1YTPA

Solution structure of the c4a/c41a variant of the nicotiana alata proteinase inhibitor t1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
DRIATNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNADPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords proteinase inhibitor
publication title The structure of a disulfide mutant of the Nicotiana alata proteinase inhibitor T1 --- Stabilisation of the reactive site loop is critical for activity
rcsb
source organism Nicotiana alata
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ytpA00
2SGDI 1YTPA 2QQDA 2SGPI 1TUSA 1IW4A 2OVOA 2N52A 2JZMA 1LR9A 2KCXA 1CSOI 1AN1I 1Y1CA 2P6AC 3B4VC 2N71A 5DAEA 3SGQI 2SGEI 5JHWC 1CT4I 1CT0I 2N17A 1TIHA 2F3CI 2NU4I 1HPTA 2ERWA 2ARPF 2NU1I 2NU0I 3TJQA 1TURA 2NU2I 3HH2C 1DS2I 1NUBA 1CT2I 1UVFA 1CGII 2SGQI 4SGBI 1HDLA 1M8CA 1PJUA 1LR8A 1OMUA 2SGFI 1SGQI 2QQCA 2KMOA 1FYBA 2JXDA 1CE3A 2XRCA 4GI3C 1TBRR 2JYYA 1R0RI 2GKTI 1PPFI 1YU6C 2GKRI 2LEOA 1SGPI 1SGRI 1BMOA 1Z7KB 1UVGA 1HJAI 1OMTA 2KMRA 2B0UC 1PCEA 2M5XA 1LR7A 1TGSI 2KMPA 1OVOA 1OYVI 1SGDI 1BUSA 3SEKC 1IY6A 2NU3I 1MT1A 4OVOA 3SGBI 1N13A 1Y1BA 1UUCA 2BUSA 1TBQR 4HGUA 1CGJI 2KMQA 2V53A 1CHOI 1M8BA 1SGYI 2WCYA 1DS3I 3OVOA 1SGEI 1H0ZA 1SGNI 1KMAA 2GKVA 3QTLD 1IY5A
chains in the Genus database with same CATH superfamily
2SGDI 1X4SA 1YTPA 2QQDA 2SGPI 3CXLA 2ENNA 1TUSA 1IW4A 2OVOA 3UEJA 3RU0A 2ENZA 2V1CC 2N52A 2JZMA 2QQEA 3QAHA 3TOBA 3VE5A 1LR9A 2E5RA 1CSOI 2KCXA 1AN1I 2ROWA 2ORWA 1Y1CA 2P6AC 3B4VC 2W0TA 1Q9BA 2N71A 2LUYA 5DAEA 1V1IA 1KBEA 2X3TA 1ULKA 5J8CA 3SGQI 9WGAA 2SGEI 2GIVA 2L7XA 5E3PA 1CT4I 5JHWC 2PQ8A 2YQPA 1CT0I 2N17A 2Y0MA 1TIHA 2ORVA 2E73A 2F3CI 1P9ZA 2NU4I 5FUXA 3UGLA 1WGCA 3BJIA 4E1RA 1HPTA 2DKVA 3R5BA 2OD1A 1Z2IA 3FSXA 3TO9A 2ERWA 1K7VA 4B6DA 2ELIA 2ARPF 2QPOA 2NU1I 4A24A 2NU0I 2UZ3A 2RC4A 2GVIA 3TJQA 5FUWA 1TURA 2WVJA 2NU2I 3FSYA 3OXFA 3TOAA 4E1PA 5CCMA 1K7UA 4AMLA 2CWFA 3HH2C 3VDPA 2J9RA 3PDNA 1DS2I 1NUBA 1CT2I 2A20A 3UFFA 2K9HA 1UVFA 1ULMA 1CGII 1P9GA 2SGQI 5HQ8A 4DNCA 4SGBI 1WTJA 1K7TA 1HDLA 5FUYA 