1CT2I

Crystal structure of the omtky3 p1 variant omtky3-thr18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct2I00
1SGQI 1TBRR 1N13A 1MT1A 3HH2C 1TGSI 2WCYA 1TUSA 1YTPA 2M5XA 2N17A 2P6AC 2KMPA 1CGII 1UVFA 1IW4A 1PCEA 1Y1CA 2NU2I 2JXDA 3SGBI 1H0ZA 1SGNI 2NU1I 1SGRI 2SGEI 1OMUA 1IY6A 1SGPI 4HGUA 2GKTI 2XRCA 1DS2I 1CT0I 4OVOA 1CE3A 2ARPF 2ERWA 3QTLD 1NUBA 1BUSA 1IY5A 1FYBA 1SGEI 1M8BA 2QQDA 1SGYI 1LR9A 2SGPI 2OVOA 1DS3I 2QQCA 1CT2I 2SGQI 1CHOI 2KMQA 2KCXA 4GI3C 2GKRI 5JHWC 4SGBI 2F3CI 1TBQR 3SEKC 2KMOA 1PPFI 5DAEA 3SGQI 1Z7KB 2NU4I 1Y1BA 2GKVA 3B4VC 2N71A 1OMTA 1HDLA 3OVOA 1UVGA 2SGDI 1OYVI 1R0RI 2LEOA 2BUSA 2NU0I 2KMRA 1YU6C 1TIHA 2JZMA 1LR7A 1CGJI 1PJUA 1CT4I 1CSOI 1OVOA 1LR8A 2JYYA 2V53A 2B0UC 2NU3I 2N52A 1KMAA 2SGFI 1TURA 1SGDI 3TJQA 1UUCA 1HPTA 1M8CA 1AN1I 1HJAI 1BMOA
chains in the Genus database with same CATH superfamily
1SGQI 1K7VA 3R5CA 2QQEA 4E1RA 1TBRR 1N13A 3KY9A 2ORVA 5HI7A 1MT1A 5CCMA 1FY7A 1V1IA 3E59A 2GIVA 2ORWA 5J8FA 2QPOA 2FNFX 4L9MA 3HH2C 2VRWB 2V1CA 4UXHA 1VDDA 1ULNA 1TGSI 1RFHA 2WCYA 2B8TA 3MEKA 3TO6A 2ODDA 2E5RA 3R5DA 1TUSA 1YTPA 2CJSC 2QQ0A 1MJAA 4WP4A 2M5XA 2N17A 3OL0A 9WGAA 4UXJA 2P6AC 2ENNA 1WGCA 2KMPA 1XX6A 1CGII 1WTJA 1UVFA 4AMLA 5J8CA 4E1PA 2DB6A 3TO7A 3GOXA 1KBEA 1PCEA 1Y1CA 2NU2I 1IW4A 3PDNA 5FUYA 2JXDA 2JW6A 1NXUA 1W3SA 1HEVA 1ULKA 3SGBI 1H0ZA 1SGNI 2NU1I 1SGRI 3R5BA 1P9ZA 2SGEI 2WGCA 3RU0A 5HQ8A 1X74A 2ENZA 2W0TA 1OMUA 3VE5A 1IY6A 3R5AA 3D00A 1X4SA 1SGPI 2PQ8A 2X52A 2YUUA 4HGUA 2GKTI 2A20A 2XRCA 3UGDA 1DS2I 1CT0I 1WKXA 4OVOA 1CE3A 2ARPF 1TBOA 2ERWA 3QTLD 1NUBA 5FUVA 3OXGA 1U5KA 1BUSA 3VDPA 1IY5A 1FYBA 1MJ9A 2UZ3A 1K7UA 1SGEI 3BJIA 1M8BA 5E3RA 3TO9A 2QQDA 1SGYI 3UFFA 4A24A 1LR9A 2CWGA 4B6DA 3OXFA 2SGPI 2N1AB 1MJBA 1DS3I 2OVOA 2QQCA 3QAHA 1CT2I 3UOEA 5FUXA 2J9RA 2SGQI 1CHOI 2WVJA 1W4RA 2OU2A 2KMQA 2CWFA 2KCXA 4GI3C 1R79A 2GKRI 2GVIA 3FSYA 5JHWC 2E73A 4SGBI 2F3CI 1TBQR 3SEKC 3UGIA 1S20A 2KMOA 1PPFI 2DIPA 4FKDA 5DAEA 3SGQI 4DNCA 5CCLA 3FC3A 