2QQDA

N47a mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
LHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVALIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
publication title Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 6
structure length 45
sequence length 45
chains with identical sequence D
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qqdA00
2SGEI 2KCXA 1BMOA 3QTLD 1CGJI 1SGPI 1AN1I 1IW4A 2QQDA 1BUSA 1CT4I 1SGNI 1CE3A 1PCEA 1M8CA 1KMAA 1OVOA 2N17A 2BUSA 3SGBI 2NU0I 1CT2I 1HPTA 1TURA 2KMQA 2SGPI 3SGQI 1TBQR 1DS3I 2LEOA 1Y1CA 1R0RI 2N71A 3TJQA 1SGQI 2B0UC 1TGSI 1OMUA 1HJAI 3SEKC 2GKVA 1CGII 1FYBA 1SGRI 2SGQI 1CSOI 1SGEI 2NU4I 2SGDI 3OVOA 1OYVI 2KMRA 2F3CI 1OMTA 1CT0I 2OVOA 1CHOI 2QQCA 2SGFI 1PPFI 2KMOA 3HH2C 1MT1A 1N13A 1LR7A 1TBRR 1Y1BA 2NU3I 1H0ZA 2JZMA 4OVOA 1M8BA 2NU2I 2KMPA 4SGBI 4HGUA 1SGDI 1UVGA 2JYYA 1NUBA 1UVFA 2N52A 1YTPA 5JHWC 1LR9A 2XRCA 1LR8A 2M5XA 2GKTI 1Z7KB 1SGYI 2ARPF 2NU1I 2ERWA 2V53A 2WCYA 3B4VC 1HDLA 1TIHA 1TUSA 2JXDA 1IY5A 5DAEA 1IY6A 1PJUA 2GKRI 1DS2I 1YU6C 1UUCA 4GI3C 2P6AC
chains in the Genus database with same CATH superfamily
3OL0A 2SGEI 2KCXA 1BMOA 3QTLD 1U5KA 3VDUA 1CGJI 1W3SA 2RC4A 2YQPA 1P9ZA 1SGPI 7WGAA 2CJSC 1AN1I 1IW4A 2QQDA 3UGLA 1WKXA 2V1CC 1CT4I 1SGNI 1ULKA 1PCEA 3QWPA 2QPOA 1MJBA 1M8CA 3VE5A 1CE3A 2DKVA 2QQEA 1KMAA 5CCLA 1OVOA 2N17A 2BUSA 3SGBI 2NU0I 2GIVA 2N1AB 1CT2I 5HI7A 2B8TA 3E59A 3OXGA 4MPIA 1HPTA 1TURA 2OU2A 1K7TA 2KMQA 2SGPI 3SGQI 1TBQR 2QQ0A 1DS3I 1VDDA 1S20A 3TO7A 2LEOA 1Y1CA 9WGAA 1R0RI 1V1HA 2L7XA 2N71A 3VDPA 3TJQA 1SGQI 2B0UC 1XA6A 3UFFA 1ULMA 2ENZA 2A20A 1TGSI 3CXLA 2L8EA 1OMUA 2DIPA 1HJAI 2V1CA 4UXJA 2WGCA 4L9MA 2CWHA 1P9GA 3SEKC 4DNCA 2GKVA 2E73A 1CGII 5EX0A 4A24A 3TOAA 1MJAA 3QAHA 1FYBA 1WTJA 2ELIA 1SGRI 1UHAA 1TBOA 2SGQI 2ENNA 1CSOI 1SGEI 2NU4I 2SGDI 3MEKA 2OD1A 3OXLA 5E3QA 2UVOA 1FAQA 3OVOA 2ROWA 1OYVI 5FUYA 2KMRA 3FSYA 1WGCA 1OMTA 2F3CI 4E1PA 4FKDA 1WGTA 3E2IA 1PTRA 1CT0I 2ORWA 1K7UA 2OVOA 1CHOI 2QQCA 1XX6A 1Z2IA 2CWFA 2SGFI 