1M8CA 5J8FA 1KBFA 3E59A 1PJUA 3OXGA 1LR8A 1OMUA 2LB7A 3R5AA 2B8TA 1V1HA 2SGFI 1SGQI 5CCLA 1RFHA 1X74A 2QQCA 2KMOA 3R5DA 4UXIA 1XBTA 1FYBA 2JXDA 3E2IA 2DB6A 1CE3A 1W3SA 2XRCA 1PTRA 1TBRR 4GI3C 3MEKA 2JYYA 2N1AB 1R0RI 2GKTI 1UHAA 2L8EA 3OL0A 3TO7A 1PPFI 4L9MA 1YU6C 2GKRI 2V1CA 2J87A 2LEOA 1SGPI 1SGRI 1BMOA 4JCVE 1Z7KB 3D00A 1PTQA 1UVGA 3KY9A 1NXUA 1HJAI 1U5KA 1OMTA 2B0UC 2KMRA 1PCEA 1TGSI 1LR7A 2M5XA 4UXHA 5E3QA 2KMPA 2UVOA 1XX6A 1OVOA 1OYVI 1SGDI 3FC3A 1BUSA 3SEKC 2CWGA 1FARA 1ULNA 1IY6A 2NU3I 1W4RA 1MJ9A 1MT1A 1TOTA 1S20A 1TBNA 1TBOA 3UOEA 1R79A 2X52A 7WGAA 1WKXA 1FAQA 4OVOA 3SGBI 1N13A 1Y1BA 2OU2A 1MJBA 1UUCA 3VDUA 3OXLA 3UEYA 2BUSA 2JA1A 4WP4A 1TBQR 2FNFX 1Y8FA 4HGUA 1CGJI 1HEVA 2QQ0A 5EX0A 3UGIA 3R5CA 2KMQA 2V53A 2WGCA 1CHOI 1M8BA 2DIPA 1SGYI 2WCYA 1VDDA 1DS3I 3OVOA 1SGEI 3TO6A 3GOXA 1H0ZA 1SGNI 5EX3A 4MPIA 2ODDA 5FUVA 2VRWB 5HI7A 1KMAA 3UGDA 2OZUA 2GKVA 5E3RA 3QTLD 2JW6A 2YUUA 3QWPA 4FKDA 2CWHA 4UXJA 1IY5A 1FY7A 2CJSC 2RIJA 1MJAA 1XA6A 1WGTA
chains in the Genus database with same CATH topology
2SGDI 1X4SA 1YTPA 2QQDA 2SGPI 3CXLA 2ENNA 1TUSA 1IW4A 2OVOA 3UEJA 3RU0A 2ENZA 2V1CC 2N52A 2JZMA 2QQEA 3VE5A 1LR9A 2E5RA 1CSOI 2KCXA 1AN1I 2ROWA 2ORWA 1Y1CA 2P6AC 3B4VC 2W0TA 2N71A 2LUYA 5DAEA 1V1IA 1KBEA 3GOXA 3SGQI 2SGEI 2L7XA 5JHWC 1CT4I 2YQPA 1CT0I 2N17A 1TIHA 2ORVA 2E73A 2F3CI 2NU4I 5FUXA 3UGLA 4E1RA 3BJIA 1HPTA 2OD1A 2ERWA 4B6DA 2ELIA 2ARPF 2QPOA 2NU1I 4A24A 2NU0I 2UZ3A 2GVIA 3TJQA 5FUWA 1TURA 2WVJA 2NU2I 3OXFA 4E1PA 5CCMA 3HH2C 3VDPA 2J9RA 3PDNA 2A20A 1DS2I 1NUBA 1CT2I 3UFFA 2K9HA 1UVFA 1CGII 2SGQI 5HQ8A 4SGBI 1HDLA 5FUYA 1M8CA 1KBFA 3E59A 1PJUA 3OXGA 1LR8A 1OMUA 2B8TA 1V1HA 2SGFI 1SGQI 5CCLA 1X74A 1RFHA 2QQCA 2KMOA 4UXIA 1FYBA 1XBTA 2JXDA 3E2IA 2DB6A 1CE3A 1W3SA 2XRCA 1PTRA 1TBRR 4GI3C 3MEKA 2JYYA 2N1AB 1R0RI 2GKTI 2L8EA 3OL0A 1PPFI 4L9MA 1YU6C 2GKRI 2V1CA 2J87A 2LEOA 1SGPI 1SGRI 1BMOA 4JCVE 1Z7KB 3D00A 1PTQA 1UVGA 3KY9A 1HJAI 1U5KA 2B0UC 1OMTA 2KMRA 1PCEA 1TGSI 1LR7A 2M5XA 4UXHA 2KMPA 1XX6A 1OVOA 1OYVI 1SGDI 3FC3A 1BUSA 3SEKC 1FARA 1IY6A 2NU3I 1W4RA 1MT1A 