1XA6A 1Z7KB 2JA1A 2X3TA 2NU4I 3UGLA 1Y1BA 5EX3A 2GKVA 1ULMA 2K9HA 3B4VC 3FSXA 3OXLA 1PTQA 2N71A 3UEYA 3VDUA 1P9GA 2LUYA 1OMTA 1HDLA 3OVOA 2V1CC 2CWHA 3TOAA 5E3PA 1KBFA 2RIJA 1UVGA 7WGAA 2SGDI 2OZUA 1WGTA 4UXIA 5EX0A 1FARA 1OYVI 2Y0MA 1R0RI 2LEOA 2BUSA 2LB7A 2L8EA 2KMRA 1YU6C 2NU0I 2OD1A 1TIHA 3UEJA 2JZMA 1LR7A 1CGJI 1PJUA 2UVOA 1TOTA 3TOBA 2YQPA 1V1HA 3QWPA 1CT4I 1CSOI 2RC4A 5FUWA 1OVOA 1LR8A 2JYYA 2V53A 2B0UC 2DKVA 2NU3I 1K7TA 3E2IA 2N52A 1KMAA 1XBTA 1Y8FA 1TURA 2SGFI 2ELIA 5E3QA 1PTRA 1SGDI 1FAQA 1Q9BA 3TJQA 2J87A 1TBNA 1UUCA 3CXLA 1HPTA 1M8CA 1AN1I 1Z2IA 2ROWA 2L7XA 4MPIA 1HJAI 1BMOA 1UHAA 4JCVE
chains in the Genus database with same CATH topology
1SGQI 4E1RA 2QQEA 1TBRR 1N13A 3KY9A 2ORVA 5HI7A 1MT1A 5CCMA 1V1IA 3E59A 2ORWA 2QPOA 2FNFX 4L9MA 3HH2C 2VRWB 2V1CA 4UXHA 1VDDA 1TGSI 1RFHA 2WCYA 2B8TA 3MEKA 2ODDA 2E5RA 1TUSA 1YTPA 2CJSC 2QQ0A 2M5XA 2N17A 3OL0A 4UXJA 2P6AC 2ENNA 2KMPA 1XX6A 1CGII 1UVFA 4E1PA 2DB6A 3GOXA 1IW4A 1KBEA 1PCEA 1Y1CA 2NU2I 3PDNA 5FUYA 2JXDA 2JW6A 1W3SA 3SGBI 1H0ZA 1SGNI 2NU1I 1SGRI 3RU0A 5HQ8A 2SGEI 1X74A 2ENZA 2W0TA 1OMUA 3VE5A 1IY6A 3D00A 1X4SA 1SGPI 2YUUA 4HGUA 2GKTI 2A20A 2XRCA 3UGDA 1DS2I 1CT0I 4OVOA 1CE3A 2ARPF 1TBOA 2ERWA 3QTLD 1NUBA 5FUVA 3OXGA 1U5KA 1BUSA 3VDPA 1IY5A 1FYBA 2UZ3A 1SGEI 3BJIA 4A24A 1M8BA 2QQDA 1SGYI 3UFFA 1LR9A 4B6DA 3OXFA 2SGPI 2N1AB 2OVOA 1DS3I 2QQCA 1CT2I 5FUXA 2J9RA 2SGQI 1CHOI 2WVJA 1W4RA 2KMQA 2KCXA 4GI3C 1R79A 2GKRI 2GVIA 5JHWC 2E73A 4SGBI 2F3CI 1TBQR 3SEKC 3UGIA 2KMOA 1PPFI 2DIPA 4FKDA 5DAEA 3SGQI 5CCLA 3FC3A 1XA6A 1Z7KB 2JA1A 2NU4I 3UGLA 1Y1BA 5EX3A 2GKVA 2K9HA 3B4VC 3OXLA 1PTQA 2N71A 3UEYA 3VDUA 2LUYA 1OMTA 1HDLA 3OVOA 2V1CC 1KBFA 1UVGA 2SGDI 4UXIA 5EX0A 1FARA 1OYVI 1R0RI 2LEOA 2BUSA 3UEJA 2L8EA 2KMRA 1YU6C 2NU0I 2OD1A 1TIHA 2JZMA 1LR7A 1CGJI 1PJUA 1TOTA 2YQPA 1V1HA 3QWPA 1CT4I 1CSOI 5FUWA 1OVOA 1LR8A 2JYYA 2V53A 2B0UC 2NU3I 3E2IA 2N52A 1KMAA 1XBTA 1Y8FA 1TURA 2SGFI 2ELIA 1PTRA 1SGDI 1FAQA 3TJQA 2J87A 1TBNA 1UUCA 