2QQDA

N47a mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
LHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVALIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
publication title Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 6
structure length 45
sequence length 45
chains with identical sequence D
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qqdA00
1AN1I 1LR8A 1UVFA 1HJAI 1CHOI 1DS3I 2N17A 1CT4I 2P6AC 1N13A 2XRCA 1SGPI 3SEKC 2GKRI 1OMTA 2NU0I 2KCXA 3SGQI 2BUSA 1CT2I 2SGQI 2SGEI 2N71A 2NU1I 2ERWA 2N52A 1UUCA 2B0UC 1DS2I 2M5XA 1TBRR 2WCYA 1CE3A 2JZMA 1IY6A 1HDLA 3TJQA 2JYYA 2KMOA 1YTPA 1Y1CA 2KMQA 2NU2I 1CGII 2F3CI 1SGDI 2KMPA 1LR7A 1Z7KB 2QQDA 3HH2C 4HGUA 1TBQR 3QTLD 1MT1A 2ARPF 1BMOA 1TUSA 2SGPI 1UVGA 1Y1BA 1OVOA 5JHWC 1FYBA 1IW4A 1H0ZA 1CSOI 2KMRA 3OVOA 1SGRI 2JXDA 5DAEA 3B4VC 1HPTA 1CT0I 4GI3C 1SGEI 2NU3I 2NU4I 1CGJI 1TURA 2SGFI 1BUSA 1PPFI 1R0RI 3SGBI 2OVOA 1YU6C 4OVOA 4SGBI 1OYVI 1M8BA 1SGQI 1PJUA 1TIHA 2V53A 2LEOA 1IY5A 2SGDI 1SGNI 1LR9A 1KMAA 2QQCA 1M8CA 1TGSI 1NUBA 1OMUA 1PCEA 2GKTI 1SGYI 2GKVA
chains in the Genus database with same CATH superfamily
1AN1I 1LR8A 4E1PA 1V1IA 1UVFA 1HJAI 2GIVA 1CHOI 1DS3I 2N17A 1CT4I 1WGCA 2P6AC 3OXGA 1MJ9A 3TO6A 3UEYA 1N13A 2XRCA 1K7VA 1SGPI 2CWHA 1OMTA 2GKRI 2VRWB 2NU0I 3R5CA 1ULMA 2KCXA 3SGQI 2BUSA 2JA1A 1MJBA 2JW6A 1W3SA 1WGTA 2ODDA 1X4SA 5E3QA 5FUVA 2Y0MA 4B6DA 1CT2I 2PQ8A 2SGQI 2SGEI 2J87A 2K9HA 5E3RA 2UVOA 2N71A 1P9ZA 4A24A 2NU1I 2OU2A 1FAQA 3TO9A 2ERWA 2N52A 3BJIA 4UXJA 1UUCA 2B0UC 2DIPA 1DS2I 1XBTA 2M5XA 2RIJA 2ROWA 1TBRR 1X74A 2X52A 2WCYA 5EX3A 1CE3A 2X3TA 2JZMA 3QAHA 2W0TA 3VDPA 3UGIA 1IY6A 2V1CA 3PDNA 3VE5A 1HDLA 2J9RA 5FUYA 1HEVA 3TJQA 2JYYA 1R79A 2KMOA 3UGLA 1YTPA 1U5KA 1Y1CA 2N1AB 4WP4A 2KMQA 5HI7A 2NU2I 2ORWA 1CGII 3OXLA 3R5AA 1VDDA 1ULKA 4DNCA 1KBFA 2F3CI 1Z2IA 2YQPA 1SGDI 2KMPA 1LR7A 3TO7A 1Z7KB 2QQDA 1WKXA 3HH2C 5CCMA 1FY7A 3SEKC 4HGUA 3FC3A 2L7XA 1S20A 1NXUA 1TBQR 2CWGA 1MT1A 2QPOA 3QTLD 2ARPF 1BMOA 3D00A 1TUSA 2SGPI 2WVJA 2CWFA 