1PPFI 1R79A 2KMOA 3HH2C 1ULNA 1KBEA 2X3TA 3FC3A 1FY7A 1MT1A 1N13A 1Y8FA 2E5RA 2LUYA 3TOBA 1LR7A 1TBRR 1Y1BA 2NU3I 2ODDA 3UOEA 4UXHA 1V1IA 1H0ZA 3UEJA 2JZMA 4JCVE 4OVOA 2PQ8A 1M8BA 3PDNA 5E3RA 2GVIA 2NU2I 2KMPA 3R5AA 4SGBI 5EX3A 3R5CA 3RU0A 1TOTA 4WP4A 1X4SA 4UXIA 5E3PA 4HGUA 1SGDI 1UVGA 2JYYA 2ORVA 2JW6A 3KY9A 3FSXA 2J87A 3BJIA 2RIJA 5HQ8A 1BUSA 1NUBA 1UVFA 1HEVA 2N52A 1YTPA 2JA1A 5JHWC 1LR9A 2XRCA 2W0TA 3TO9A 1RFHA 2LB7A 1LR8A 3UGDA 3GOXA 5FUXA 2M5XA 5FUVA 3UEYA 2GKTI 1XBTA 3R5DA 2FNFX 1Z7KB 1SGYI 2ARPF 3R5BA 2YUUA 3TO6A 2CWGA 2NU1I 2ERWA 4AMLA 3D00A 2V53A 2WCYA 1Q9BA 1MJ9A 1W4RA 1X74A 2VRWB 3B4VC 1HDLA 1K7VA 1PTQA 1TIHA 1TUSA 1TBNA 2J9RA 1NXUA 2JXDA 1KBFA 1IY5A 5DAEA 5CCMA 1IY6A 3OXFA 1PJUA 2GKRI 1DS2I 2WVJA 4E1RA 5J8FA 2Y0MA 5J8CA 3UGIA 1YU6C 2K9HA 2OZUA 1UUCA 5FUWA 2X52A 4GI3C 2DB6A 2UZ3A 4B6DA 1FARA 2P6AC
chains in the Genus database with same CATH topology
3OL0A 2SGEI 2KCXA 1BMOA 3QTLD 1U5KA 3VDUA 1CGJI 1W3SA 2YQPA 1SGPI 2CJSC 1AN1I 1IW4A 2QQDA 3UGLA 2V1CC 1BUSA 1CT4I 1SGNI 1CE3A 1PCEA 3QWPA 2QPOA 3VE5A 1M8CA 2QQEA 1KMAA 5CCLA 1OVOA 2N17A 2BUSA 3SGBI 2NU0I 2N1AB 1CT2I 5HI7A 2B8TA 3E59A 3OXGA 1HPTA 1TURA 2KMQA 2SGPI 3SGQI 1TBQR 2QQ0A 1DS3I 1VDDA 2LEOA 1Y1CA 1R0RI 1V1HA 2L7XA 2N71A 3VDPA 3TJQA 1SGQI 2B0UC 1XA6A 3UFFA 2ENZA 2A20A 1TGSI 3CXLA 2L8EA 1OMUA 2DIPA 1HJAI 2V1CA 4UXJA 4L9MA 3SEKC 2GKVA 2E73A 1CGII 5EX0A 4A24A 1FYBA 2ELIA 1SGRI 1TBOA 2SGQI 2ENNA 1CSOI 1SGEI 2NU4I 2SGDI 3MEKA 2OD1A 3OXLA 1FAQA 3OVOA 2ROWA 1OYVI 5FUYA 2KMRA 2F3CI 1OMTA 4E1PA 4FKDA 3E2IA 1PTRA 1CT0I 2ORWA 2OVOA 1CHOI 2QQCA 1XX6A 2SGFI 1PPFI 1R79A 2KMOA 3HH2C 1KBEA 3FC3A 1MT1A 1N13A 1Y8FA 2E5RA 2LUYA 1LR7A 1TBRR 1Y1BA 2NU3I 2ODDA 4UXHA 1V1IA 1H0ZA 3UEJA 2JZMA 4JCVE 4OVOA 1M8BA 3PDNA 2GVIA 2NU2I 2KMPA 4SGBI 5EX3A 3RU0A 1TOTA 1X4SA 4UXIA 4HGUA 1SGDI 1UVGA 2JYYA 2ORVA 2JW6A 3KY9A 2J87A 3BJIA 5HQ8A 1NUBA 1UVFA 2N52A 1YTPA 2JA1A 5JHWC 1LR9A 2XRCA 2W0TA 1RFHA 1LR8A 3UGDA 3GOXA 5FUXA 2M5XA 5FUVA 3UEYA 2GKTI 1XBTA 2FNFX 1Z7KB 1SGYI 2ARPF 2YUUA 2NU1I 2ERWA 