1YTPA

Solution structure of the c4a/c41a variant of the nicotiana alata proteinase inhibitor t1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
DRIATNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNADPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase inhibitor
publication title The structure of a disulfide mutant of the Nicotiana alata proteinase inhibitor T1 --- Stabilisation of the reactive site loop is critical for activity
rcsb
source organism Nicotiana alata
molecule tags Hydrolase inhibitor
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ytpA00
1CSOI 4OVOA 1R0RI 2SGEI 1SGNI 1NUBA 2NU0I 1Y1BA 1CT4I 2B0UC 3HH2C 1IY6A 2JYYA 1HDLA 3B4VC 2GKVA 2SGQI 2JZMA 2JXDA 2KCXA 1CT2I 1DS2I 1PJUA 2N52A 2M5XA 1LR7A 1CGII 1PPFI 2KMQA 3SGBI 2P6AC 1SGPI 2SGDI 4SGBI 1BMOA 1HPTA 1SGQI 1KMAA 2NU2I 2GKTI 2GKRI 2OVOA 1LR9A 1OMUA 1YU6C 1N13A 2NU1I 2WCYA 1UUCA 2N71A 1OYVI 2ERWA 1OVOA 1Y1CA 1CGJI 1CT0I 1TBRR 1DS3I 1UVGA 1BUSA 1TIHA 1IW4A 2XRCA 3SGQI 5DAEA 1UVFA 4GI3C 5JHWC 1MT1A 3TJQA 3SEKC 1LR8A 1CHOI 2KMPA 1YTPA 2KMRA 2N17A 2SGFI 2SGPI 1TBQR 3QTLD 1FYBA 2NU4I 2NU3I 2QQCA 1Z7KB 1OMTA 1CE3A 1H0ZA 4HGUA 1AN1I 3OVOA 1HJAI 2QQDA 2V53A 1SGYI 2KMOA 2F3CI 2LEOA 1SGEI 1TURA 1PCEA 2ARPF 1IY5A 2BUSA 1SGRI 1TUSA 1SGDI 1M8BA 1TGSI 1M8CA
chains in the Genus database with same CATH superfamily
2ORWA 5FUXA 1KBEA 1PTRA 2ORVA 9WGAA 3E59A 1Z2IA 3UFFA 1KBFA 1CSOI 3KY9A 2WGCA 3R5BA 4L9MA 3GOXA 3OXFA 4OVOA 1R0RI 5E3QA 2N1AB 3VE5A 2CWFA 2SGEI 1TBNA 1MJBA 1SGNI 2GIVA 1W3SA 1NUBA 3UGLA 1FARA 2NU0I 1Y1BA 2Y0MA 7WGAA 1V1IA 1CT4I 3R5DA 2B0UC 3HH2C 1IY6A 2JYYA 3R5AA 3QWPA 1HDLA 5EX0A 2OD1A 3B4VC 1MJ9A 2GKVA 2SGQI 2V1CA 1HEVA 1ULKA 2ENNA 5E3PA 1WKXA 2RC4A 2JZMA 2JXDA 1K7UA 2L8EA 1K7TA 1FAQA 4E1RA 2FNFX 1UHAA 2K9HA 2KCXA 1CT2I 1DS2I 1PJUA 2N52A 1XA6A 2M5XA 3FSYA 2W0TA 2J9RA 3VDUA 3PDNA 1LR7A 5CCMA 1CGII 1TOTA 1PPFI 2KMQA 2OZUA 3BJIA 1S20A 1ULMA 1P9GA 3SGBI 3UGIA 2P6AC 3UOEA 1SGPI 2ROWA 2SGDI 4SGBI 1BMOA 1HPTA 2YUUA 1SGQI 4B6DA 1KMAA 1U5KA 1X4SA 2NU2I 1Y8FA 2DB6A 3CXLA 2WVJA 2GKTI 2V1CC 