1CT2I

Crystal structure of the omtky3 p1 variant omtky3-thr18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct2I00
1MT1A 1SGNI 2N52A 1CHOI 1IW4A 1AN1I 2SGPI 2KMPA 2OVOA 5DAEA 2P6AC 2F3CI 1IY5A 1CT2I 2XRCA 1N13A 3OVOA 1CGII 2NU0I 1CGJI 1PJUA 1H0ZA 2QQDA 1CE3A 2GKRI 4HGUA 2B0UC 4OVOA 1CT4I 1UUCA 1FYBA 1BUSA 2KMOA 1HDLA 1LR7A 1UVFA 2SGEI 4GI3C 1OMTA 1SGRI 1CSOI 2SGQI 2WCYA 2LEOA 1TBQR 1BMOA 1TIHA 3SEKC 2GKVA 1LR9A 1DS2I 2NU2I 1M8BA 1TBRR 2NU4I 1SGYI 1KMAA 1CT0I 2JYYA 2ARPF 2QQCA 1OMUA 2M5XA 2KMQA 1Z7KB 2NU1I 1OVOA 1SGDI 2KCXA 1YTPA 1TUSA 1OYVI 1PCEA 2BUSA 3QTLD 1LR8A 1UVGA 3SGBI 2GKTI 2N17A 1YU6C 1R0RI 2N71A 1HJAI 1HPTA 1DS3I 2SGFI 2JZMA 4SGBI 1NUBA 1SGPI 2KMRA 3B4VC 2ERWA 1Y1BA 1TGSI 3SGQI 3TJQA 1TURA 1SGQI 2JXDA 2V53A 3HH2C 1SGEI 1Y1CA 5JHWC 1M8CA 1PPFI 2NU3I 2SGDI 1IY6A
chains in the Genus database with same CATH superfamily
1MT1A 5HI7A 1SGNI 4DNCA 2X3TA 3R5BA 2N52A 9WGAA 2CWHA 1CHOI 3TOBA 1WGCA 3R5CA 1IW4A 1AN1I 3TO9A 2SGPI 2KMPA 2OVOA 3FSXA 5DAEA 2ENZA 2RIJA 2DKVA 2P6AC 2B8TA 2J9RA 2ENNA 2F3CI 2J87A 1IY5A 5EX0A 1CT2I 4FKDA 2XRCA 1N13A 4JCVE 2L8EA 3OVOA 3UEYA 2CWFA 1MJAA 1CGII 2YQPA 3TO6A 4AMLA 3GOXA 2LUYA 2X52A 2FNFX 2NU0I 1KBEA 4B6DA 2VRWB 1RFHA 1K7UA 2L7XA 5CCLA 1CGJI 1PJUA 1TBNA 1H0ZA 2QQDA 1VDDA 2LB7A 5E3PA 4L9MA 1CE3A 1FARA 2ORWA 2GKRI 4WP4A 4HGUA 2B0UC 4OVOA 4UXIA 1CT4I 1UUCA 1FYBA 2OD1A 3UEJA 1W3SA 1BUSA 2KMOA 1HDLA 3RU0A 1LR7A 2E73A 2GIVA 1V1IA 1UVFA 3OXGA 2SGEI 4GI3C 2DIPA 5J8CA 1OMTA 1SGRI 1CSOI 2N1AB 2SGQI 1Q9BA 2JA1A 2LEOA 2WCYA 3BJIA 3UFFA 2Y0MA 3TO7A 1TBQR 1NXUA 3VDPA 1BMOA 1K7TA 1TIHA 1ULMA 3VDUA 2ELIA 3SEKC 2A20A 2GKVA 2ORVA 3OXFA 1V1HA 1WGTA 1LR9A 1XBTA 1R79A 1DS2I 2K9HA 2NU2I 1M8BA 1TBRR 2QQ0A 4UXHA 1UHAA 2NU4I 1SGYI 4E1RA 7WGAA 2V1CA 1MJ9A 1XA6A 5EX3A 1TBOA 3PDNA 1KMAA 1CT0I 2UVOA 1PTQA 2JYYA 3MEKA 2ARPF 2WVJA 1W4RA 2YUUA 2QQCA 5FUWA 1OMUA 2M5XA 2KMQA 1Z7KB 2RC4A 1WKXA 5E3RA 1P9GA 2CJSC 2NU1I 2OZUA 3E59A 1OVOA 1SGDI 1XX6A 2KCXA 3E2IA 1YTPA 