1CT2I

Crystal structure of the omtky3 p1 variant omtky3-thr18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct2I00
2NU1I 2QQCA 2JXDA 1HPTA 1DS2I 2NU2I 1OYVI 1AN1I 2SGDI 1N13A 2V53A 1Y1BA 1SGDI 3HH2C 2ERWA 2M5XA 1SGYI 2XRCA 2QQDA 1Y1CA 2SGFI 3SGQI 3TJQA 1SGEI 2NU4I 1UUCA 3SGBI 2N71A 2NU3I 1SGQI 1LR9A 1SGPI 4HGUA 2F3CI 2P6AC 2WCYA 1CT0I 1OMUA 1Z7KB 1TURA 4OVOA 1H0ZA 2KMQA 2KMPA 1IW4A 1PCEA 5JHWC 3QTLD 1PJUA 2JZMA 1BUSA 2N17A 1CT4I 1TBQR 2KMOA 1YTPA 2SGEI 1CGJI 1LR8A 2JYYA 1LR7A 1SGRI 2ARPF 5DAEA 1KMAA 1CT2I 1NUBA 1M8CA 1IY5A 1CSOI 1IY6A 1MT1A 3B4VC 2SGQI 3OVOA 1R0RI 4GI3C 1M8BA 2OVOA 4SGBI 1TIHA 1TGSI 2NU0I 1OMTA 2SGPI 1CHOI 1UVFA 1CE3A 3SEKC 1CGII 1PPFI 2BUSA 1HJAI 1TBRR 2B0UC 2GKTI 1DS3I 2GKVA 2KCXA 1TUSA 1BMOA 1UVGA 2LEOA 1FYBA 2GKRI 2N52A 2KMRA 1YU6C 1OVOA 1HDLA 1SGNI
chains in the Genus database with same CATH superfamily
5CCMA 2NU1I 2QQCA 2V1CC 1FYBA 3OXFA 3UGLA 2JXDA 1HPTA 1DS2I 1KBEA 1WGTA 2NU2I 2V1CA 1TOTA 4AMLA 1OYVI 1AN1I 2SGDI 1MJ9A 1N13A 2ENNA 2J87A 2V53A 2ENZA 2QQEA 1Y1BA 1SGDI 3HH2C 2ERWA 2M5XA 1SGYI 2XRCA 3OL0A 3VE5A 2QQDA 1Y1CA 2ORVA 4JCVE 1RFHA 1XBTA 2CWGA 2UVOA 4E1PA 2RIJA 2SGFI 3SGQI 1FY7A 4FKDA 1HEVA 1W3SA 3MEKA 3TJQA 1SGEI 2RC4A 2GIVA 2NU4I 1UUCA 3SGBI 2X52A 5J8CA 2J9RA 2N71A 4MPIA 4UXIA 1WGCA 1SGQI 1PTRA 1X4SA 2K9HA 1LR9A 1SGPI 1K7TA 2NU3I 2WGCA 2F3CI 4HGUA 2P6AC 2WCYA 1TBNA 1XX6A 1CT0I 3UFFA 1R79A 1OMUA 5FUWA 1Q9BA 1KBFA 1U5KA 1Z7KB 1TURA 3TOAA 3E59A 4OVOA 2DIPA 3FSYA 4WP4A 1H0ZA 2KMQA 9WGAA 5HI7A 2KMPA 1IW4A 1MJBA 3BJIA 1PCEA 5JHWC 3GOXA 2YUUA 3QTLD 5EX0A 1PJUA 5HQ8A 1UHAA 1ULKA 3KY9A 4L9MA 5E3QA 2CWHA 5J8FA 2L7XA 2JA1A 1K7UA 2ELIA 2JZMA 3R5CA 2LB7A 1BUSA 5E3RA 2N17A 1CT4I 2FNFX 1WKXA 1TBQR 3UEYA 1VDDA 2KMOA 1YTPA 3TOBA 2SGEI 3VDUA 2B8TA 1CGJI 2N1AB 2OZUA 2E73A 2ODDA 2E5RA 5FUYA 3RU0A 3CXLA 1LR8A 2JYYA 1LR7A 3UOEA 1SGRI 2ARPF 2Y0MA 2A20A 5DAEA 7WGAA 1ULMA 1Y8FA 2DB6A 2W0TA 1CT2I 3FC3A 1KMAA 1NUBA 3D00A 3QWPA 1M8CA 1K7VA 1W4RA 2X3TA 4UXJA 1IY5A 