2GKRI 5FUWA 1TBOA 2OVOA 1LR9A 1K7VA 1OMUA 3D00A 1V1HA 1FY7A 1R79A 1MJAA 1XBTA 1YU6C 1N13A 2CWGA 2NU1I 2WCYA 4E1PA 1UUCA 2N71A 1OYVI 2X3TA 3TOAA 2ERWA 1OVOA 4WP4A 1Y1CA 3OL0A 2YQPA 1CGJI 3UGDA 1CT0I 2LUYA 3RU0A 5EX3A 1TBRR 1DS3I 2DKVA 1UVGA 3VDPA 3R5CA 4AMLA 1BUSA 2E73A 3TO7A 5FUVA 1TIHA 2L7XA 1IW4A 2JA1A 4UXHA 1X74A 2XRCA 1VDDA 5DAEA 1UVFA 4GI3C 5E3RA 1MT1A 1XX6A 3SGQI 2ELIA 5JHWC 3TJQA 3SEKC 2CJSC 2DIPA 1LR8A 1CHOI 2KMPA 3FSXA 1YTPA 2KMRA 3TOBA 3TO9A 2N17A 2ENZA 2SGFI 3OXLA 3OXGA 2UVOA 2SGPI 4UXIA 5HI7A 3FC3A 1NXUA 1PTQA 1TBQR 2E5RA 3QTLD 1TGSI 1FYBA 2QQ0A 4FKDA 3UEJA 2VRWB 5HQ8A 3TO6A 2NU4I 2OU2A 1P9ZA 2RIJA 2A20A 2NU3I 4UXJA 2QQCA 1Z7KB 1OMTA 4JCVE 1CE3A 5J8CA 1WGCA 4HGUA 1H0ZA 2QQEA 1AN1I 1W4RA 1WGTA 2J87A 2X52A 2LB7A 2PQ8A 5CCLA 2JW6A 3MEKA 3OVOA 3E2IA 1HJAI 1RFHA 2QQDA 2V53A 1Q9BA 2B8TA 1SGYI 2GVIA 2KMOA 2UZ3A 2F3CI 2LEOA 1SGEI 2CWHA 2ODDA 1TURA 3UEYA 1PCEA 1WTJA 2ARPF 4MPIA 3QAHA 2QPOA 4A24A 1IY5A 2BUSA 4DNCA 1SGRI 5FUYA 1TUSA 5J8FA 1SGDI 1M8BA 1ULNA 1M8CA
chains in the Genus database with same CATH topology
2ORWA 5FUXA 1KBEA 1PTRA 2ORVA 3E59A 3UFFA 1KBFA 1CSOI 3KY9A 4L9MA 3OXFA 4OVOA 1R0RI 3VE5A 2N1AB 2SGEI 1TBNA 1SGNI 1W3SA 1NUBA 3UGLA 1FARA 2NU0I 1Y1BA 1V1IA 1CT4I 2B0UC 3HH2C 1IY6A 2JYYA 3QWPA 1HDLA 5EX0A 2OD1A 3B4VC 2GKVA 2SGQI 2V1CA 2ENNA 2JZMA 2JXDA 1FAQA 2L8EA 4E1RA 2FNFX 2KCXA 2K9HA 1CT2I 1DS2I 1PJUA 2N52A 1XA6A 2M5XA 2W0TA 2J9RA 3VDUA 3PDNA 1LR7A 5CCMA 1CGII 1TOTA 1PPFI 2KMQA 3BJIA 3SGBI 3UGIA 2P6AC 1SGPI 2ROWA 2SGDI 4SGBI 1BMOA 1HPTA 2YUUA 1SGQI 4B6DA 1KMAA 1U5KA 1X4SA 2NU2I 1Y8FA 2DB6A 3CXLA 2WVJA 2GKTI 2V1CC 2GKRI 5FUWA 1TBOA 2OVOA 1LR9A 1OMUA 3D00A 1V1HA 1R79A 1XBTA 1YU6C 1N13A 2NU1I 2WCYA 4E1PA 1UUCA 2N71A 1OYVI 2ERWA 1OVOA 1Y1CA 3OL0A 2YQPA 1CGJI 3UGDA 1CT0I 2LUYA 3RU0A 5EX3A 1TBRR 1DS3I 3VDPA 1UVGA 3GOXA 1BUSA 2E73A 5FUVA 1TIHA 2L7XA 1IW4A 2JA1A 4UXHA 1X74A 2XRCA 1VDDA 5DAEA 1UVFA 4GI3C 3SGQI 1MT1A 1XX6A 5JHWC 2ELIA 3TJQA 3SEKC 2CJSC 2DIPA 1LR8A 1CHOI 2KMPA 1YTPA 2KMRA 2N17A 2ENZA 2SGFI 3OXLA 3OXGA 2SGPI 4UXIA 5HI7A 3FC3A 1PTQA 1TBQR 2E5RA 