1CT2I

Crystal structure of the omtky3 p1 variant omtky3-thr18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct2I00
2JYYA 1Y1BA 1SGYI 2SGEI 1HDLA 2SGDI 1PPFI 1HPTA 1TUSA 2NU1I 1CE3A 2ERWA 1M8CA 1OMUA 1TBQR 2NU2I 1M8BA 1TGSI 4SGBI 1SGDI 2GKRI 2JZMA 1LR9A 2N52A 2SGQI 1DS3I 3SGQI 1IY6A 2LEOA 3QTLD 1NUBA 2KMPA 2B0UC 2QQDA 2N71A 5DAEA 2GKTI 1MT1A 2KCXA 1OYVI 2ARPF 1SGQI 2F3CI 3SGBI 1UVGA 2GKVA 2NU0I 1TIHA 1PJUA 5JHWC 1OVOA 2OVOA 4OVOA 2BUSA 1FYBA 1YU6C 3OVOA 1CHOI 2NU3I 1IW4A 1AN1I 3SEKC 1UUCA 1SGNI 3B4VC 2SGPI 1LR8A 2NU4I 1BMOA 3TJQA 1CT2I 2KMRA 1Z7KB 1HJAI 2KMOA 3HH2C 1UVFA 4GI3C 2QQCA 2V53A 1DS2I 1N13A 1KMAA 1R0RI 1SGPI 2SGFI 1CT0I 1SGRI 1H0ZA 1SGEI 1Y1CA 1PCEA 2M5XA 2WCYA 1IY5A 1YTPA 2N17A 2XRCA 1LR7A 1BUSA 1CT4I 1CSOI 4HGUA 1TBRR 1TURA 2P6AC 1OMTA 1CGJI 2KMQA 1CGII 2JXDA
chains in the Genus database with same CATH superfamily
5EX3A 2ROWA 2Y0MA 4A24A 3R5CA 2JYYA 9WGAA 1Y1BA 1Z2IA 2GIVA 4B6DA 1SGYI 1ULMA 2SGEI 1HDLA 1R79A 2ENZA 2SGDI 3UEJA 1S20A 5FUWA 4AMLA 1TBNA 1K7VA 1PPFI 3FSYA 3KY9A 3R5AA 1HPTA 2ENNA 1TUSA 1X4SA 2NU1I 1CE3A 1FARA 2ERWA 1M8CA 1OMUA 1TBQR 3VE5A 2NU2I 1M8BA 1TGSI 3PDNA 4SGBI 4UXHA 1SGDI 2GKRI 2JZMA 1LR9A 2OZUA 3OXLA 2DB6A 1ULNA 2N52A 2SGQI 5FUXA 3OXFA 3E2IA 5HQ8A 1DS3I 3SGQI 3TOBA 1IY6A 3QWPA 2LEOA 2E73A 2FNFX 3QTLD 2OD1A 1V1IA 2L7XA 5J8FA 4E1RA 3FC3A 1NUBA 2B8TA 2UZ3A 2V1CA 1K7TA 1U5KA 5FUYA 2KMPA 2B0UC 2QQDA 2N71A 2UVOA 2E5RA 3E59A 2A20A 3D00A 2CWHA 3UGIA 5DAEA 1TBOA 2GKTI 2OU2A 1MT1A 2X3TA 2KCXA 1OYVI 3TOAA 1KBEA 3UGDA 2ARPF 5E3PA 1SGQI 2QPOA 2VRWB 2F3CI 3SGBI 1UHAA 3OXGA 1TOTA 1ULKA 1UVGA 2GKVA 1K7UA 2NU0I 1TIHA 1PJUA 2YUUA 1OVOA 2OVOA 3QAHA 5FUVA 1MJ9A 4OVOA 5JHWC 2BUSA 1FYBA 1YU6C 3OVOA 1CHOI 2NU3I 1W4RA 3FSXA 2L8EA 2CWFA 2CJSC 4DNCA 1IW4A 1KBFA 2JW6A 1AN1I 2DIPA 2J87A 2ORVA 2QQEA 1RFHA 3SEKC 3RU0A 1UUCA 1WTJA 1SGNI 2ELIA 3UEYA 7WGAA 5HI7A 2J9RA 1Q9BA 1NXUA 1WGCA 3UFFA 2CWGA 5EX0A 3VDUA 3B4VC 1XA6A 2SGPI 1LR8A 1WGTA 1WKXA 2LB7A 1FY7A 2NU4I 