2J9RA

Thymidine kinase from b. anthracis in complex with dt.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
195
structure length
178
Chain Sequence
SHMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPTKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 44
structure length 178
sequence length 195
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2j9rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j9rA01
5JJKA 3GJ0A 2BKEA 2HLDA 2C99A 1K8RA 3IQWA 4DLWA 3RVBA 4XD7D 2IWHA 2O8BA 5JSZB 1UADA 1VIYA 2ORVA 2QN6A 5JMTA 4QJ3A 1W0KA 2J0VA 1YZQA 1NKTA 4MDFA 2B8TA 2FSHA 1N6LA 4EPXA 1P3JA 3P20A 3UGIA 4XVRA 1QDEA 2ZUCA 4LCBA 1FP6A 1NVVQ 3LLMA 4IVPA 5TDHA 1S2MA 1G6OA 4UNSA 1E2PA 1FPMA 2MSDB 1F60A 3RS5A 2VP6A 1VYTA 1OFUX 4POAA 4LX0A 2W6IA 4DWJA 821PA 2QU8A 4TTQA 3IIMA 4C2TA 3NEYA 2NOAA 3Q7PA 1PZNA 4P31A 4C0QC 4DSUA 1E9EA 4B2IA 1X1RA 2Q3FA 1Z6GA 2E73A 1Y3AA 1ZUNB 3MUFA 4P4SA 1R8QA 4URYR 3I8SA 2WBLC 4FMDB 4B34A 5FR2A 3EX7C 5FPTA 3GLHA 4MGYR 4ZDIA 3VX4A 3RRZA 1P5ZB 1UBFA 3JVVA 3DM5A 2YWFA 4BFTA 4KSBA 2AX4A 2VSFA 1Z2CA 4H9GA 1IJEA 2VP4A 4B43A 4A36A 4D80A 2B92A 4KAXA 1T4GA 3UMFA 1P2SA 3THXA 3NHAA 1GILA 3O8BA 3TVDA 1P9RA 5D3QA 4EKDA 5L8VA 4JL5A 2NMVA 1ZVQA 1W49A 5FUYA 4Y0AA 2GXSA 3GCGA 4CT4B 5EE3A 5KO2A 3HR8A 5CLLA 3K9HA 3P1JA 2OV2A 2QAGA 3BORA 2GESA 1Z07A 2ZVPX 3DHWC 4KFRA 1IXRC 4CEHB 1P2UA 1N6RA 2QY9A 3E1SA 5FBQB 3QEOA 3TK1A 5KPDA 1W7AA 1SVKA 1GNQA 4OKSA 4QJ4A 2J0SA 3Q85A 1J2JA 5L3VA 1W1WA 3HU1A 1VG8A 3EXAA 1CU1A 2ZYTX 2LKCA 5DHFA 4RFSB 1Q1BA 1BIFA 2C03A 4Y0VA 5LBIA 2WKPA 1E9FA 4NZYA 5F3WB 4PQRA 2BCJQ 4KHZA 4Q4JB 2EYQA 3KB2A 4DDTA 5JSZA 5BN4A 3ZLJA 1TX4B 1W48A 2PCJA 1DE0A 2FJUA 4DLUA 5JI2E 3GLIE 2FFAA 1OYYA 1PUJA 1VTKA 1KKLA 1SQ5A 2EFCB 3E5HA 3X1YA 2RB4A 4PSAA 3QKUA 5DI3B 3BAFA 3CR8A 4FMDF 2EU8A 1ZU5A 2MSEB 1G6HA 2FE4A 1MV5A 3J81k 2A3RA 1CF4A 2QTVB 2QPAA 2BVNA 