS A;  1HJA I;  2N17 A;  2QQ0 A;  4UXI A;  4HGU A;  2VRW B;  3E2I A;  1N13 A;  2UZ3 A;  2GKR I;  1TBQ R;  1TUR A;  3VDP A;  1LR9 A;  1TBR R;  1KBE A;  1OMU A;  1W4R A;  2GKV A;  2SGP I;  2ROW A;  3UGI A;  2N1A B;  1H0Z A;  3UGD A;  1PJU A;  2GVI A;  4E1R A;  1SGD I;  2JA1 A;  2QPO A;  3VDU A;  3OXG A;  1DS2 I;  1HPT A;  1TBN A;  1TOT A;  2OVO A;  5FUX A;  1DS3 I;  2V1C A;  4L9M A;  2QQE A;  2ENN A;  1BUS A;  2FNF X;  4B6D A;  2YUU A;  4E1P A;  2JW6 A;  1SGQ I;  1X74 A;  2QQD A;  1V1I A;  1LR7 A;  3SEK C;  1CT2 I;  1YTP A;  2L7X A;  1SGE I;  1PTR A;  1OYV I;  1V1H A;  1W3S A;  2ENZ A;  5CCL A;  2E73 A;  2NU3 I;  3UFF A;  4UXH A;  2NU0 I;  3SGQ I;  2N71 A;  3CXL A;  1CT4 I;  1R79 A;  2NU2 I;  4GI3 C;  1M8C A;  1CSO I;  1CT0 I;  4JCV E;  1RFH A;  5JHW C;  1Z7K B;  2J9R A;  4SGB I;  1SGY I;  2A20 A;  2V53 A;  1XA6 A;  1MT1 A;  1TGS I;  1UUC A;  3FC3 A;  3QTL D;  2SGE I;  2JZM A;  1AN1 I;  2GKT I;  1BMO A;  1OMT A;  3UEJ A;  1IW4 A;  2SGQ I;  1FAR A;  2YQP A;  5EX0 A;  1XBT A;  2NU4 I;  4FKD A;  1CGI I;  5CCM A;  1U5K A;  4OVO A;  3KY9 A;  1TUS A;  1CHO I;  1NUB A;  1Y8F A;  3MEK A;  2ODD A;  2E5R A;  2WVJ A;  5HQ8 A;  3BJI A;  2B8T A;  3VE5 A;  3QWP A;  3OXL A;  1CE3 A;  1CGJ I;  2SGD I;  5FUW A;  2LUY A;  1SGP I;  1KMA A;  2KMQ A;  1Y1B A;  2F3C I;  2L8E A;  3UEY A;  2OD1 A;  1IY6 A;  2LEO A;  1X4S A;  1XX6 A;  1Y1C A;  5DAE A;  3TJQ A;  1VDD A;  2DB6 A;  1FAQ A;  3HH2 C;  5HI7 A;  2JXD A;  3OXF A;  2ARP F;  1UVF A;  2N52 A;  2CJS C;  3PDN A;  4A24 A;  1YU6 C;  2QQC A;  2JYY A;  2M5X A;  1OVO A;  2ORW A;  5FUV A;  1IY5 A;  3UGL A;  3OVO A;  1PTQ A;  3GOX A;  3B4V C;  2KCX A;  1FYB A;  2WCY A;  3SGB I;  1SGR I;  1LR8 A;  2XRC A;  3D00 A;  2P6A C;  1M8B A;  2ORV A;  2ELI A;  2SGF I;  3RU0 A;  1UVG A;  1TBO A;  4UXJ A;  1TIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...