3D00A 2V53A 2WCYA 1W4RA 1X74A 2VRWB 3B4VC 1HDLA 1PTQA 1TIHA 1TUSA 1TBNA 2J9RA 2JXDA 1KBFA 1IY5A 5DAEA 5CCMA 1IY6A 3OXFA 1PJUA 2GKRI 1DS2I 2WVJA 4E1RA 3UGIA 1YU6C 2K9HA 1UUCA 5FUWA 4GI3C 2DB6A 2UZ3A 4B6DA 1FARA 2P6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGE I;  2KCX A;  1BMO A;  3QTL D;  1CGJ I;  1SGP I;  1AN1 I;  1IW4 A;  2QQD A;  1BUS A;  1CT4 I;  1SGN I;  1CE3 A;  1PCE A;  1M8C A;  1KMA A;  1OVO A;  2N17 A;  2BUS A;  3SGB I;  2NU0 I;  1CT2 I;  1HPT A;  1TUR A;  2KMQ A;  2SGP I;  3SGQ I;  1TBQ R;  1DS3 I;  2LEO A;  1Y1C A;  1R0R I;  2N71 A;  3TJQ A;  1SGQ I;  2B0U C;  1TGS I;  1OMU A;  1HJA I;  3SEK C;  2GKV A;  1CGI I;  1FYB A;  1SGR I;  2SGQ I;  1CSO I;  1SGE I;  2NU4 I;  2SGD I;  3OVO A;  1OYV I;  2KMR A;  2F3C I;  1OMT A;  1CT0 I;  2OVO A;  1CHO I;  2QQC A;  2SGF I;  1PPF I;  2KMO A;  3HH2 C;  1MT1 A;  1N13 A;  1LR7 A;  1TBR R;  1Y1B A;  2NU3 I;  1H0Z A;  2JZM A;  4OVO A;  1M8B A;  2NU2 I;  2KMP A;  4SGB I;  4HGU A;  1SGD I;  1UVG A;  2JYY A;  1NUB A;  1UVF A;  2N52 A;  1YTP A;  5JHW C;  1LR9 A;  2XRC A;  1LR8 A;  2M5X A;  2GKT I;  1Z7K B;  1SGY I;  2ARP F;  2NU1 I;  2ERW A;  2V53 A;  2WCY A;  3B4V C;  1HDL A;  1TIH A;  1TUS A;  2JXD A;  1IY5 A;  5DAE A;  1IY6 A;  1PJU A;  2GKR I;  1DS2 I;  1YU6 C;  1UUC A;  4GI3 C;  2P6A C; 
#chains in the Genus database with same CATH topology
 3OL0 A;  2SGE I;  2KCX A;  1BMO A;  3QTL D;  1U5K A;  3VDU A;  1CGJ I;  1W3S A;  2RC4 A;  2YQP A;  1P9Z A;  1SGP I;  7WGA A;  2CJS C;  1AN1 I;  1IW4 A;  2QQD A;  3UGL A;  1WKX A;  2V1C C;  1CT4 I;  1SGN I;  1ULK A;  1PCE A;  3QWP A;  2QPO A;  1MJB A;  1M8C A;  3VE5 A;  1CE3 A;  2DKV A;  2QQE A;  1KMA A;  5CCL A;  1OVO A;  2N17 A;  2BUS A;  3SGB I;  2NU0 I;  2GIV A;  2N1A B;  1CT2 I;  5HI7 A;  2B8T A;  3E59 A;  3OXG A;  4MPI A;  1HPT A;  1TUR A;  2OU2 A;  1K7T A;  2KMQ A;  2SGP I;  3SGQ I;  1TBQ R;  2QQ0 A;  1DS3 I;  1VDD A;  1S20 A;  3TO7 A;  2LEO A;  1Y1C A;  9WGA A;  1R0R I;  1V1H A;  2L7X A;  2N71 A;  3VDP A;  3TJQ A;  1SGQ I;  