3CXLA 1HPTA 1M8CA 1AN1I 2ROWA 2L7XA 1HJAI 1BMOA 4JCVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGQ I;  1TBR R;  1N13 A;  1MT1 A;  3HH2 C;  1TGS I;  2WCY A;  1TUS A;  1YTP A;  2M5X A;  2N17 A;  2P6A C;  2KMP A;  1CGI I;  1UVF A;  1IW4 A;  1PCE A;  1Y1C A;  2NU2 I;  2JXD A;  3SGB I;  1H0Z A;  1SGN I;  2NU1 I;  1SGR I;  2SGE I;  1OMU A;  1IY6 A;  1SGP I;  4HGU A;  2GKT I;  2XRC A;  1DS2 I;  1CT0 I;  4OVO A;  1CE3 A;  2ARP F;  2ERW A;  3QTL D;  1NUB A;  1BUS A;  1IY5 A;  1FYB A;  1SGE I;  1M8B A;  2QQD A;  1SGY I;  1LR9 A;  2SGP I;  2OVO A;  1DS3 I;  2QQC A;  1CT2 I;  2SGQ I;  1CHO I;  2KMQ A;  2KCX A;  4GI3 C;  2GKR I;  5JHW C;  4SGB I;  2F3C I;  1TBQ R;  3SEK C;  2KMO A;  1PPF I;  5DAE A;  3SGQ I;  1Z7K B;  2NU4 I;  1Y1B A;  2GKV A;  3B4V C;  2N71 A;  1OMT A;  1HDL A;  3OVO A;  1UVG A;  2SGD I;  1OYV I;  1R0R I;  2LEO A;  2BUS A;  2NU0 I;  2KMR A;  1YU6 C;  1TIH A;  2JZM A;  1LR7 A;  1CGJ I;  1PJU A;  1CT4 I;  1CSO I;  1OVO A;  1LR8 A;  2JYY A;  2V53 A;  2B0U C;  2NU3 I;  2N52 A;  1KMA A;  2SGF I;  1TUR A;  1SGD I;  3TJQ A;  1UUC A;  1HPT A;  1M8C A;  1AN1 I;  1HJA I;  1BMO A; 
#chains in the Genus database with same CATH topology
 1SGQ I;  1K7V A;  3R5C A;  2QQE A;  4E1R A;  1TBR R;  1N13 A;  3KY9 A;  2ORV A;  5HI7 A;  1MT1 A;  5CCM A;  1FY7 A;  1V1I A;  3E59 A;  2GIV A;  2ORW A;  5J8F A;  2QPO A;  2FNF X;  4L9M A;  3HH2 C;  2VRW B;  2V1C A;  4UXH A;  1VDD A;  1ULN A;  1TGS I;  1RFH A;  2WCY A;  2B8T A;  3MEK A;  3TO6 A;  2ODD A;  2E5R A;  3R5D A;  1TUS A;  1YTP A;  2CJS C;  2QQ0 A;  1MJA A;  4WP4 A;  2M5X A;  2N17 A;  3OL0 A;  9WGA A;  4UXJ A;  2P6A C;  2ENN A;  1WGC A;  2KMP A;  1XX6 A;  1CGI I;  1WTJ A;  1UVF A;  4AML A;  5J8C A;  4E1P A;  2DB6 A;  3TO7 A;  3GOX A;  1KBE A;  1PCE A;  1Y1C A;  2NU2 I;  1IW4 A;  3PDN A;  5FUY A;  2JXD A;  2JW6 A;  1NXU A;  1W3S A;  1HEV A;  1ULK A;  3SGB I;  1H0Z A;  1SGN I;  2NU1 I;  1SGR I;  3R5B A;  1P9Z A;  2SGE I;  2WGC A;  