1UHAA 1UVGA 1Y1BA 1OVOA 2OD1A 3KY9A 5JHWC 1MJAA 2UZ3A 1IW4A 3UFFA 1FYBA 1P9GA 1PTRA 3R5BA 1H0ZA 1Y8FA 4MPIA 5EX0A 1CSOI 2KMRA 3OVOA 4JCVE 1SGRI 4UXHA 2CJSC 3VDUA 2GVIA 1W4RA 5FUWA 2A20A 2JXDA 2ENNA 9WGAA 5DAEA 3B4VC 3RU0A 5J8CA 1Q9BA 1HPTA 3CXLA 2QQEA 1V1HA 4E1RA 1CT0I 4GI3C 1SGEI 5E3PA 1XX6A 2NU4I 2NU3I 1CGJI 2DKVA 2QQ0A 3E2IA 1TURA 3UGDA 2SGFI 5HQ8A 2ORVA 3QWPA 1BUSA 1PPFI 3OL0A 2DB6A 1R0RI 2B8TA 3SGBI 1K7TA 3GOXA 2OVOA 1TBNA 2ENZA 4FKDA 1TOTA 5FUXA 1PTQA 3FSYA 3TOAA 1YU6C 1WTJA 3OXFA 3UEJA 3UOEA 1TBOA 4OVOA 4AMLA 2FNFX 1OYVI 4SGBI 4UXIA 3FSXA 3TOBA 3MEKA 1XA6A 2V1CC 1M8BA 1SGQI 1RFHA 1PJUA 1TIHA 2V53A 2LEOA 2RC4A 3E59A 1IY5A 2E5RA 2OZUA 5J8FA 2L8EA 2LUYA 2SGDI 2YUUA 1KBEA 4L9MA 1SGNI 2E73A 2ELIA 2WGCA 1LR9A 1KMAA 1ULNA 1M8CA 1TGSI 2QQCA 5CCLA 1NUBA 1OMUA 1FARA 1PCEA 2GKTI 1SGYI 2LB7A 3R5DA 7WGAA 1K7UA 2GKVA
chains in the Genus database with same CATH topology
1AN1I 1LR8A 4E1PA 1V1IA 1UVFA 1HJAI 1CHOI 1DS3I 2N17A 1CT4I 2P6AC 3OXGA 3UEYA 1N13A 2XRCA 1SGPI 3SEKC 2GKRI 1OMTA 2VRWB 2NU0I 2KCXA 3SGQI 2BUSA 2JA1A 2JW6A 1W3SA 2ODDA 5FUVA 4B6DA 1CT2I 2SGQI 2SGEI 2J87A 2K9HA 2N71A 4A24A 2NU1I 1FAQA 2ERWA 2N52A 3BJIA 4UXJA 1UUCA 2B0UC 2DIPA 1DS2I 1XBTA 2M5XA 2ROWA 1TBRR 1X74A 5EX3A 2WCYA 1CE3A 2JZMA 2W0TA 3VDPA 3UGIA 1IY6A 2V1CA 3PDNA 3VE5A 1HDLA 2J9RA 5FUYA 3TJQA 2JYYA 1R79A 2KMOA 3UGLA 1YTPA 1U5KA 1Y1CA 2N1AB 2KMQA 5HI7A 2NU2I 2ORWA 1CGII 3OXLA 1VDDA 1KBFA 2F3CI 2YQPA 1SGDI 2KMPA 1LR7A 1Z7KB 2QQDA 3HH2C 5CCMA 4HGUA 3FC3A 2L7XA 1TBQR 3QTLD 1MT1A 2QPOA 2ARPF 1BMOA 3D00A 1TUSA 2SGPI 2WVJA 1UVGA 1Y1BA 1OVOA 2OD1A 3KY9A 5JHWC 2UZ3A 1IW4A 1FYBA 3UFFA 1PTRA 1H0ZA 1Y8FA 5EX0A 1CSOI 2KMRA 3OVOA 4JCVE 1SGRI 4UXHA 2CJSC 2GVIA 1W4RA 5FUWA 2A20A 2JXDA 2ENNA 5DAEA 3B4VC 3RU0A 1HPTA 3CXLA 2QQEA 1V1HA 4E1RA 1CT0I 4GI3C 1SGEI 1XX6A 2NU4I 2NU3I 1CGJI 2QQ0A 3E2IA 1TURA 3UGDA 1SGYI 2SGFI 5HQ8A 2ORVA 3QWPA 1BUSA 1PPFI 3OL0A 2DB6A 1R0RI 2B8TA 3SGBI 3GOXA 2OVOA 1TBNA 2ENZA 4FKDA 1TOTA 5FUXA 1PTQA 1YU6C 3OXFA 3UEJA 1TBOA 4OVOA 2FNFX 1OYVI 4SGBI 4UXIA 3MEKA 