2B0U C;  1XA6 A;  3UFF A;  1ULM A;  2ENZ A;  2A20 A;  1TGS I;  3CXL A;  2L8E A;  1OMU A;  2DIP A;  1HJA I;  2V1C A;  4UXJ A;  2WGC A;  4L9M A;  2CWH A;  1P9G A;  3SEK C;  4DNC A;  2GKV A;  2E73 A;  1CGI I;  5EX0 A;  4A24 A;  3TOA A;  1MJA A;  3QAH A;  1FYB A;  1WTJ A;  2ELI A;  1SGR I;  1UHA A;  1TBO A;  2SGQ I;  2ENN A;  1CSO I;  1SGE I;  2NU4 I;  2SGD I;  3MEK A;  2OD1 A;  3OXL A;  5E3Q A;  2UVO A;  1FAQ A;  3OVO A;  2ROW A;  1OYV I;  5FUY A;  2KMR A;  3FSY A;  1WGC A;  1OMT A;  2F3C I;  4E1P A;  4FKD A;  1WGT A;  3E2I A;  1PTR A;  1CT0 I;  2ORW A;  1K7U A;  2OVO A;  1CHO I;  2QQC A;  1XX6 A;  1Z2I A;  2CWF A;  2SGF I;  1PPF I;  1R79 A;  2KMO A;  3HH2 C;  1ULN A;  1KBE A;  2X3T A;  3FC3 A;  1FY7 A;  1MT1 A;  1N13 A;  1Y8F A;  2E5R A;  2LUY A;  3TOB A;  1LR7 A;  1TBR R;  1Y1B A;  2NU3 I;  2ODD A;  3UOE A;  4UXH A;  1V1I A;  1H0Z A;  3UEJ A;  2JZM A;  4JCV E;  4OVO A;  2PQ8 A;  1M8B A;  3PDN A;  5E3R A;  2GVI A;  2NU2 I;  2KMP A;  3R5A A;  4SGB I;  5EX3 A;  3R5C A;  3RU0 A;  1TOT A;  4WP4 A;  1X4S A;  4UXI A;  5E3P A;  4HGU A;  1SGD I;  1UVG A;  2JYY A;  2ORV A;  2JW6 A;  3KY9 A;  3FSX A;  2J87 A;  3BJI A;  2RIJ A;  5HQ8 A;  1BUS A;  1NUB A;  1UVF A;  1HEV A;  2N52 A;  1YTP A;  2JA1 A;  5JHW C;  1LR9 A;  2XRC A;  2W0T A;  3TO9 A;  1RFH A;  2LB7 A;  1LR8 A;  3UGD A;  3GOX A;  5FUX A;  2M5X A;  5FUV A;  3UEY A;  2GKT I;  1XBT A;  3R5D A;  2FNF X;  1Z7K B;  1SGY I;  2ARP F;  3R5B A;  2YUU A;  3TO6 A;  2CWG A;  2NU1 I;  2ERW A;  4AML A;  3D00 A;  2V53 A;  2WCY A;  1Q9B A;  1MJ9 A;  1W4R A;  1X74 A;  2VRW B;  3B4V C;  1HDL A;  1K7V A;  1PTQ A;  1TIH A;  1TUS A;  1TBN A;  2J9R A;  1NXU A;  2JXD A;  1KBF A;  1IY5 A;  5DAE A;  5CCM A;  1IY6 A;  3OXF A;  1PJU A;  2GKR I;  1DS2 I;  2WVJ A;  4E1R A;  5J8F A;  2Y0M A;  5J8C A;  3UGI A;  1YU6 C;  2K9H A;  2OZU A;  1UUC A;  5FUW A;  2X52 A;  4GI3 C;  2DB6 A;  2UZ3 A;  4B6D A;  1FAR A;  2P6A C; 
#chains in the Genus database with same CATH homology