3QAHA 1MJBA 5J8FA 1TUSA 1OYVI 1PCEA 1IY6A 3OL0A 2BUSA 2UZ3A 5FUYA 1P9ZA 1HEVA 3QTLD 3CXLA 1LR8A 1UVGA 3SGBI 3UGIA 2GKTI 2N17A 4MPIA 3TOAA 1YU6C 1R0RI 2GVIA 3R5DA 5E3QA 2N71A 1X4SA 2DB6A 1HJAI 3FSYA 1HPTA 4E1PA 1Z2IA 2E5RA 2WGCA 3OXLA 1DS3I 3QWPA 2SGFI 5HQ8A 2JZMA 4SGBI 1ULNA 1NUBA 1SGPI 2KMRA 3B4VC 2ERWA 1ULKA 3VE5A 2V1CC 3FC3A 1Y1BA 1TGSI 5FUXA 3SGQI 1S20A 2ODDA 3TJQA 3UGLA 1Y8FA 1TURA 4A24A 1SGQI 1KBFA 1K7VA 2JXDA 1U5KA 2W0TA 2ROWA 3D00A 2QPOA 2V53A 3HH2C 1SGEI 3KY9A 1Y1CA 3UGDA 1TOTA 1FAQA 5JHWC 1WTJA 3R5AA 1PTRA 5CCMA 5FUVA 2PQ8A 1M8CA 2JW6A 2CWGA 1FY7A 1PPFI 2NU3I 2QQEA 4UXJA 2SGDI 3UOEA 2OU2A 1X74A
chains in the Genus database with same CATH topology
1MT1A 5HI7A 1SGNI 2N52A 1CHOI 1IW4A 1AN1I 2SGPI 2KMPA 2OVOA 5DAEA 2ENZA 2P6AC 2B8TA 2J9RA 2ENNA 2F3CI 2J87A 1IY5A 5EX0A 1CT2I 4FKDA 2XRCA 1N13A 4JCVE 2L8EA 3OVOA 3UEYA 2YQPA 1CGII 3GOXA 2LUYA 2FNFX 2NU0I 1KBEA 4B6DA 2VRWB 1RFHA 2L7XA 5CCLA 1CGJI 1PJUA 1TBNA 1H0ZA 2QQDA 1VDDA 4L9MA 1CE3A 1FARA 2ORWA 2GKRI 4HGUA 2B0UC 4OVOA 4UXIA 1CT4I 1UUCA 1FYBA 2OD1A 3UEJA 1W3SA 1BUSA 2KMOA 1HDLA 3RU0A 1LR7A 2E73A 1V1IA 1UVFA 3OXGA 2SGEI 4GI3C 2DIPA 1OMTA 1SGRI 1CSOI 2N1AB 2SGQI 2JA1A 2WCYA 2LEOA 3BJIA 3UFFA 1TBQR 3VDPA 1BMOA 1TIHA 3VDUA 2ELIA 3SEKC 2A20A 2GKVA 2ORVA 3OXFA 1XBTA 1V1HA 1LR9A 1R79A 1DS2I 2K9HA 2NU2I 1M8BA 1TBRR 2QQ0A 4UXHA 2NU4I 4E1RA 1SGYI 1KMAA 2V1CA 1XA6A 5EX3A 1TBOA 3PDNA 1CT0I 1PTQA 2JYYA 3MEKA 2ARPF 2WVJA 1W4RA 2YUUA 2QQCA 5FUWA 1OMUA 2M5XA 2KMQA 1Z7KB 2CJSC 2NU1I 3E59A 1OVOA 1SGDI 1XX6A 2KCXA 3E2IA 1YTPA 1TUSA 1OYVI 1PCEA 1IY6A 3OL0A 2BUSA 2UZ3A 5FUYA 3QTLD 3CXLA 1LR8A 1UVGA 3SGBI 3UGIA 2GKTI 2N17A 1YU6C 1R0RI 2GVIA 2N71A 1X4SA 2DB6A 1HJAI 1HPTA 4E1PA 2E5RA 3OXLA 1DS3I 3QWPA 2SGFI 5HQ8A 2JZMA 4SGBI 1NUBA 1SGPI 2KMRA 3B4VC 2ERWA 3VE5A 2V1CC 3FC3A 1Y1BA 1TGSI 5FUXA 3SGQI 2ODDA 3TJQA 3UGLA 1Y8FA 1TURA 4A24A 1SGQI 1KBFA 2JXDA 1U5KA 2W0TA 2ROWA 3D00A 2QPOA 2V53A 3HH2C 1SGEI 3KY9A 1Y1CA 3UGDA 1TOTA 1FAQA 5JHWC 1PTRA 