1TOTA 1TBNA 1TBOA 1R79A 1FAQA 4OVOA 3SGBI 1N13A 1Y1BA 1UUCA 3VDUA 3OXLA 3UEYA 2BUSA 2JA1A 1TBQR 2FNFX 1Y8FA 4HGUA 1CGJI 2QQ0A 5EX0A 3UGIA 2KMQA 2V53A 1CHOI 1M8BA 2DIPA 1SGYI 2WCYA 1VDDA 1DS3I 3OVOA 1SGEI 1H0ZA 1SGNI 5EX3A 2ODDA 5FUVA 2VRWB 5HI7A 1KMAA 3UGDA 2GKVA 3QTLD 2JW6A 2YUUA 3QWPA 4FKDA 4UXJA 2CJSC 1XA6A 1IY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGD I;  1YTP A;  2QQD A;  2SGP I;  1TUS A;  1IW4 A;  2OVO A;  2N52 A;  2JZM A;  1LR9 A;  2KCX A;  1CSO I;  1AN1 I;  1Y1C A;  2P6A C;  3B4V C;  2N71 A;  5DAE A;  3SGQ I;  2SGE I;  5JHW C;  1CT4 I;  1CT0 I;  2N17 A;  1TIH A;  2F3C I;  2NU4 I;  1HPT A;  2ERW A;  2ARP F;  2NU1 I;  2NU0 I;  3TJQ A;  1TUR A;  2NU2 I;  3HH2 C;  1DS2 I;  1NUB A;  1CT2 I;  1UVF A;  1CGI I;  2SGQ I;  4SGB I;  1HDL A;  1M8C A;  1PJU A;  1LR8 A;  1OMU A;  2SGF I;  1SGQ I;  2QQC A;  2KMO A;  1FYB A;  2JXD A;  1CE3 A;  2XRC A;  4GI3 C;  1TBR R;  2JYY A;  1R0R I;  2GKT I;  1PPF I;  1YU6 C;  2GKR I;  2LEO A;  1SGP I;  1SGR I;  1BMO A;  1Z7K B;  1UVG A;  1HJA I;  1OMT A;  2KMR A;  2B0U C;  1PCE A;  2M5X A;  1LR7 A;  1TGS I;  2KMP A;  1OVO A;  1OYV I;  1SGD I;  1BUS A;  3SEK C;  1IY6 A;  2NU3 I;  1MT1 A;  4OVO A;  3SGB I;  1N13 A;  1Y1B A;  1UUC A;  2BUS A;  1TBQ R;  4HGU A;  1CGJ I;  2KMQ A;  2V53 A;  1CHO I;  1M8B A;  1SGY I;  2WCY A;  1DS3 I;  3OVO A;  1SGE I;  1H0Z A;  1SGN I;  1KMA A;  2GKV A;  3QTL D;  1IY5 A; 
#chains in the Genus database with same CATH topology
 2SGD I;  1X4S A;  1YTP A;  2QQD A;  2SGP I;  3CXL A;  2ENN A;  1TUS A;  1IW4 A;  2OVO A;  3UEJ A;  3RU0 A;  2ENZ A;  2V1C C;  2N52 A;  2JZM A;  2QQE A;  3QAH A;  3TOB A;  3VE5 A;  1LR9 A;  2E5R A;  1CSO I;  2KCX A;  1AN1 I;  2ROW A;  2ORW A;  1Y1C A;  2P6A C;  3B4V C;  2W0T A;  1Q9B A;  2N71 A;  2LUY A;  5DAE A;  1V1I A;  1KBE A;  2X3T A;  1ULK A;  5J8C A;  3SGQ I;  9WGA A;  2SGE I;  2GIV A;  2L7X A;  5E3P A;  1CT4 I;  5JHW C;  2PQ8 A;  2YQP A;  1CT0 I;  2N17 A;  2Y0M A;  1TIH A;  2ORV A;  2E73 A;  2F3C I;  1P9Z A;  2NU4 I;  5FUX A;  3UGL A;  1WGC A;  3BJI A;  4E1R