2ORWA 1BMOA 4UXJA 3TJQA 3MEKA 1CT2I 3TO7A 1X74A 2KMRA 1W3SA 1Z7KB 1HJAI 2WVJA 2DKVA 2KMOA 3GOXA 3HH2C 1UVFA 2LUYA 1P9GA 2QQCA 4GI3C 2RC4A 2V53A 4UXIA 1FAQA 2GVIA 1DS2I 1VDDA 3UGLA 5J8CA 3CXLA 1N13A 1KMAA 1R0RI 1Y8FA 2RIJA 1SGPI 3UOEA 2ODDA 2SGFI 4E1PA 1CT0I 1SGRI 2X52A 5E3RA 3TO6A 1H0ZA 1SGEI 1XBTA 1Y1CA 1PCEA 1PTQA 4WP4A 2M5XA 2WCYA 3VDPA 5CCMA 1YTPA 2N17A 1IY5A 2XRCA 3TO9A 1HEVA 1LR7A 4FKDA 2JA1A 2V1CC 4L9MA 2PQ8A 4MPIA 5CCLA 1BUSA 1XX6A 1CT4I 1CSOI 4HGUA 1TBRR 1TURA 2P6AC 1OMTA 3R5BA 1CGJI 1P9ZA 3OL0A 2W0TA 3BJIA 3R5DA 2K9HA 1V1HA 1MJBA 2WGCA 1MJAA 2YQPA 2KMQA 5E3QA 2QQ0A 4JCVE 1PTRA 2N1AB 1CGII 2JXDA
chains in the Genus database with same CATH topology
5EX3A 2ROWA 4A24A 2JYYA 1Y1BA 4B6DA 1SGYI 2SGEI 1HDLA 1R79A 2ENZA 2SGDI 3UEJA 5FUWA 1TBNA 1PPFI 3KY9A 1HPTA 2ENNA 1TUSA 1X4SA 2NU1I 1CE3A 1FARA 2ERWA 1M8CA 1OMUA 1TBQR 3VE5A 2NU2I 1M8BA 1TGSI 3PDNA 4SGBI 4UXHA 1SGDI 2GKRI 2JZMA 1LR9A 3OXLA 2DB6A 2N52A 2SGQI 5FUXA 3OXFA 3E2IA 5HQ8A 1DS3I 3SGQI 1IY6A 3QWPA 2LEOA 2E73A 2FNFX 3QTLD 2OD1A 1V1IA 2L7XA 4E1RA 3FC3A 1NUBA 2B8TA 2UZ3A 2V1CA 1U5KA 5FUYA 2KMPA 2B0UC 2QQDA 2N71A 2E5RA 3E59A 2A20A 3D00A 3UGIA 5DAEA 1TBOA 2GKTI 1MT1A 2KCXA 1OYVI 1KBEA 3UGDA 2ARPF 1SGQI 2QPOA 2VRWB 2F3CI 3SGBI 3OXGA 1TOTA 1UVGA 2GKVA 2NU0I 2YUUA 1TIHA 1PJUA 5JHWC 1OVOA 2OVOA 5FUVA 4OVOA 2BUSA 1FYBA 1YU6C 3OVOA 1CHOI 2NU3I 1W4RA 2L8EA 1IW4A 2CJSC 1KBFA 2JW6A 1AN1I 2DIPA 2J87A 2ORVA 2QQEA 1RFHA 3SEKC 3RU0A 1UUCA 1SGNI 2ELIA 3UEYA 5HI7A 2J9RA 3UFFA 5EX0A 3VDUA 3B4VC 1XA6A 2SGPI 1LR8A 2NU4I 2ORWA 1BMOA 4UXJA 3TJQA 3MEKA 1CT2I 1X74A 2KMRA 1W3SA 1Z7KB 1HJAI 2WVJA 2KMOA 3GOXA 3HH2C 1UVFA 2LUYA 4GI3C 2QQCA 2V53A 4UXIA 1FAQA 2GVIA 1DS2I 1VDDA 3UGLA 3CXLA 1N13A 1KMAA 1Y8FA 1R0RI 1SGPI 2ODDA 2SGFI 4E1PA 1CT0I 1SGRI 1H0ZA 1SGEI 1XBTA 1Y1CA 1PCEA 1PTQA 2M5XA 2WCYA 3VDPA 5CCMA 1YTPA 2N17A 1IY5A 2XRCA 1LR7A 4FKDA 2JA1A 2V1CC 4L9MA 5CCLA 1BUSA 1XX6A 1CT4I 1CSOI 4HGUA 1TBRR 1TURA 2P6AC 1OMTA 1CGJI 3OL0A 2W0TA 3BJIA 2K9HA 