5CCMA 5FUVA 1M8CA 2JW6A 4UXJA 1PPFI 2NU3I 2QQEA 2SGDI 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MT1 A;  1SGN I;  2N52 A;  1CHO I;  1IW4 A;  1AN1 I;  2SGP I;  2KMP A;  2OVO A;  5DAE A;  2P6A C;  2F3C I;  1IY5 A;  1CT2 I;  2XRC A;  1N13 A;  3OVO A;  1CGI I;  2NU0 I;  1CGJ I;  1PJU A;  1H0Z A;  2QQD A;  1CE3 A;  2GKR I;  4HGU A;  2B0U C;  4OVO A;  1CT4 I;  1UUC A;  1FYB A;  1BUS A;  2KMO A;  1HDL A;  1LR7 A;  1UVF A;  2SGE I;  4GI3 C;  1OMT A;  1SGR I;  1CSO I;  2SGQ I;  2WCY A;  2LEO A;  1TBQ R;  1BMO A;  1TIH A;  3SEK C;  2GKV A;  1LR9 A;  1DS2 I;  2NU2 I;  1M8B A;  1TBR R;  2NU4 I;  1SGY I;  1KMA A;  1CT0 I;  2JYY A;  2ARP F;  2QQC A;  1OMU A;  2M5X A;  2KMQ A;  1Z7K B;  2NU1 I;  1OVO A;  1SGD I;  2KCX A;  1YTP A;  1TUS A;  1OYV I;  1PCE A;  2BUS A;  3QTL D;  1LR8 A;  1UVG A;  3SGB I;  2GKT I;  2N17 A;  1YU6 C;  1R0R I;  2N71 A;  1HJA I;  1HPT A;  1DS3 I;  2SGF I;  2JZM A;  4SGB I;  1NUB A;  1SGP I;  2KMR A;  3B4V C;  2ERW A;  1Y1B A;  1TGS I;  3SGQ I;  3TJQ A;  1TUR A;  1SGQ I;  2JXD A;  2V53 A;  3HH2 C;  1SGE I;  1Y1C A;  5JHW C;  1M8C A;  1PPF I;  2NU3 I;  2SGD I;  1IY6 A; 
#chains in the Genus database with same CATH topology
 1MT1 A;  5HI7 A;  1SGN I;  4DNC A;  2X3T A;  3R5B A;  2N52 A;  9WGA A;  2CWH A;  1CHO I;  3TOB A;  1WGC A;  3R5C A;  1IW4 A;  1AN1 I;  3TO9 A;  2SGP I;  2KMP A;  2OVO A;  3FSX A;  5DAE A;  2ENZ A;  2RIJ A;  2DKV A;  2P6A C;  2B8T A;  2J9R A;  2ENN A;  2F3C I;  2J87 A;  1IY5 A;  5EX0 A;  1CT2 I;  4FKD A;  2XRC A;  1N13 A;  4JCV E;  2L8E A;  3OVO A;  3UEY A;  2CWF A;  1MJA A;  1CGI I;  2YQP A;  3TO6 A;  4AML A;  3GOX A;  2LUY A;  2X52 A;  2FNF X;  2NU0 I;  1KBE A;  4B6D A;  2VRW B;  1RFH A;  1K7U A;  2L7X A;  5CCL A;  1CGJ I;  1PJU A;  1TBN A;  1H0Z A;  2QQD A;  1VDD A;  2LB7 A;  5E3P A;  4L9M A;  1CE3 A;  1FAR A;  2ORW A;  2GKR I;  4WP4 A;  4HGU A;  2B0U C;  4OVO A;  4UXI A;  1CT4 I;  1UUC A;  1FYB A;  2OD1 A;  3UEJ A;  1W3S A;  1BUS