4QGFA 3CRW1 3KX2A 2CDNA 2CK3D 1HE8B 2GK6A 4L9SA 3LY5A 2FGJA 1XZPA 3VNUA 5H8WA 3QVVA 2GXAA 3SYLA 2IF2A 2D06A 2P65A 4QHTA 3SJZA 4TSFA 4DRZA 1E3MA 3LW7A 5A0FA 4ITRC 3GFTA 4XIGS 3KKNA 3TMKA 2QGNA 2SHKA 1L4YA 3QKRA 2HT1A 4L9MA 2PJZA 3ZQJA 3BE4A 1GOTA 4UXJA 1IN8A 2OCPA 3GFPA 4FWIB 3QBVA 3W6PA 1XTKA 3Q3JB 2V1XA 1XJCA 1X6VA 2PEYA 5KU1A 4UXIA 1M7GA 5IF9A 3NH9A 1NG1A 1W0JD 4OBEA 2QBYB 1KSGA 4M22A 1KO1A 4B74A 3NVAA 4GMXA 1G8FA 1Z6AA 2BEJA 1VECA 2NO7A 2OUKA 2VRWA 2F1JA 1EK0A 4HDQB 4IOJA 1TQ6A 4QBFA 5FTMA 3SI7A 4F4CA 1ESMA 2J7PD 3DOEA 2GBLC 4NCIA 1SXJB 1XZQA 3GEHA 3BS4A 2DB6A 4HUQB 1J8MF 2WWIA 1FP7A 2JA1A 1W5TA 2V7QD 2XITA 1VCIA 2H1LA 3U4QB 2P5TB 3EWSA 1D2MA 4Q7JB 4A6XA 2W6JA 1W36C 3IUYA 3V4RA 3OFNA 4TLCA 5DN6D 4AY2A 1DPFA 2J1LA 1OJLA 3NXSA 4LJ4A 5EXPA 4C0AC 2UKDA 4NP6A 2Z4RA 1TQDA 2JJ2A 1YR8A 1RIFA 4HZUA 1T0HB 1P9WA 3KKMA 1C4OA 1CJMA 4KFUA 3SE0A 2WWXA 3U3JA 1JR6A 1U94A 1YZUA 4ABYA 4M53A 4HDOB 3A4LA 3Q72A 2H18A 1Z0AA 2FGKA 2CCJA 5F9FA 4LPSA 1R7RA 2Q9BA 5DNYB 2FEMA 3AGQA 3EPLA 4B6DA 1V5WA 2UVQA 3GJ7A 4KU4A 2QI9C 2Z5FA 4UNPA 2QM7A 2C9CA 3U3RA 5LPNA 3B8HA 4K8OA 4Q21A 2CVHA 2JLVA 3FWYA 4HYYA 4LHVA 1KBEA 4AC9A 4E22A 2EYUA 3F8TA 2BM1A 5B64A 3B6EA 4JT2A 4C0SA 2WWGA 1AKYA 4IOKA 4JVLA 1QHIA 2WSMA 1OF1A 3CXLA 4RZ2A 1XEFA 4V0OA 1JR3E 3QXHA 3N2IA 3FMIA 1KNQA 4LY6A 5JRZA 1A2BA 3IQXA 4BLTA 2PZGA 2PH1A 4FCTA 3B9QA 3ND8A 3CH4B 4OJQA 1RRFA 3I8XA 2FDCA 1Q57A 1NJFA 2CEAA 3B1ZA 3LRPA 4TLBA 1OFHA 4AKHA 4IXNA 3SBEA 1BMFA 5FL7D 2W00A 2GJSA 2OM2A 1H8HA 3CKLA 1XTQA 3UGDA 2J59A 3D6TB 4GBMA 1Q3HA 2ZROA 4D4LA 1RRCA 4TZ6A 2REBA 1G3RA 4JT4A 1RZ3A 4B48A 1SKYB 2OG2A 4DCTA 1MO4A 3REFA 4DUGD 1KK2A 5BWMA 3PEYA 4E03A 3SS8A 4O2RA 4Q4HA 2R6FA 4EPYA 1OH7A 1IN4A 1KSJA 3U6BA 3KB1A 4B2PA 2NQ2C 2O8EB 4LOAA 2C9YA 1IJFA 1GTVA 2ZPTX 1XDBA 5G41A 4BASA 2QG6A 2F3RA 1HY3A 4A2PA 4V03A 3HWSA 2J46A 3B7GA 1Z29A 1WCV1 1SXJD 3DZ8A 