3QTLD 1FYBA 2QQ0A 4FKDA 3UEJA 2VRWB 5HQ8A 2NU4I 2A20A 2NU3I 4UXJA 2QQCA 1Z7KB 1OMTA 4JCVE 1CE3A 1H0ZA 4HGUA 2QQEA 1AN1I 1W4RA 2J87A 5CCLA 2JW6A 3MEKA 3OVOA 3E2IA 1HJAI 1RFHA 2QQDA 2V53A 2B8TA 1SGYI 2GVIA 2KMOA 2UZ3A 2F3CI 2LEOA 1SGEI 2ODDA 1TURA 3UEYA 1PCEA 2ARPF 1IY5A 4A24A 2QPOA 2BUSA 1SGRI 5FUYA 1TUSA 1SGDI 1M8BA 1TGSI 1M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSO I;  4OVO A;  1R0R I;  2SGE I;  1SGN I;  1NUB A;  2NU0 I;  1Y1B A;  1CT4 I;  2B0U C;  3HH2 C;  1IY6 A;  2JYY A;  1HDL A;  3B4V C;  2GKV A;  2SGQ I;  2JZM A;  2JXD A;  2KCX A;  1CT2 I;  1DS2 I;  1PJU A;  2N52 A;  2M5X A;  1LR7 A;  1CGI I;  1PPF I;  2KMQ A;  3SGB I;  2P6A C;  1SGP I;  2SGD I;  4SGB I;  1BMO A;  1HPT A;  1SGQ I;  1KMA A;  2NU2 I;  2GKT I;  2GKR I;  2OVO A;  1LR9 A;  1OMU A;  1YU6 C;  1N13 A;  2NU1 I;  2WCY A;  1UUC A;  2N71 A;  1OYV I;  2ERW A;  1OVO A;  1Y1C A;  1CGJ I;  1CT0 I;  1TBR R;  1DS3 I;  1UVG A;  1BUS A;  1TIH A;  1IW4 A;  2XRC A;  3SGQ I;  5DAE A;  1UVF A;  4GI3 C;  5JHW C;  1MT1 A;  3TJQ A;  3SEK C;  1LR8 A;  1CHO I;  2KMP A;  1YTP A;  2KMR A;  2N17 A;  2SGF I;  2SGP I;  1TBQ R;  3QTL D;  1FYB A;  2NU4 I;  2NU3 I;  2QQC A;  1Z7K B;  1OMT A;  1CE3 A;  1H0Z A;  4HGU A;  1AN1 I;  3OVO A;  1HJA I;  2QQD A;  2V53 A;  1SGY I;  2KMO A;  2F3C I;  2LEO A;  1SGE I;  1TUR A;  1PCE A;  2ARP F;  1IY5 A;  2BUS A;  1SGR I;  1TUS A;  1SGD I;  1M8B A;  1TGS I;  1M8C A; 
#chains in the Genus database with same CATH topology
 2ORW A;  5FUX A;  1KBE A;  1PTR A;  2ORV A;  9WGA A;  3E59 A;  1Z2I A;  3UFF A;  1KBF A;  1CSO I;  3KY9 A;  2WGC A;  3R5B A;  4L9M A;  3GOX A;  3OXF A;  4OVO A;  1R0R I;  5E3Q A;  2N1A B;  3VE5 A;  2CWF A;  2SGE I;  1TBN A;  1MJB A;  1SGN I;  2GIV A;  1W3S A;  1NUB A;  3UGL A;  1FAR A;  2NU0 I;  1Y1B A;  2Y0M A;  7WGA A;  1V1I A;  1CT4 I;  3R5D A;  2B0U C;  3HH2 C;  1IY6 A;  2JYY A;  3R5A A;  3QWP A;  1HDL A;  5EX0 A;  2OD1 A;  3B4V C;  1MJ9 A;  2GKV A;  2SGQ I;  2V1C A;  1HEV A;  1ULK A;  2ENN A;  5E3P A;  1WKX A;  2RC4 A;  2JZM A;  2JXD A;  1K7U A;  2L8E