1MJAA 2OU2A 1V1IA 1CSOI 2LUYA 3R5DA 1MT1A 3B4VC 4DNCA 2SGQI 4E1RA 3R5AA 1FARA 4A24A 1IY6A 3OVOA 1R0RI 1NXUA 1XA6A 4GI3C 1M8BA 2WVJA 2GVIA 2OD1A 3UEJA 3UGIA 2OVOA 2QPOA 4SGBI 1FAQA 1TIHA 1TGSI 2NU0I 1OMTA 3VDPA 2ORWA 2SGPI 3OXGA 1CHOI 1UVFA 1CE3A 3SEKC 1CGII 1PPFI 1P9GA 2YQPA 5CCLA 1TBOA 1ULNA 1X74A 1S20A 2BUSA 2L8EA 1HJAI 1TBRR 2DKVA 2B0UC 2CWFA 2GKTI 1WTJA 1DS3I 2QQ0A 2GKVA 3QAHA 2CJSC 3PDNA 4UXHA 2PQ8A 5E3PA 5FUVA 5FUXA 2KCXA 1TUSA 4B6DA 1BMOA 1UVGA 3TO7A 1V1HA 1PTQA 1Z2IA 2LEOA 3R5BA 2GKRI 2N52A 2VRWB 2JW6A 3FSXA 3UGDA 1P9ZA 2KMRA 1YU6C 3E2IA 3OXLA 3TO9A 1OVOA 5EX3A 2UZ3A 3TO6A 2ROWA 1HDLA 1SGNI
chains in the Genus database with same CATH topology
5CCMA 2NU1I 2QQCA 2V1CC 3OXFA 3UGLA 2JXDA 1HPTA 1DS2I 1KBEA 2NU2I 2V1CA 1TOTA 1OYVI 1AN1I 2SGDI 2J87A 1N13A 2ENNA 2V53A 2ENZA 2QQEA 1Y1BA 1SGDI 3HH2C 2ERWA 2M5XA 1SGYI 2XRCA 3OL0A 3VE5A 2QQDA 1Y1CA 2ORVA 4JCVE 1RFHA 1XBTA 4E1PA 2SGFI 3SGQI 4FKDA 1W3SA 3MEKA 3TJQA 1SGEI 2NU4I 1UUCA 3SGBI 2J9RA 2N71A 4UXIA 2NU3I 1SGQI 1PTRA 1X4SA 2K9HA 1LR9A 1SGPI 3UGIA 4HGUA 2F3CI 2P6AC 2WCYA 1TBNA 1XX6A 1CT0I 3UFFA 1R79A 1OMUA 5FUWA 1KBFA 1U5KA 1Z7KB 1TURA 3E59A 4OVOA 2DIPA 1H0ZA 2KMQA 5HI7A 2KMPA 1IW4A 3BJIA 1PCEA 5JHWC 3GOXA 2YUUA 3QTLD 5EX0A 1PJUA 5HQ8A 3KY9A 4L9MA 2L7XA 2JA1A 2ELIA 2JZMA 1BUSA 2N17A 1CT4I 2FNFX 1TBQR 3UEYA 1VDDA 2KMOA 1YTPA 2SGEI 3VDUA 2B8TA 1CGJI 2N1AB 5FUYA 2E73A 2ODDA 2E5RA 3RU0A 3CXLA 1LR8A 2JYYA 1LR7A 1SGRI 2ARPF 5DAEA 2A20A 2W0TA 1Y8FA 2DB6A 3FC3A 1CT2I 1KMAA 1NUBA 3D00A 3QWPA 1M8CA 4UXJA 1W4RA 1IY5A 1V1IA 1CSOI 2LUYA 1IY6A 1MT1A 3B4VC 4E1RA 2SGQI 1FARA 4A24A 3OVOA 1R0RI 1XA6A 4GI3C 1M8BA 2WVJA 2GVIA 2OD1A 3UEJA 2OVOA 2QPOA 4SGBI 1FAQA 1TIHA 1TGSI 2NU0I 1OMTA 3VDPA 2ORWA 2SGPI 3OXGA 1CHOI 1UVFA 1CE3A 3SEKC 1CGII 1PPFI 5CCLA 2YQPA 1TBOA 1X74A 2BUSA 2L8EA 1HJAI 1TBRR 2B0UC 2GKTI 1DS3I 2QQ0A 2GKVA 2CJSC 3PDNA 4UXHA 5FUVA 5FUXA 2KCXA 1TUSA 4B6DA 1BMOA 1UVGA 1V1HA 1PTQA 3UGDA 2LEOA 1FYBA 2GKRI 2N52A 2VRWB 2JW6A 2KMRA 