3FKSD 1ESNA 1N0VC 4JLAA 2YINC 2CXXA 1FW6A 1G3UA 3PEUA 1OB5A 5UKDA 3B2EA 3K09C 2RHDA 1WQ1R 2PBRA 2DFTA 5JS8A 3MSXA 1QRAA 1S1CA 1E2KA 2ZYWX 4ESVA 3ICQB 4TTPA 1PUIA 1UBCA 1XX6A 3M1IA 2IYXA 3ASYA 5KDDA 2AHOA 2YYZA 4EQ6B 4AG6A 1E1QD 4DEYA 2IHBA 4OJKA 1DAIA 3QVUA 1RYHA 2ZANA 2XZPA 1E2MA 2D2FA 3RAPR 4BFSA 4QM6A 1RVDA 4Q5IA 2ZSAA 1GUAA 3V9PA 4MITA 5L3QB 4J0QA 4R2IA 1E4VA 4FI3C 4BPBA 4V0LA 1YE8A 4JVMA 4X8LA 2VPPA 1E0SA 1EFRA 3KKPA 3H0KA 5CYPA 1NRJB 1OSNA 2HUPA 3ZZUA 1G7SA 1FNMA 2REXB 3SNHA 4XVQA 3GJXC 221PA 5FFMA 3QBTA 1KYIA 4OHZA 2NPFA 3WYFA 4B44A 5HR5A 5HKKA 4DCNA 1G5PA 2JJ1D 1Z22A 4BECA 3MJHA 5GJCA 3CX6A 1ZM7A 4EAQA 1GFIA 2HJGA 3AF3A 4MRPA 4CEIB 1KI8A 4MUBA 3LV8A 1U8YA 1R4AA 4YONB 3AVXA 2P2LA 1O3YA 2QMEA 3DMDA 4DLYA 4A2QA 2DYKA 3CPJB 5CIWA 2ZS8A 2PT7A 1RE0A 1NN3A 4EFNA 3TW4A 2OCBA 3DOFA 2WJJA 3WP1B 1Z2AA 4Z54A 4R7ZA 2JLWA 2WJIA 2F43A 3FHTA 4TYPA 4D82A 3K0FB 1XEXA 2WJGA 4NU0A 1FQKA 1M8PA 3TSWA 1WBDA 3VHXA 2ASEA 2Q0HA 2ZITA 5B58C 3GLFB 1E32A 2YOGA 4YMWA 3CR7A 3QQ5A 3QXXA 4WIAA 4UNRA 4DKXA 2WIBA 3QPUA 4B71A 3TUJC 3KJHA 2G0NA 1MO3A 4QNMA 3LX8A 1CULC 4TYQA 4CIDA 4RD1A 4Q1BA 4NH0A 3SU8A 1D8TA 1FZQA 1PLLA 4URVR 2RGNA 3LXRA 1P61B 5CK4A 3AV0B 3EC1A 4KYUA 2NO9A 2D4HA 2BOVA 2GA8A 2ODWA 2YOHA 3AUXA 3ICEA 1W44A 2D62A 2YZ2A 1FMJA 3EZ9A 4LBZA 4NONA 4G5OA 1JBKA 3MWJA 2ZRMA 4QBHA 2KBEA 4DJTA 3SJCA 2FN4A 3CPHA 4JL6A 1P2TA 2DR3A 2WIAA 3Q5DA 4I4LA 3TBKA 4BEJA 2RGBA 4I1UA 3QSYA 4B3BA 1U0LA 2JCSA 4BUJA 1S9HA 3BFVA 4TN1A 5BXQC 2GVIA 4UJ3A 4B35A 3CF2A 4XSHA 4B73A 5IRCD 2BJWA 4ACBA 3EA0A 4ZCMA 4HAUA 4M1YA 4ON9A 4PPGA 2FV8A 1E99A 1H8ED 2ZI9A 1UDXA 3B1XA 4IEEA 4YLGA 1FOEB 4Q4AB 1PTRA 1QF9A 2QAGC 3W8NA 2P67A 2FFHA 4LJ7A 4LYFA 4Q47A 4NCKA 1F2UB 4A1FA 3C4JA 4YDHB 4FXPA 1CJKC 4BLRA 2XJ9A 5IK2D 4DEXA 1IY2A 2IYWA 1N6IA 2GAAA 3CF6R 2EFHB 4YXWA 4C7OA 2A78A 1G1MA 1NNEA 4RKEA 3AKCA 3KXIA 3NBZC 3MAAC 