A;  1HPT A;  2DKV A;  3R5B A;  2OD1 A;  1Z2I A;  3FSX A;  3TO9 A;  2ERW A;  1K7V A;  4B6D A;  2ELI A;  2ARP F;  2QPO A;  2NU1 I;  4A24 A;  2NU0 I;  2UZ3 A;  2RC4 A;  2GVI A;  3TJQ A;  5FUW A;  1TUR A;  2WVJ A;  2NU2 I;  3FSY A;  3OXF A;  3TOA A;  4E1P A;  5CCM A;  1K7U A;  4AML A;  2CWF A;  3HH2 C;  3VDP A;  2J9R A;  3PDN A;  1DS2 I;  1NUB A;  1CT2 I;  2A20 A;  3UFF A;  2K9H A;  1UVF A;  1ULM A;  1CGI I;  1P9G A;  2SGQ I;  5HQ8 A;  4DNC A;  4SGB I;  1WTJ A;  1K7T A;  1HDL A;  5FUY A;  1M8C A;  5J8F A;  1KBF A;  3E59 A;  1PJU A;  3OXG A;  1LR8 A;  1OMU A;  2LB7 A;  3R5A A;  2B8T A;  1V1H A;  2SGF I;  1SGQ I;  5CCL A;  1RFH A;  1X74 A;  2QQC A;  2KMO A;  3R5D A;  4UXI A;  1XBT A;  1FYB A;  2JXD A;  3E2I A;  2DB6 A;  1CE3 A;  1W3S A;  2XRC A;  1PTR A;  1TBR R;  4GI3 C;  3MEK A;  2JYY A;  2N1A B;  1R0R I;  2GKT I;  1UHA A;  2L8E A;  3OL0 A;  3TO7 A;  1PPF I;  4L9M A;  1YU6 C;  2GKR I;  2V1C A;  2J87 A;  2LEO A;  1SGP I;  1SGR I;  1BMO A;  4JCV E;  1Z7K B;  3D00 A;  1PTQ A;  1UVG A;  3KY9 A;  1NXU A;  1HJA I;  1U5K A;  1OMT A;  2B0U C;  2KMR A;  1PCE A;  1TGS I;  1LR7 A;  2M5X A;  4UXH A;  5E3Q A;  2KMP A;  2UVO A;  1XX6 A;  1OVO A;  1OYV I;  1SGD I;  3FC3 A;  1BUS A;  3SEK C;  2CWG A;  1FAR A;  1ULN A;  1IY6 A;  2NU3 I;  1W4R A;  1MJ9 A;  1MT1 A;  1TOT A;  1S20 A;  1TBN A;  1TBO A;  3UOE A;  1R79 A;  2X52 A;  7WGA A;  1WKX A;  1FAQ A;  4OVO A;  3SGB I;  1N13 A;  1Y1B A;  2OU2 A;  1MJB A;  1UUC A;  3VDU A;  3OXL A;  3UEY A;  2BUS A;  2JA1 A;  4WP4 A;  1TBQ R;  2FNF X;  1Y8F A;  4HGU A;  1CGJ I;  1HEV A;  2QQ0 A;  5EX0 A;  3UGI A;  3R5C A;  2KMQ A;  2V53 A;  2WGC A;  1CHO I;  1M8B A;  2DIP A;  1SGY I;  2WCY A;  1VDD A;  1DS3 I;  3OVO A;  1SGE I;  3TO6 A;  3GOX A;  1H0Z A;  1SGN I;  5EX3 A;  4MPI A;  2ODD A;  5FUV A;  2VRW B;  5HI7 A;  1KMA A;  3UGD A;  2OZU A;  2GKV A;  5E3R A;  3QTL D;  2JW6 A;  2YUU A;  3QWP A;  4FKD A;  2CWH A;  4UXJ A;  1IY5 A;  1FY7 A;  2CJS C;  2RIJ A;  1MJA A;  1XA6 A;  1WGT A; 
#chains in the Genus database with same CATH homology