1XA6A 2V1CC 1M8BA 1SGQI 1RFHA 1PJUA 1TIHA 2V53A 2LEOA 3E59A 1IY5A 2E5RA 2L8EA 2LUYA 2SGDI 2YUUA 1KBEA 4L9MA 1SGNI 2E73A 2ELIA 1LR9A 1KMAA 2QQCA 1M8CA 1TGSI 5CCLA 1NUBA 1OMUA 1FARA 1PCEA 2GKTI 1X4SA 3VDUA 2GKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AN1 I;  1LR8 A;  1UVF A;  1HJA I;  1CHO I;  1DS3 I;  2N17 A;  1CT4 I;  2P6A C;  1N13 A;  2XRC A;  1SGP I;  3SEK C;  2GKR I;  1OMT A;  2NU0 I;  2KCX A;  3SGQ I;  2BUS A;  1CT2 I;  2SGQ I;  2SGE I;  2N71 A;  2NU1 I;  2ERW A;  2N52 A;  1UUC A;  2B0U C;  1DS2 I;  2M5X A;  1TBR R;  2WCY A;  1CE3 A;  2JZM A;  1IY6 A;  1HDL A;  3TJQ A;  2JYY A;  2KMO A;  1YTP A;  1Y1C A;  2KMQ A;  2NU2 I;  1CGI I;  2F3C I;  1SGD I;  2KMP A;  1LR7 A;  1Z7K B;  2QQD A;  3HH2 C;  4HGU A;  1TBQ R;  3QTL D;  1MT1 A;  2ARP F;  1BMO A;  1TUS A;  2SGP I;  1UVG A;  1Y1B A;  1OVO A;  5JHW C;  1FYB A;  1IW4 A;  1H0Z A;  1CSO I;  2KMR A;  3OVO A;  1SGR I;  2JXD A;  5DAE A;  3B4V C;  1HPT A;  1CT0 I;  4GI3 C;  1SGE I;  2NU3 I;  2NU4 I;  1CGJ I;  1TUR A;  2SGF I;  1BUS A;  1PPF I;  1R0R I;  3SGB I;  2OVO A;  1YU6 C;  4OVO A;  4SGB I;  1OYV I;  1M8B A;  1SGQ I;  1PJU A;  1TIH A;  2V53 A;  2LEO A;  1IY5 A;  2SGD I;  1SGN I;  1LR9 A;  1KMA A;  2QQC A;  1M8C A;  1TGS I;  1NUB A;  1OMU A;  1PCE A;  2GKT I;  1SGY I;  2GKV A; 
#chains in the Genus database with same CATH topology
 1AN1 I;  1LR8 A;  4E1P A;  1V1I A;  1UVF A;  1HJA I;  2GIV A;  1CHO I;  1DS3 I;  2N17 A;  1CT4 I;  1WGC A;  2P6A C;  3OXG A;  1MJ9 A;  3TO6 A;  3UEY A;  1N13 A;  2XRC A;  1K7V A;  1SGP I;  2CWH A;  1OMT A;  2GKR I;  2VRW B;  2NU0 I;  3R5C A;  1ULM A;  2KCX A;  3SGQ I;  2BUS A;  2JA1 A;  1MJB A;  2JW6 A;  1W3S A;  1WGT A;  2ODD A;  1X4S A;  5E3Q A;  5FUV A;  2Y0M A;  4B6D A;  1CT2 I;  2PQ8 A;  2SGQ I;  2SGE I;  2J87 A;  2K9H A;  5E3R A;  2UVO A;  2N71 A;  1P9Z A;  4A24 A;  2NU1 I;  2OU2 A;  1FAQ A;  3TO9 A;  2ERW A;  2N52 A;  3BJI A;  4UXJ A;  1UUC A;  2B0U C;  2DIP A;  1DS2 I;  1XBT A;  2M5X A;  2RIJ A;  2ROW A;  1TBR R;  1X74 A;  