1YU6C 3E2IA 3OXLA 1OVOA 5EX3A 2UZ3A 2ROWA 1HDLA 1SGNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NU1 I;  2QQC A;  2JXD A;  1HPT A;  1DS2 I;  2NU2 I;  1OYV I;  1AN1 I;  2SGD I;  1N13 A;  2V53 A;  1Y1B A;  1SGD I;  3HH2 C;  2ERW A;  2M5X A;  1SGY I;  2XRC A;  2QQD A;  1Y1C A;  2SGF I;  3SGQ I;  3TJQ A;  1SGE I;  2NU4 I;  1UUC A;  3SGB I;  2N71 A;  2NU3 I;  1SGQ I;  1LR9 A;  1SGP I;  4HGU A;  2F3C I;  2P6A C;  2WCY A;  1CT0 I;  1OMU A;  1Z7K B;  1TUR A;  4OVO A;  1H0Z A;  2KMQ A;  2KMP A;  1IW4 A;  1PCE A;  5JHW C;  3QTL D;  1PJU A;  2JZM A;  1BUS A;  2N17 A;  1CT4 I;  1TBQ R;  2KMO A;  1YTP A;  2SGE I;  1CGJ I;  1LR8 A;  2JYY A;  1LR7 A;  1SGR I;  2ARP F;  5DAE A;  1KMA A;  1CT2 I;  1NUB A;  1M8C A;  1IY5 A;  1CSO I;  1IY6 A;  1MT1 A;  3B4V C;  2SGQ I;  3OVO A;  1R0R I;  4GI3 C;  1M8B A;  2OVO A;  4SGB I;  1TIH A;  1TGS I;  2NU0 I;  1OMT A;  2SGP I;  1CHO I;  1UVF A;  1CE3 A;  3SEK C;  1CGI I;  1PPF I;  2BUS A;  1HJA I;  1TBR R;  2B0U C;  2GKT I;  1DS3 I;  2GKV A;  2KCX A;  1TUS A;  1BMO A;  1UVG A;  2LEO A;  1FYB A;  2GKR I;  2N52 A;  2KMR A;  1YU6 C;  1OVO A;  1HDL A;  1SGN I; 
#chains in the Genus database with same CATH topology
 5CCM A;  2NU1 I;  2QQC A;  2V1C C;  1FYB A;  3OXF A;  3UGL A;  2JXD A;  1HPT A;  1DS2 I;  1KBE A;  1WGT A;  2NU2 I;  2V1C A;  1TOT A;  4AML A;  1OYV I;  1AN1 I;  2SGD I;  1MJ9 A;  1N13 A;  2ENN A;  2J87 A;  2V53 A;  2ENZ A;  2QQE A;  1Y1B A;  1SGD I;  3HH2 C;  2ERW A;  2M5X A;  1SGY I;  2XRC A;  3OL0 A;  3VE5 A;  2QQD A;  1Y1C A;  2ORV A;  4JCV E;  1RFH A;  1XBT A;  2CWG A;  2UVO A;  4E1P A;  2RIJ A;  2SGF I;  3SGQ I;  1FY7 A;  4FKD A;  1HEV A;  1W3S A;  3MEK A;  3TJQ A;  1SGE I;  2RC4 A;  2GIV A;  2NU4 I;  1UUC A;  3SGB I;  2X52 A;  5J8C A;  2J9R A;  2N71 A;  4MPI A;  4UXI A;  1WGC A;  1SGQ I;  1PTR A;  1X4S A;  2K9H A;  1LR9 A;  1SGP I;  1K7T A;  2NU3 I;  2WGC A;  2F3C I;  4HGU A;  2P6A C;  2WCY A;  1TBN A;  1XX6 A;  1CT0 I;  3UFF A;  