1V1HA 2YQPA 2KMQA 2QQ0A 4JCVE 1PTRA 2N1AB 1CGII 2JXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYY A;  1Y1B A;  1SGY I;  2SGE I;  1HDL A;  2SGD I;  1PPF I;  1HPT A;  1TUS A;  2NU1 I;  1CE3 A;  2ERW A;  1M8C A;  1OMU A;  1TBQ R;  2NU2 I;  1M8B A;  1TGS I;  4SGB I;  1SGD I;  2GKR I;  2JZM A;  1LR9 A;  2N52 A;  2SGQ I;  1DS3 I;  3SGQ I;  1IY6 A;  2LEO A;  3QTL D;  1NUB A;  2KMP A;  2B0U C;  2QQD A;  2N71 A;  5DAE A;  2GKT I;  1MT1 A;  2KCX A;  1OYV I;  2ARP F;  1SGQ I;  2F3C I;  3SGB I;  1UVG A;  2GKV A;  2NU0 I;  1TIH A;  1PJU A;  5JHW C;  1OVO A;  2OVO A;  4OVO A;  2BUS A;  1FYB A;  1YU6 C;  3OVO A;  1CHO I;  2NU3 I;  1IW4 A;  1AN1 I;  3SEK C;  1UUC A;  1SGN I;  3B4V C;  2SGP I;  1LR8 A;  2NU4 I;  1BMO A;  3TJQ A;  1CT2 I;  2KMR A;  1Z7K B;  1HJA I;  2KMO A;  3HH2 C;  1UVF A;  4GI3 C;  2QQC A;  2V53 A;  1DS2 I;  1N13 A;  1KMA A;  1R0R I;  1SGP I;  2SGF I;  1CT0 I;  1SGR I;  1H0Z A;  1SGE I;  1Y1C A;  1PCE A;  2M5X A;  2WCY A;  1IY5 A;  1YTP A;  2N17 A;  2XRC A;  1LR7 A;  1BUS A;  1CT4 I;  1CSO I;  4HGU A;  1TBR R;  1TUR A;  2P6A C;  1OMT A;  1CGJ I;  2KMQ A;  1CGI I;  2JXD A; 
#chains in the Genus database with same CATH topology
 5EX3 A;  2ROW A;  2Y0M A;  4A24 A;  3R5C A;  2JYY A;  9WGA A;  1Y1B A;  1Z2I A;  2GIV A;  4B6D A;  1SGY I;  1ULM A;  2SGE I;  1HDL A;  1R79 A;  2ENZ A;  2SGD I;  3UEJ A;  1S20 A;  5FUW A;  4AML A;  1TBN A;  1K7V A;  1PPF I;  3FSY A;  3KY9 A;  3R5A A;  1HPT A;  2ENN A;  1TUS A;  1X4S A;  2NU1 I;  1CE3 A;  1FAR A;  2ERW A;  1M8C A;  1OMU A;  1TBQ R;  3VE5 A;  2NU2 I;  1M8B A;  1TGS I;  3PDN A;  4SGB I;  4UXH A;  1SGD I;  2GKR I;  2JZM A;  1LR9 A;  2OZU A;  3OXL A;  2DB6 A;  1ULN A;  2N52 A;  2SGQ I;  5FUX A;  3OXF A;  3E2I A;  5HQ8 A;  1DS3 I;  3SGQ I;  3TOB A;  1IY6 A;  3QWP A;  2LEO A;  2E73 A;  2FNF X;  3QTL D;  2OD1 A;  1V1I A;  2L7X A;  5J8F A;  4E1R A;  3FC3 A;  1NUB A;  2B8T A;  2UZ3 A;  2V1C A;  1K7T A;  1U5K A;  5FUY A;  2KMP A;  