2X52 A;  2WCY A;  5EX3 A;  1CE3 A;  2X3T A;  2JZM A;  3QAH A;  2W0T A;  3VDP A;  3UGI A;  1IY6 A;  2V1C A;  3PDN A;  3VE5 A;  1HDL A;  2J9R A;  5FUY A;  1HEV A;  3TJQ A;  2JYY A;  1R79 A;  2KMO A;  3UGL A;  1YTP A;  1U5K A;  1Y1C A;  2N1A B;  4WP4 A;  2KMQ A;  5HI7 A;  2NU2 I;  2ORW A;  1CGI I;  3OXL A;  3R5A A;  1VDD A;  1ULK A;  4DNC A;  1KBF A;  2F3C I;  1Z2I A;  2YQP A;  1SGD I;  2KMP A;  1LR7 A;  3TO7 A;  1Z7K B;  2QQD A;  1WKX A;  3HH2 C;  5CCM A;  1FY7 A;  3SEK C;  4HGU A;  3FC3 A;  2L7X A;  1S20 A;  1NXU A;  1TBQ R;  2CWG A;  1MT1 A;  2QPO A;  3QTL D;  2ARP F;  1BMO A;  3D00 A;  1TUS A;  2SGP I;  2WVJ A;  2CWF A;  1UHA A;  1UVG A;  1Y1B A;  1OVO A;  2OD1 A;  3KY9 A;  5JHW C;  1MJA A;  2UZ3 A;  1IW4 A;  3UFF A;  1FYB A;  1P9G A;  1PTR A;  3R5B A;  1H0Z A;  1Y8F A;  4MPI A;  5EX0 A;  1CSO I;  2KMR A;  3OVO A;  4JCV E;  1SGR I;  4UXH A;  2CJS C;  3VDU A;  2GVI A;  1W4R A;  5FUW A;  2A20 A;  2JXD A;  2ENN A;  9WGA A;  5DAE A;  3B4V C;  3RU0 A;  5J8C A;  1Q9B A;  1HPT A;  3CXL A;  2QQE A;  1V1H A;  4E1R A;  1CT0 I;  4GI3 C;  1SGE I;  5E3P A;  1XX6 A;  2NU4 I;  2NU3 I;  1CGJ I;  2DKV A;  2QQ0 A;  3E2I A;  1TUR A;  3UGD A;  2SGF I;  5HQ8 A;  2ORV A;  3QWP A;  1BUS A;  1PPF I;  3OL0 A;  2DB6 A;  1R0R I;  2B8T A;  3SGB I;  1K7T A;  3GOX A;  2OVO A;  1TBN A;  2ENZ A;  4FKD A;  1TOT A;  5FUX A;  1PTQ A;  3FSY A;  3TOA A;  1YU6 C;  1WTJ A;  3OXF A;  3UEJ A;  3UOE A;  1TBO A;  4OVO A;  4AML A;  2FNF X;  1OYV I;  4SGB I;  4UXI A;  3FSX A;  3TOB A;  3MEK A;  1XA6 A;  2V1C C;  1M8B A;  1SGQ I;  1RFH A;  1PJU A;  1TIH A;  2V53 A;  2LEO A;  2RC4 A;  3E59 A;  1IY5 A;  2E5R A;  2OZU A;  5J8F A;  2L8E A;  2LUY A;  2SGD I;  2YUU A;  1KBE A;  4L9M A;  1SGN I;  2E73 A;  2ELI A;  2WGC A;  1LR9 A;  1KMA A;  1ULN A;  1M8C A;  1TGS I;  2QQC A;  5CCL A;  1NUB A;  1OMU A;  1FAR A;  1PCE A;  2GKT I;  1SGY I;  2LB7 A;  3R5D A;  7WGA A;  1K7U A;  2GKV A; 
#chains in the Genus database with same CATH homology