1R79 A;  1OMU A;  5FUW A;  1Q9B A;  1KBF A;  1U5K A;  1Z7K B;  1TUR A;  3TOA A;  3E59 A;  4OVO A;  2DIP A;  3FSY A;  4WP4 A;  1H0Z A;  2KMQ A;  9WGA A;  5HI7 A;  2KMP A;  1IW4 A;  1MJB A;  3BJI A;  1PCE A;  5JHW C;  3GOX A;  2YUU A;  3QTL D;  5EX0 A;  1PJU A;  5HQ8 A;  1UHA A;  1ULK A;  3KY9 A;  4L9M A;  5E3Q A;  2CWH A;  5J8F A;  2L7X A;  2JA1 A;  1K7U A;  2ELI A;  2JZM A;  3R5C A;  2LB7 A;  1BUS A;  5E3R A;  2N17 A;  1CT4 I;  2FNF X;  1WKX A;  1TBQ R;  3UEY A;  1VDD A;  2KMO A;  1YTP A;  3TOB A;  2SGE I;  3VDU A;  2B8T A;  1CGJ I;  2N1A B;  2OZU A;  2E73 A;  2ODD A;  2E5R A;  5FUY A;  3RU0 A;  3CXL A;  1LR8 A;  2JYY A;  1LR7 A;  3UOE A;  1SGR I;  2ARP F;  2Y0M A;  2A20 A;  5DAE A;  7WGA A;  1ULM A;  1Y8F A;  2DB6 A;  2W0T A;  1CT2 I;  3FC3 A;  1KMA A;  1NUB A;  3D00 A;  3QWP A;  1M8C A;  1K7V A;  1W4R A;  2X3T A;  4UXJ A;  1IY5 A;  1MJA A;  2OU2 A;  1V1I A;  1CSO I;  2LUY A;  3R5D A;  1MT1 A;  3B4V C;  4DNC A;  2SGQ I;  4E1R A;  3R5A A;  1FAR A;  4A24 A;  1IY6 A;  3OVO A;  1R0R I;  1NXU A;  1XA6 A;  4GI3 C;  1M8B A;  2WVJ A;  2GVI A;  2OD1 A;  3UEJ A;  3UGI A;  2OVO A;  2QPO A;  4SGB I;  1FAQ A;  1TIH A;  1TGS I;  2NU0 I;  1OMT A;  3VDP A;  2ORW A;  2SGP I;  3OXG A;  1CHO I;  1UVF A;  1CE3 A;  3SEK C;  1CGI I;  1PPF I;  1P9G A;  2YQP A;  5CCL A;  1TBO A;  1ULN A;  1X74 A;  1S20 A;  2BUS A;  2L8E A;  1HJA I;  1TBR R;  2DKV A;  2B0U C;  2CWF A;  2GKT I;  1WTJ A;  1DS3 I;  2QQ0 A;  2GKV A;  3QAH A;  2CJS C;  3PDN A;  4UXH A;  2PQ8 A;  5E3P A;  5FUV A;  5FUX A;  2KCX A;  1TUS A;  4B6D A;  1BMO A;  1UVG A;  3TO7 A;  1V1H A;  1PTQ A;  1Z2I A;  2LEO A;  3R5B A;  2GKR I;  2N52 A;  2VRW B;  2JW6 A;  3FSX A;  3UGD A;  1P9Z A;  2KMR A;  1YU6 C;  3E2I A;  3OXL A;  3TO9 A;  1OVO A;  5EX3 A;  2UZ3 A;  3TO6 A;  2ROW A;  1HDL A;  1SGN I; 
#chains in the Genus database with same CATH homology