A;  2KMO A;  1HDL A;  3RU0 A;  1LR7 A;  2E73 A;  2GIV A;  1V1I A;  1UVF A;  3OXG A;  2SGE I;  4GI3 C;  2DIP A;  5J8C A;  1OMT A;  1SGR I;  1CSO I;  2N1A B;  2SGQ I;  1Q9B A;  2JA1 A;  2LEO A;  2WCY A;  3BJI A;  3UFF A;  2Y0M A;  3TO7 A;  1TBQ R;  1NXU A;  3VDP A;  1BMO A;  1K7T A;  1TIH A;  1ULM A;  3VDU A;  2ELI A;  3SEK C;  2A20 A;  2GKV A;  2ORV A;  3OXF A;  1V1H A;  1WGT A;  1LR9 A;  1XBT A;  1R79 A;  1DS2 I;  2K9H A;  2NU2 I;  1M8B A;  1TBR R;  2QQ0 A;  4UXH A;  1UHA A;  2NU4 I;  1SGY I;  4E1R A;  7WGA A;  2V1C A;  1MJ9 A;  1XA6 A;  5EX3 A;  1TBO A;  3PDN A;  1KMA A;  1CT0 I;  2UVO A;  1PTQ A;  2JYY A;  3MEK A;  2ARP F;  2WVJ A;  1W4R A;  2YUU A;  2QQC A;  5FUW A;  1OMU A;  2M5X A;  2KMQ A;  1Z7K B;  2RC4 A;  1WKX A;  5E3R A;  1P9G A;  2CJS C;  2NU1 I;  2OZU A;  3E59 A;  1OVO A;  1SGD I;  1XX6 A;  2KCX A;  3E2I A;  1YTP A;  3QAH A;  1MJB A;  5J8F A;  1TUS A;  1OYV I;  1PCE A;  1IY6 A;  3OL0 A;  2BUS A;  2UZ3 A;  5FUY A;  1P9Z A;  1HEV A;  3QTL D;  3CXL A;  1LR8 A;  1UVG A;  3SGB I;  3UGI A;  2GKT I;  2N17 A;  4MPI A;  3TOA A;  1YU6 C;  1R0R I;  2GVI A;  3R5D A;  5E3Q A;  2N71 A;  1X4S A;  2DB6 A;  1HJA I;  3FSY A;  1HPT A;  4E1P A;  1Z2I A;  2E5R A;  2WGC A;  3OXL A;  1DS3 I;  3QWP A;  2SGF I;  5HQ8 A;  2JZM A;  4SGB I;  1ULN A;  1NUB A;  1SGP I;  2KMR A;  3B4V C;  2ERW A;  1ULK A;  3VE5 A;  2V1C C;  3FC3 A;  1Y1B A;  1TGS I;  5FUX A;  3SGQ I;  1S20 A;  2ODD A;  3TJQ A;  3UGL A;  1Y8F A;  1TUR A;  4A24 A;  1SGQ I;  1KBF A;  1K7V A;  2JXD A;  1U5K A;  2W0T A;  2ROW A;  3D00 A;  2QPO A;  2V53 A;  3HH2 C;  1SGE I;  3KY9 A;  1Y1C A;  3UGD A;  1TOT A;  1FAQ A;  5JHW C;  1WTJ A;  3R5A A;  1PTR A;  5CCM A;  5FUV A;  2PQ8 A;  1M8C A;  2JW6 A;  2CWG A;  1FY7 A;  1PPF I;  2NU3 I;  2QQE A;  4UXJ A;  2SGD I;  3UOE A;  2OU2 A;  1X74 A; 
#chains in the Genus database with same CATH homology