A;  1K7T A;  1FAQ A;  4E1R A;  2FNF X;  1UHA A;  2K9H A;  2KCX A;  1CT2 I;  1DS2 I;  1PJU A;  2N52 A;  1XA6 A;  2M5X A;  3FSY A;  2W0T A;  2J9R A;  3VDU A;  3PDN A;  1LR7 A;  5CCM A;  1CGI I;  1TOT A;  1PPF I;  2KMQ A;  2OZU A;  3BJI A;  1S20 A;  1ULM A;  1P9G A;  3SGB I;  3UGI A;  2P6A C;  3UOE A;  1SGP I;  2ROW A;  2SGD I;  4SGB I;  1BMO A;  1HPT A;  2YUU A;  1SGQ I;  4B6D A;  1KMA A;  1U5K A;  1X4S A;  2NU2 I;  1Y8F A;  2DB6 A;  3CXL A;  2WVJ A;  2GKT I;  2V1C C;  2GKR I;  5FUW A;  1TBO A;  2OVO A;  1LR9 A;  1K7V A;  1OMU A;  3D00 A;  1V1H A;  1FY7 A;  1R79 A;  1MJA A;  1XBT A;  1YU6 C;  1N13 A;  2CWG A;  2NU1 I;  2WCY A;  4E1P A;  1UUC A;  2N71 A;  1OYV I;  2X3T A;  3TOA A;  2ERW A;  1OVO A;  4WP4 A;  1Y1C A;  3OL0 A;  2YQP A;  1CGJ I;  3UGD A;  1CT0 I;  2LUY A;  3RU0 A;  5EX3 A;  1TBR R;  1DS3 I;  2DKV A;  1UVG A;  3VDP A;  3R5C A;  4AML A;  1BUS A;  2E73 A;  3TO7 A;  5FUV A;  1TIH A;  2L7X A;  1IW4 A;  2JA1 A;  4UXH A;  1X74 A;  2XRC A;  1VDD A;  5DAE A;  1UVF A;  4GI3 C;  5E3R A;  1MT1 A;  1XX6 A;  3SGQ I;  2ELI A;  5JHW C;  3TJQ A;  3SEK C;  2CJS C;  2DIP A;  1LR8 A;  1CHO I;  2KMP A;  3FSX A;  1YTP A;  2KMR A;  3TOB A;  3TO9 A;  2N17 A;  2ENZ A;  2SGF I;  3OXL A;  3OXG A;  2UVO A;  2SGP I;  4UXI A;  5HI7 A;  3FC3 A;  1NXU A;  1PTQ A;  1TBQ R;  2E5R A;  3QTL D;  1TGS I;  1FYB A;  2QQ0 A;  4FKD A;  3UEJ A;  2VRW B;  5HQ8 A;  3TO6 A;  2NU4 I;  2OU2 A;  1P9Z A;  2RIJ A;  2A20 A;  2NU3 I;  4UXJ A;  2QQC A;  1Z7K B;  1OMT A;  4JCV E;  1CE3 A;  5J8C A;  1WGC A;  4HGU A;  1H0Z A;  2QQE A;  1AN1 I;  1W4R A;  1WGT A;  2J87 A;  2X52 A;  2LB7 A;  2PQ8 A;  5CCL A;  2JW6 A;  3MEK A;  3OVO A;  3E2I A;  1HJA I;  1RFH A;  2QQD A;  2V53 A;  1Q9B A;  2B8T A;  1SGY I;  2GVI A;  2KMO A;  2UZ3 A;  2F3C I;  2LEO A;  1SGE I;  2CWH A;  2ODD A;  1TUR A;  3UEY A;  1PCE A;  1WTJ A;  2ARP F;  4MPI A;  3QAH A;  2QPO A;  4A24 A;  1IY5 A;  2BUS A;  4DNC A;  1SGR I;  5FUY A;  1TUS A;  5J8F A;  1SGD I;  1M8B A;  1ULN A;  1M8C A; 
#chains in the Genus database with same CATH homology