 5CCM A;  2NU1 I;  2QQC A;  2V1C C;  3OXF A;  3UGL A;  2JXD A;  1HPT A;  1DS2 I;  1KBE A;  2NU2 I;  2V1C A;  1TOT A;  1OYV I;  1AN1 I;  2SGD I;  2J87 A;  1N13 A;  2ENN A;  2V53 A;  2ENZ A;  2QQE A;  1Y1B A;  1SGD I;  3HH2 C;  2ERW A;  2M5X A;  1SGY I;  2XRC A;  3OL0 A;  3VE5 A;  2QQD A;  1Y1C A;  2ORV A;  4JCV E;  1RFH A;  1XBT A;  4E1P A;  2SGF I;  3SGQ I;  4FKD A;  1W3S A;  3MEK A;  3TJQ A;  1SGE I;  2NU4 I;  1UUC A;  3SGB I;  2J9R A;  2N71 A;  4UXI A;  2NU3 I;  1SGQ I;  1PTR A;  1X4S A;  2K9H A;  1LR9 A;  1SGP I;  3UGI A;  4HGU A;  2F3C I;  2P6A C;  2WCY A;  1TBN A;  1XX6 A;  1CT0 I;  3UFF A;  1R79 A;  1OMU A;  5FUW A;  1KBF A;  1U5K A;  1Z7K B;  1TUR A;  3E59 A;  4OVO A;  2DIP A;  1H0Z A;  2KMQ A;  5HI7 A;  2KMP A;  1IW4 A;  3BJI A;  1PCE A;  5JHW C;  3GOX A;  2YUU A;  3QTL D;  5EX0 A;  1PJU A;  5HQ8 A;  3KY9 A;  4L9M A;  2L7X A;  2JA1 A;  2ELI A;  2JZM A;  1BUS A;  2N17 A;  1CT4 I;  2FNF X;  1TBQ R;  3UEY A;  1VDD A;  2KMO A;  1YTP A;  2SGE I;  3VDU A;  2B8T A;  1CGJ I;  2N1A B;  5FUY A;  2E73 A;  2ODD A;  2E5R A;  3RU0 A;  3CXL A;  1LR8 A;  2JYY A;  1LR7 A;  1SGR I;  2ARP F;  5DAE A;  2A20 A;  2W0T A;  1Y8F A;  2DB6 A;  3FC3 A;  1CT2 I;  1KMA A;  1NUB A;  3D00 A;  3QWP A;  1M8C A;  4UXJ A;  1W4R A;  1IY5 A;  1V1I A;  1CSO I;  2LUY A;  1IY6 A;  1MT1 A;  3B4V C;  4E1R A;  2SGQ I;  1FAR A;  4A24 A;  3OVO A;  1R0R I;  1XA6 A;  4GI3 C;  1M8B A;  2WVJ A;  2GVI A;  2OD1 A;  3UEJ A;  2OVO A;  2QPO A;  4SGB I;  1FAQ A;  1TIH A;  1TGS I;  2NU0 I;  1OMT A;  3VDP A;  2ORW A;  2SGP I;  3OXG A;  1CHO I;  1UVF A;  1CE3 A;  3SEK C;  1CGI I;  1PPF I;  5CCL A;  2YQP A;  1TBO A;  1X74 A;  2BUS A;  2L8E A;  1HJA I;  1TBR R;  2B0U C;  2GKT I;  1DS3 I;  2QQ0 A;  2GKV A;  2CJS C;  3PDN A;  4UXH A;  5FUV A;  5FUX A;  2KCX A;  1TUS A;  4B6D A;  1BMO A;  1UVG A;  1V1H A;  1PTQ A;  3UGD A;  2LEO A;  1FYB A;  2GKR I;  2N52 A;  2VRW B;  2JW6 A;  2KMR A;  1YU6 C;  3E2I A;  3OXL A;  1OVO A;  5EX3 A;  2UZ3 A;  2ROW A;  1HDL A;  1SGN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...