3RU0 A;  5HQ8 A;  1X74 A;  2ENZ A;  2W0T A;  1OMU A;  3VE5 A;  1IY6 A;  3R5A A;  3D00 A;  1X4S A;  1SGP I;  2PQ8 A;  2X52 A;  2YUU A;  4HGU A;  2GKT I;  2A20 A;  2XRC A;  3UGD A;  1DS2 I;  1CT0 I;  1WKX A;  4OVO A;  1CE3 A;  2ARP F;  1TBO A;  2ERW A;  3QTL D;  1NUB A;  5FUV A;  3OXG A;  1U5K A;  1BUS A;  3VDP A;  1IY5 A;  1FYB A;  1MJ9 A;  2UZ3 A;  1K7U A;  1SGE I;  3BJI A;  1M8B A;  5E3R A;  3TO9 A;  2QQD A;  1SGY I;  3UFF A;  4A24 A;  1LR9 A;  2CWG A;  4B6D A;  3OXF A;  2SGP I;  2N1A B;  1MJB A;  1DS3 I;  2OVO A;  2QQC A;  3QAH A;  1CT2 I;  3UOE A;  5FUX A;  2J9R A;  2SGQ I;  1CHO I;  2WVJ A;  1W4R A;  2OU2 A;  2KMQ A;  2CWF A;  2KCX A;  4GI3 C;  1R79 A;  2GKR I;  2GVI A;  3FSY A;  5JHW C;  2E73 A;  4SGB I;  2F3C I;  1TBQ R;  3SEK C;  3UGI A;  1S20 A;  2KMO A;  1PPF I;  2DIP A;  4FKD A;  5DAE A;  3SGQ I;  4DNC A;  5CCL A;  3FC3 A;  1XA6 A;  1Z7K B;  2JA1 A;  2X3T A;  2NU4 I;  3UGL A;  1Y1B A;  5EX3 A;  2GKV A;  1ULM A;  2K9H A;  3B4V C;  3FSX A;  3OXL A;  1PTQ A;  2N71 A;  3UEY A;  3VDU A;  1P9G A;  2LUY A;  1OMT A;  1HDL A;  3OVO A;  2V1C C;  2CWH A;  3TOA A;  5E3P A;  1KBF A;  2RIJ A;  1UVG A;  7WGA A;  2SGD I;  2OZU A;  1WGT A;  4UXI A;  5EX0 A;  1FAR A;  1OYV I;  2Y0M A;  1R0R I;  2LEO A;  2BUS A;  2LB7 A;  2L8E A;  2KMR A;  1YU6 C;  2NU0 I;  2OD1 A;  1TIH A;  3UEJ A;  2JZM A;  1LR7 A;  1CGJ I;  1PJU A;  2UVO A;  1TOT A;  3TOB A;  2YQP A;  1V1H A;  3QWP A;  1CT4 I;  1CSO I;  2RC4 A;  5FUW A;  1OVO A;  1LR8 A;  2JYY A;  2V53 A;  2B0U C;  2DKV A;  2NU3 I;  1K7T A;  3E2I A;  2N52 A;  1KMA A;  1XBT A;  1Y8F A;  1TUR A;  2SGF I;  2ELI A;  5E3Q A;  1PTR A;  1SGD I;  1FAQ A;  1Q9B A;  3TJQ A;  2J87 A;  1TBN A;  1UUC A;  3CXL A;  1HPT A;  1M8C A;  1AN1 I;  1Z2I A;  2ROW A;  2L7X A;  4MPI A;  1HJA I;  1BMO A;  1UHA A;  4JCV E; 
#chains in the Genus database with same CATH homology