 3OL0 A;  2SGE I;  2KCX A;  1BMO A;  3QTL D;  1U5K A;  3VDU A;  1CGJ I;  1W3S A;  2YQP A;  1SGP I;  2CJS C;  1AN1 I;  1IW4 A;  2QQD A;  3UGL A;  2V1C C;  1BUS A;  1CT4 I;  1SGN I;  1CE3 A;  1PCE A;  3QWP A;  2QPO A;  3VE5 A;  1M8C A;  2QQE A;  1KMA A;  5CCL A;  1OVO A;  2N17 A;  2BUS A;  3SGB I;  2NU0 I;  2N1A B;  1CT2 I;  5HI7 A;  2B8T A;  3E59 A;  3OXG A;  1HPT A;  1TUR A;  2KMQ A;  2SGP I;  3SGQ I;  1TBQ R;  2QQ0 A;  1DS3 I;  1VDD A;  2LEO A;  1Y1C A;  1R0R I;  1V1H A;  2L7X A;  2N71 A;  3VDP A;  3TJQ A;  1SGQ I;  2B0U C;  1XA6 A;  3UFF A;  2ENZ A;  2A20 A;  1TGS I;  3CXL A;  2L8E A;  1OMU A;  2DIP A;  1HJA I;  2V1C A;  4UXJ A;  4L9M A;  3SEK C;  2GKV A;  2E73 A;  1CGI I;  5EX0 A;  4A24 A;  1FYB A;  2ELI A;  1SGR I;  1TBO A;  2SGQ I;  2ENN A;  1CSO I;  1SGE I;  2NU4 I;  2SGD I;  3MEK A;  2OD1 A;  3OXL A;  1FAQ A;  3OVO A;  2ROW A;  1OYV I;  5FUY A;  2KMR A;  2F3C I;  1OMT A;  4E1P A;  4FKD A;  3E2I A;  1PTR A;  1CT0 I;  2ORW A;  2OVO A;  1CHO I;  2QQC A;  1XX6 A;  2SGF I;  1PPF I;  1R79 A;  2KMO A;  3HH2 C;  1KBE A;  3FC3 A;  1MT1 A;  1N13 A;  1Y8F A;  2E5R A;  2LUY A;  1LR7 A;  1TBR R;  1Y1B A;  2NU3 I;  2ODD A;  4UXH A;  1V1I A;  1H0Z A;  3UEJ A;  2JZM A;  4JCV E;  4OVO A;  1M8B A;  3PDN A;  2GVI A;  2NU2 I;  2KMP A;  4SGB I;  5EX3 A;  3RU0 A;  1TOT A;  1X4S A;  4UXI A;  4HGU A;  1SGD I;  1UVG A;  2JYY A;  2ORV A;  2JW6 A;  3KY9 A;  2J87 A;  3BJI A;  5HQ8 A;  1NUB A;  1UVF A;  2N52 A;  1YTP A;  2JA1 A;  5JHW C;  1LR9 A;  2XRC A;  2W0T A;  1RFH A;  1LR8 A;  3UGD A;  3GOX A;  5FUX A;  2M5X A;  5FUV A;  3UEY A;  2GKT I;  1XBT A;  2FNF X;  1Z7K B;  1SGY I;  2ARP F;  2YUU A;  2NU1 I;  2ERW A;  3D00 A;  2V53 A;  2WCY A;  1W4R A;  1X74 A;  2VRW B;  3B4V C;  1HDL A;  1PTQ A;  1TIH A;  1TUS A;  1TBN A;  2J9R A;  2JXD A;  1KBF A;  1IY5 A;  5DAE A;  5CCM A;  1IY6 A;  3OXF A;  1PJU A;  2GKR I;  1DS2 I;  2WVJ A;  4E1R A;  3UGI A;  1YU6 C;  2K9H A;  1UUC A;  5FUW A;  4GI3 C;  2DB6 A;  2UZ3 A;  4B6D A;  1FAR A;  2P6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...