 2SGD I;  1X4S A;  1YTP A;  2QQD A;  2SGP I;  3CXL A;  2ENN A;  1TUS A;  1IW4 A;  2OVO A;  3UEJ A;  3RU0 A;  2ENZ A;  2V1C C;  2N52 A;  2JZM A;  2QQE A;  3VE5 A;  1LR9 A;  2E5R A;  1CSO I;  2KCX A;  1AN1 I;  2ROW A;  2ORW A;  1Y1C A;  2P6A C;  3B4V C;  2W0T A;  2N71 A;  2LUY A;  5DAE A;  1V1I A;  1KBE A;  3GOX A;  3SGQ I;  2SGE I;  2L7X A;  5JHW C;  1CT4 I;  2YQP A;  1CT0 I;  2N17 A;  1TIH A;  2ORV A;  2E73 A;  2F3C I;  2NU4 I;  5FUX A;  3UGL A;  4E1R A;  3BJI A;  1HPT A;  2OD1 A;  2ERW A;  4B6D A;  2ELI A;  2ARP F;  2QPO A;  2NU1 I;  4A24 A;  2NU0 I;  2UZ3 A;  2GVI A;  3TJQ A;  5FUW A;  1TUR A;  2WVJ A;  2NU2 I;  3OXF A;  4E1P A;  5CCM A;  3HH2 C;  3VDP A;  2J9R A;  3PDN A;  2A20 A;  1DS2 I;  1NUB A;  1CT2 I;  3UFF A;  2K9H A;  1UVF A;  1CGI I;  2SGQ I;  5HQ8 A;  4SGB I;  1HDL A;  5FUY A;  1M8C A;  1KBF A;  3E59 A;  1PJU A;  3OXG A;  1LR8 A;  1OMU A;  2B8T A;  1V1H A;  2SGF I;  1SGQ I;  5CCL A;  1X74 A;  1RFH A;  2QQC A;  2KMO A;  4UXI A;  1FYB A;  1XBT A;  2JXD A;  3E2I A;  2DB6 A;  1CE3 A;  1W3S A;  2XRC A;  1PTR A;  1TBR R;  4GI3 C;  3MEK A;  2JYY A;  2N1A B;  1R0R I;  2GKT I;  2L8E A;  3OL0 A;  1PPF I;  4L9M A;  1YU6 C;  2GKR I;  2V1C A;  2J87 A;  2LEO A;  1SGP I;  1SGR I;  1BMO A;  4JCV E;  1Z7K B;  3D00 A;  1PTQ A;  1UVG A;  3KY9 A;  1HJA I;  1U5K A;  2B0U C;  1OMT A;  2KMR A;  1PCE A;  1TGS I;  1LR7 A;  2M5X A;  4UXH A;  2KMP A;  1XX6 A;  1OVO A;  1OYV I;  1SGD I;  3FC3 A;  1BUS A;  3SEK C;  1FAR A;  1IY6 A;  2NU3 I;  1W4R A;  1MT1 A;  1TOT A;  1TBN A;  1TBO A;  1R79 A;  1FAQ A;  4OVO A;  3SGB I;  1N13 A;  1Y1B A;  1UUC A;  3VDU A;  3OXL A;  3UEY A;  2BUS A;  2JA1 A;  1TBQ R;  2FNF X;  1Y8F A;  4HGU A;  1CGJ I;  2QQ0 A;  5EX0 A;  3UGI A;  2KMQ A;  2V53 A;  1CHO I;  1M8B A;  2DIP A;  1SGY I;  2WCY A;  1VDD A;  1DS3 I;  3OVO A;  1SGE I;  1H0Z A;  1SGN I;  5EX3 A;  2ODD A;  5FUV A;  2VRW B;  5HI7 A;  1KMA A;  3UGD A;  2GKV A;  3QTL D;  2JW6 A;  2YUU A;  3QWP A;  4FKD A;  4UXJ A;  2CJS C;  1XA6 A;  1IY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...