 1AN1 I;  1LR8 A;  4E1P A;  1V1I A;  1UVF A;  1HJA I;  1CHO I;  1DS3 I;  2N17 A;  1CT4 I;  2P6A C;  3OXG A;  3UEY A;  1N13 A;  2XRC A;  1SGP I;  3SEK C;  2GKR I;  1OMT A;  2VRW B;  2NU0 I;  2KCX A;  3SGQ I;  2BUS A;  2JA1 A;  2JW6 A;  1W3S A;  2ODD A;  5FUV A;  4B6D A;  1CT2 I;  2SGQ I;  2SGE I;  2J87 A;  2K9H A;  2N71 A;  4A24 A;  2NU1 I;  1FAQ A;  2ERW A;  2N52 A;  3BJI A;  4UXJ A;  1UUC A;  2B0U C;  2DIP A;  1DS2 I;  1XBT A;  2M5X A;  2ROW A;  1TBR R;  1X74 A;  5EX3 A;  2WCY A;  1CE3 A;  2JZM A;  2W0T A;  3VDP A;  3UGI A;  1IY6 A;  2V1C A;  3PDN A;  3VE5 A;  1HDL A;  2J9R A;  5FUY A;  3TJQ A;  2JYY A;  1R79 A;  2KMO A;  3UGL A;  1YTP A;  1U5K A;  1Y1C A;  2N1A B;  2KMQ A;  5HI7 A;  2NU2 I;  2ORW A;  1CGI I;  3OXL A;  1VDD A;  1KBF A;  2F3C I;  2YQP A;  1SGD I;  2KMP A;  1LR7 A;  1Z7K B;  2QQD A;  3HH2 C;  5CCM A;  4HGU A;  3FC3 A;  2L7X A;  1TBQ R;  3QTL D;  1MT1 A;  2QPO A;  2ARP F;  1BMO A;  3D00 A;  1TUS A;  2SGP I;  2WVJ A;  1UVG A;  1Y1B A;  1OVO A;  2OD1 A;  3KY9 A;  5JHW C;  2UZ3 A;  1IW4 A;  1FYB A;  3UFF A;  1PTR A;  1H0Z A;  1Y8F A;  5EX0 A;  1CSO I;  2KMR A;  3OVO A;  4JCV E;  1SGR I;  4UXH A;  2CJS C;  2GVI A;  1W4R A;  5FUW A;  2A20 A;  2JXD A;  2ENN A;  5DAE A;  3B4V C;  3RU0 A;  1HPT A;  3CXL A;  2QQE A;  1V1H A;  4E1R A;  1CT0 I;  4GI3 C;  1SGE I;  1XX6 A;  2NU4 I;  2NU3 I;  1CGJ I;  2QQ0 A;  3E2I A;  1TUR A;  3UGD A;  1SGY I;  2SGF I;  5HQ8 A;  2ORV A;  3QWP A;  1BUS A;  1PPF I;  3OL0 A;  2DB6 A;  1R0R I;  2B8T A;  3SGB I;  3GOX A;  2OVO A;  1TBN A;  2ENZ A;  4FKD A;  1TOT A;  5FUX A;  1PTQ A;  1YU6 C;  3OXF A;  3UEJ A;  1TBO A;  4OVO A;  2FNF X;  1OYV I;  4SGB I;  4UXI A;  3MEK A;  1XA6 A;  2V1C C;  1M8B A;  1SGQ I;  1RFH A;  1PJU A;  1TIH A;  2V53 A;  2LEO A;  3E59 A;  1IY5 A;  2E5R A;  2L8E A;  2LUY A;  2SGD I;  2YUU A;  1KBE A;  4L9M A;  1SGN I;  2E73 A;  2ELI A;  1LR9 A;  1KMA A;  2QQC A;  1M8C A;  1TGS I;  5CCL A;  1NUB A;  1OMU A;  1FAR A;  1PCE A;  2GKT I;  1X4S A;  3VDU A;  2GKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...