2B0U C;  2QQD A;  2N71 A;  2UVO A;  2E5R A;  3E59 A;  2A20 A;  3D00 A;  2CWH A;  3UGI A;  5DAE A;  1TBO A;  2GKT I;  2OU2 A;  1MT1 A;  2X3T A;  2KCX A;  1OYV I;  3TOA A;  1KBE A;  3UGD A;  2ARP F;  5E3P A;  1SGQ I;  2QPO A;  2VRW B;  2F3C I;  3SGB I;  1UHA A;  3OXG A;  1TOT A;  1ULK A;  1UVG A;  2GKV A;  1K7U A;  2NU0 I;  1TIH A;  1PJU A;  2YUU A;  1OVO A;  2OVO A;  3QAH A;  5FUV A;  1MJ9 A;  4OVO A;  5JHW C;  2BUS A;  1FYB A;  1YU6 C;  3OVO A;  1CHO I;  2NU3 I;  1W4R A;  3FSX A;  2L8E A;  2CWF A;  2CJS C;  4DNC A;  1IW4 A;  1KBF A;  2JW6 A;  1AN1 I;  2DIP A;  2J87 A;  2ORV A;  2QQE A;  1RFH A;  3SEK C;  3RU0 A;  1UUC A;  1WTJ A;  1SGN I;  2ELI A;  3UEY A;  7WGA A;  5HI7 A;  2J9R A;  1Q9B A;  1NXU A;  1WGC A;  3UFF A;  2CWG A;  5EX0 A;  3VDU A;  3B4V C;  1XA6 A;  2SGP I;  1LR8 A;  1WGT A;  1WKX A;  2LB7 A;  1FY7 A;  2NU4 I;  2ORW A;  1BMO A;  4UXJ A;  3TJQ A;  3MEK A;  1CT2 I;  3TO7 A;  1X74 A;  2KMR A;  1W3S A;  1Z7K B;  1HJA I;  2WVJ A;  2DKV A;  2KMO A;  3GOX A;  3HH2 C;  1UVF A;  2LUY A;  1P9G A;  2QQC A;  4GI3 C;  2RC4 A;  2V53 A;  4UXI A;  1FAQ A;  2GVI A;  1DS2 I;  1VDD A;  3UGL A;  5J8C A;  3CXL A;  1N13 A;  1KMA A;  1R0R I;  1Y8F A;  2RIJ A;  1SGP I;  3UOE A;  2ODD A;  2SGF I;  4E1P A;  1CT0 I;  1SGR I;  2X52 A;  5E3R A;  3TO6 A;  1H0Z A;  1SGE I;  1XBT A;  1Y1C A;  1PCE A;  1PTQ A;  4WP4 A;  2M5X A;  2WCY A;  3VDP A;  5CCM A;  1YTP A;  2N17 A;  1IY5 A;  2XRC A;  3TO9 A;  1HEV A;  1LR7 A;  4FKD A;  2JA1 A;  2V1C C;  4L9M A;  2PQ8 A;  4MPI A;  5CCL A;  1BUS A;  1XX6 A;  1CT4 I;  1CSO I;  4HGU A;  1TBR R;  1TUR A;  2P6A C;  1OMT A;  3R5B A;  1CGJ I;  1P9Z A;  3OL0 A;  2W0T A;  3BJI A;  3R5D A;  2K9H A;  1V1H A;  1MJB A;  2WGC A;  1MJA A;  2YQP A;  2KMQ A;  5E3Q A;  2QQ0 A;  4JCV E;  1PTR A;  2N1A B;  1CGI I;  2JXD A; 
#chains in the Genus database with same CATH homology