 1MT1 A;  5HI7 A;  1SGN I;  2N52 A;  1CHO I;  1IW4 A;  1AN1 I;  2SGP I;  2KMP A;  2OVO A;  5DAE A;  2ENZ A;  2P6A C;  2B8T A;  2J9R A;  2ENN A;  2F3C I;  2J87 A;  1IY5 A;  5EX0 A;  1CT2 I;  4FKD A;  2XRC A;  1N13 A;  4JCV E;  2L8E A;  3OVO A;  3UEY A;  2YQP A;  1CGI I;  3GOX A;  2LUY A;  2FNF X;  2NU0 I;  1KBE A;  4B6D A;  2VRW B;  1RFH A;  2L7X A;  5CCL A;  1CGJ I;  1PJU A;  1TBN A;  1H0Z A;  2QQD A;  1VDD A;  4L9M A;  1CE3 A;  1FAR A;  2ORW A;  2GKR I;  4HGU A;  2B0U C;  4OVO A;  4UXI A;  1CT4 I;  1UUC A;  1FYB A;  2OD1 A;  3UEJ A;  1W3S A;  1BUS A;  2KMO A;  1HDL A;  3RU0 A;  1LR7 A;  2E73 A;  1V1I A;  1UVF A;  3OXG A;  2SGE I;  4GI3 C;  2DIP A;  1OMT A;  1SGR I;  1CSO I;  2N1A B;  2SGQ I;  2JA1 A;  2WCY A;  2LEO A;  3BJI A;  3UFF A;  1TBQ R;  3VDP A;  1BMO A;  1TIH A;  3VDU A;  2ELI A;  3SEK C;  2A20 A;  2GKV A;  2ORV A;  3OXF A;  1XBT A;  1V1H A;  1LR9 A;  1R79 A;  1DS2 I;  2K9H A;  2NU2 I;  1M8B A;  1TBR R;  2QQ0 A;  4UXH A;  2NU4 I;  4E1R A;  1SGY I;  1KMA A;  2V1C A;  1XA6 A;  5EX3 A;  1TBO A;  3PDN A;  1CT0 I;  1PTQ A;  2JYY A;  3MEK A;  2ARP F;  2WVJ A;  1W4R A;  2YUU A;  2QQC A;  5FUW A;  1OMU A;  2M5X A;  2KMQ A;  1Z7K B;  2CJS C;  2NU1 I;  3E59 A;  1OVO A;  1SGD I;  1XX6 A;  2KCX A;  3E2I A;  1YTP A;  1TUS A;  1OYV I;  1PCE A;  1IY6 A;  3OL0 A;  2BUS A;  2UZ3 A;  5FUY A;  3QTL D;  3CXL A;  1LR8 A;  1UVG A;  3SGB I;  3UGI A;  2GKT I;  2N17 A;  1YU6 C;  1R0R I;  2GVI A;  2N71 A;  1X4S A;  2DB6 A;  1HJA I;  1HPT A;  4E1P A;  2E5R A;  3OXL A;  1DS3 I;  3QWP A;  2SGF I;  5HQ8 A;  2JZM A;  4SGB I;  1NUB A;  1SGP I;  2KMR A;  3B4V C;  2ERW A;  3VE5 A;  2V1C C;  3FC3 A;  1Y1B A;  1TGS I;  5FUX A;  3SGQ I;  2ODD A;  3TJQ A;  3UGL A;  1Y8F A;  1TUR A;  4A24 A;  1SGQ I;  1KBF A;  2JXD A;  1U5K A;  2W0T A;  2ROW A;  3D00 A;  2QPO A;  2V53 A;  3HH2 C;  1SGE I;  3KY9 A;  1Y1C A;  3UGD A;  1TOT A;  1FAQ A;  5JHW C;  1PTR A;  5CCM A;  5FUV A;  1M8C A;  2JW6 A;  4UXJ A;  1PPF I;  2NU3 I;  2QQE A;  2SGD I;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...