 1SGQ I;  4E1R A;  2QQE A;  1TBR R;  1N13 A;  3KY9 A;  2ORV A;  5HI7 A;  1MT1 A;  5CCM A;  1V1I A;  3E59 A;  2ORW A;  2QPO A;  2FNF X;  4L9M A;  3HH2 C;  2VRW B;  2V1C A;  4UXH A;  1VDD A;  1TGS I;  1RFH A;  2WCY A;  2B8T A;  3MEK A;  2ODD A;  2E5R A;  1TUS A;  1YTP A;  2CJS C;  2QQ0 A;  2M5X A;  2N17 A;  3OL0 A;  4UXJ A;  2P6A C;  2ENN A;  2KMP A;  1XX6 A;  1CGI I;  1UVF A;  4E1P A;  2DB6 A;  3GOX A;  1IW4 A;  1KBE A;  1PCE A;  1Y1C A;  2NU2 I;  3PDN A;  5FUY A;  2JXD A;  2JW6 A;  1W3S A;  3SGB I;  1H0Z A;  1SGN I;  2NU1 I;  1SGR I;  3RU0 A;  5HQ8 A;  2SGE I;  1X74 A;  2ENZ A;  2W0T A;  1OMU A;  3VE5 A;  1IY6 A;  3D00 A;  1X4S A;  1SGP I;  2YUU A;  4HGU A;  2GKT I;  2A20 A;  2XRC A;  3UGD A;  1DS2 I;  1CT0 I;  4OVO A;  1CE3 A;  2ARP F;  1TBO A;  2ERW A;  3QTL D;  1NUB A;  5FUV A;  3OXG A;  1U5K A;  1BUS A;  3VDP A;  1IY5 A;  1FYB A;  2UZ3 A;  1SGE I;  3BJI A;  4A24 A;  1M8B A;  2QQD A;  1SGY I;  3UFF A;  1LR9 A;  4B6D A;  3OXF A;  2SGP I;  2N1A B;  2OVO A;  1DS3 I;  2QQC A;  1CT2 I;  5FUX A;  2J9R A;  2SGQ I;  1CHO I;  2WVJ A;  1W4R A;  2KMQ A;  2KCX A;  4GI3 C;  1R79 A;  2GKR I;  2GVI A;  5JHW C;  2E73 A;  4SGB I;  2F3C I;  1TBQ R;  3SEK C;  3UGI A;  2KMO A;  1PPF I;  2DIP A;  4FKD A;  5DAE A;  3SGQ I;  5CCL A;  3FC3 A;  1XA6 A;  1Z7K B;  2JA1 A;  2NU4 I;  3UGL A;  1Y1B A;  5EX3 A;  2GKV A;  2K9H A;  3B4V C;  3OXL A;  1PTQ A;  2N71 A;  3UEY A;  3VDU A;  2LUY A;  1OMT A;  1HDL A;  3OVO A;  2V1C C;  1KBF A;  1UVG A;  2SGD I;  4UXI A;  5EX0 A;  1FAR A;  1OYV I;  1R0R I;  2LEO A;  2BUS A;  3UEJ A;  2L8E A;  2KMR A;  1YU6 C;  2NU0 I;  2OD1 A;  1TIH A;  2JZM A;  1LR7 A;  1CGJ I;  1PJU A;  1TOT A;  2YQP A;  1V1H A;  3QWP A;  1CT4 I;  1CSO I;  5FUW A;  1OVO A;  1LR8 A;  2JYY A;  2V53 A;  2B0U C;  2NU3 I;  3E2I A;  2N52 A;  1KMA A;  1XBT A;  1Y8F A;  1TUR A;  2SGF I;  2ELI A;  1PTR A;  1SGD I;  1FAQ A;  3TJQ A;  2J87 A;  1TBN A;  1UUC A;  3CXL A;  1HPT A;  1M8C A;  1AN1 I;  2ROW A;  2L7X A;  1HJA I;  1BMO A;  4JCV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...