 5EX3 A;  2ROW A;  4A24 A;  2JYY A;  1Y1B A;  4B6D A;  1SGY I;  2SGE I;  1HDL A;  1R79 A;  2ENZ A;  2SGD I;  3UEJ A;  5FUW A;  1TBN A;  1PPF I;  3KY9 A;  1HPT A;  2ENN A;  1TUS A;  1X4S A;  2NU1 I;  1CE3 A;  1FAR A;  2ERW A;  1M8C A;  1OMU A;  1TBQ R;  3VE5 A;  2NU2 I;  1M8B A;  1TGS I;  3PDN A;  4SGB I;  4UXH A;  1SGD I;  2GKR I;  2JZM A;  1LR9 A;  3OXL A;  2DB6 A;  2N52 A;  2SGQ I;  5FUX A;  3OXF A;  3E2I A;  5HQ8 A;  1DS3 I;  3SGQ I;  1IY6 A;  3QWP A;  2LEO A;  2E73 A;  2FNF X;  3QTL D;  2OD1 A;  1V1I A;  2L7X A;  4E1R A;  3FC3 A;  1NUB A;  2B8T A;  2UZ3 A;  2V1C A;  1U5K A;  5FUY A;  2KMP A;  2B0U C;  2QQD A;  2N71 A;  2E5R A;  3E59 A;  2A20 A;  3D00 A;  3UGI A;  5DAE A;  1TBO A;  2GKT I;  1MT1 A;  2KCX A;  1OYV I;  1KBE A;  3UGD A;  2ARP F;  1SGQ I;  2QPO A;  2VRW B;  2F3C I;  3SGB I;  3OXG A;  1TOT A;  1UVG A;  2GKV A;  2NU0 I;  2YUU A;  1TIH A;  1PJU A;  5JHW C;  1OVO A;  2OVO A;  5FUV A;  4OVO A;  2BUS A;  1FYB A;  1YU6 C;  3OVO A;  1CHO I;  2NU3 I;  1W4R A;  2L8E A;  1IW4 A;  2CJS C;  1KBF A;  2JW6 A;  1AN1 I;  2DIP A;  2J87 A;  2ORV A;  2QQE A;  1RFH A;  3SEK C;  3RU0 A;  1UUC A;  1SGN I;  2ELI A;  3UEY A;  5HI7 A;  2J9R A;  3UFF A;  5EX0 A;  3VDU A;  3B4V C;  1XA6 A;  2SGP I;  1LR8 A;  2NU4 I;  2ORW A;  1BMO A;  4UXJ A;  3TJQ A;  3MEK A;  1CT2 I;  1X74 A;  2KMR A;  1W3S A;  1Z7K B;  1HJA I;  2WVJ A;  2KMO A;  3GOX A;  3HH2 C;  1UVF A;  2LUY A;  4GI3 C;  2QQC A;  2V53 A;  4UXI A;  1FAQ A;  2GVI A;  1DS2 I;  1VDD A;  3UGL A;  3CXL A;  1N13 A;  1KMA A;  1Y8F A;  1R0R I;  1SGP I;  2ODD A;  2SGF I;  4E1P A;  1CT0 I;  1SGR I;  1H0Z A;  1SGE I;  1XBT A;  1Y1C A;  1PCE A;  1PTQ A;  2M5X A;  2WCY A;  3VDP A;  5CCM A;  1YTP A;  2N17 A;  1IY5 A;  2XRC A;  1LR7 A;  4FKD A;  2JA1 A;  2V1C C;  4L9M A;  5CCL A;  1BUS A;  1XX6 A;  1CT4 I;  1CSO I;  4HGU A;  1TBR R;  1TUR A;  2P6A C;  1OMT A;  1CGJ I;  3OL0 A;  2W0T A;  3BJI A;  2K9H A;  1V1H A;  2YQP A;  2KMQ A;  2QQ0 A;  4JCV E;  1PTR A;  2N1A B;  1CGI I;  2JXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...