 2ORW A;  5FUX A;  1KBE A;  1PTR A;  2ORV A;  3E59 A;  3UFF A;  1KBF A;  1CSO I;  3KY9 A;  4L9M A;  3OXF A;  4OVO A;  1R0R I;  3VE5 A;  2N1A B;  2SGE I;  1TBN A;  1SGN I;  1W3S A;  1NUB A;  3UGL A;  1FAR A;  2NU0 I;  1Y1B A;  1V1I A;  1CT4 I;  2B0U C;  3HH2 C;  1IY6 A;  2JYY A;  3QWP A;  1HDL A;  5EX0 A;  2OD1 A;  3B4V C;  2GKV A;  2SGQ I;  2V1C A;  2ENN A;  2JZM A;  2JXD A;  1FAQ A;  2L8E A;  4E1R A;  2FNF X;  2KCX A;  2K9H A;  1CT2 I;  1DS2 I;  1PJU A;  2N52 A;  1XA6 A;  2M5X A;  2W0T A;  2J9R A;  3VDU A;  3PDN A;  1LR7 A;  5CCM A;  1CGI I;  1TOT A;  1PPF I;  2KMQ A;  3BJI A;  3SGB I;  3UGI A;  2P6A C;  1SGP I;  2ROW A;  2SGD I;  4SGB I;  1BMO A;  1HPT A;  2YUU A;  1SGQ I;  4B6D A;  1KMA A;  1U5K A;  1X4S A;  2NU2 I;  1Y8F A;  2DB6 A;  3CXL A;  2WVJ A;  2GKT I;  2V1C C;  2GKR I;  5FUW A;  1TBO A;  2OVO A;  1LR9 A;  1OMU A;  3D00 A;  1V1H A;  1R79 A;  1XBT A;  1YU6 C;  1N13 A;  2NU1 I;  2WCY A;  4E1P A;  1UUC A;  2N71 A;  1OYV I;  2ERW A;  1OVO A;  1Y1C A;  3OL0 A;  2YQP A;  1CGJ I;  3UGD A;  1CT0 I;  2LUY A;  3RU0 A;  5EX3 A;  1TBR R;  1DS3 I;  3VDP A;  1UVG A;  3GOX A;  1BUS A;  2E73 A;  5FUV A;  1TIH A;  2L7X A;  1IW4 A;  2JA1 A;  4UXH A;  1X74 A;  2XRC A;  1VDD A;  5DAE A;  1UVF A;  4GI3 C;  3SGQ I;  1MT1 A;  1XX6 A;  5JHW C;  2ELI A;  3TJQ A;  3SEK C;  2CJS C;  2DIP A;  1LR8 A;  1CHO I;  2KMP A;  1YTP A;  2KMR A;  2N17 A;  2ENZ A;  2SGF I;  3OXL A;  3OXG A;  2SGP I;  4UXI A;  5HI7 A;  3FC3 A;  1PTQ A;  1TBQ R;  2E5R A;  3QTL D;  1FYB A;  2QQ0 A;  4FKD A;  3UEJ A;  2VRW B;  5HQ8 A;  2NU4 I;  2A20 A;  2NU3 I;  4UXJ A;  2QQC A;  1Z7K B;  1OMT A;  4JCV E;  1CE3 A;  1H0Z A;  4HGU A;  2QQE A;  1AN1 I;  1W4R A;  2J87 A;  5CCL A;  2JW6 A;  3MEK A;  3OVO A;  3E2I A;  1HJA I;  1RFH A;  2QQD A;  2V53 A;  2B8T A;  1SGY I;  2GVI A;  2KMO A;  2UZ3 A;  2F3C I;  2LEO A;  1SGE I;  2ODD A;  1TUR A;  3UEY A;  1PCE A;  2ARP F;  1IY5 A;  4A24 A;  2QPO A;  2BUS A;  1SGR I;  5FUY A;  1TUS A;  1SGD I;  1M8B A;  1TGS I;  1M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...