2OFXA 2MMGA 1GL6A 1E79A 1S96A 3KQKA 3OAAD 1GM5A 1DAKA 4MYHA 4B3CA 3THWB 3GLGA 1Q1ZA 2J3EA 4QL3A 2ZRBA 1U98A 2IYTA 2R6DA 4M1SA 4HAWA 4IDQA 5SZIA 2AR7A 2QGZA 1R6BX 1TF5A 2FA9A 3K53A 1R5NA 2QE7D 5LDDC 1DAMA 2ZJYA 4Q1FA 1Q12A 3A1SA 4RZXA 1G8GA 1HT2E 1LY1A 5K8IA 2CL6X 1SHZA 2CNWA 4LSGA 1AQUA 2HYIC 2RH5A 1ZAKA 1KOFA 2FSFA 4OHWA 3WNCA 2XAUA 3BJIC 2E9SA 4QGAA 3WMGA 3TNFA 2ENNA 4FMBB 4PO9A 2WV9A 3TR5A 3ZH9B 5IT5A 4OYHA 1NVUQ 2XJ4A 4JBYA 5KUTA 2QSYA 4BZPA 1FX0B 1US8B 1N0WA 1HE1C 2WKRA 5J4YA 2JLRA 2V6JA 4A0GA 3NBXX 2BMEA 3FFBA 4B75A 1X8LA 2F9MA 3KUCA 2G83A 1OXSC 3VR3A 1T3LA 4BE7B 4MYUA 3C8UA 2DB3A 4LC1A 3BRWD 4IXMA 3A58B 1RJ9B 1Z47A 3U7HB 1KKMA 3RS3A 3NG1A 5DH9A 1OKKD 2A2ZA 1A1VA 1RKBA 1GAJA 4EJSB 3CRVA 3K70B 1I4LD 4LBVA 2FNFX 1KK0A 2ZAMA 3JZAA 4NYMQ 2ZI4A 4C9BA 2QQ0A 4PHGA 3VU9B 5SZJA 2QNRA 2GCNA 2VP9A 1JQJC 1XRJA 3KJEA 1DAEA 4WZ6A 4F93B 1ODFA 1Q3TA 1E1RD 2ZE6A 4JLJA 1KDRA 1GDDA 2YWGA 4S2EA 2OXRA 2WWFA 4CEJB 1G18A 2OESA 5EP1A 2ZUBA 5JS7A 1TF2A 4OK3A 4ZKEA 3TSOA 3AP2A 3CNLA 4HLQB 1NIPA 4IW3B 2RCNA 3EC2A 4NYIR 1ZUIA 5KYKA 4IDHA 1T5LA 3IHLA 4LBYA 1YZLA 4Q18A 1COWA 2IUTA 2WWHA 3QUSA 3K0SA 3A37A 2O8BB 1AK2A 4DXAA 1E0AA 4LJ6A 4PHHA 3UPUA 3MMPA 5FTLA 1W4BA 1J70A 3W9YA 2DWQA 2IEZA 4FMCB 3M4YA 3IEUA 1Q1EA 3LFUA 4GZLA 3W3AA 1HTWA 1TQ2A 3AUYA 4OI2A 1FTNA 1XMJA 1ZINA 1N6KA 3ZJYA 2QORA 3UMRA 2HEIA 4G0NA 5JWHA 2B21A 1CEEA 3B9PA 1SVIA 5JRJA 3K0AA 3WMEA 1OXXK 3AH8A 2QQEA 1JAIA 5DSZA 5GVRA 2YHSA 3I32A 1OE0A 3L0OA 2GETA 1ZD1A 4KBFA 4PO1A 3RLFA 3AF0A 4P32A 2ZSEA 1MO6A 3LQRA 3VX3A 2EWVA 3HYRA 4P4SB 4JIMA 4P4TA 2P0EA 3CNOA 3RSLA 1T0JB 3AVYA 1J7KA 3GLHB 1FX0A 4EPTA 4F92B 3I5YA 3K0EA 4QM7A 1D6JA 2HT6A 5K8TA 2CCGA 3THXB 5AJXA 3NKVA 1KDTA 2F7SA 4NKRA 1P62B 4HB0A 4Q9JA 2YC2C 1VYUA 5J4LA 3CZPA 3L8YA 2FZLA 2ZVQX 4Q1EA 4HAXA 4X8HA 3B1YA 2GCOA 4NCNA 1LF0A 1T3SA 3SBDA 1NBMD 3Q7QA 5B57C 1KZ7B 2ZJOA 2QAGB 4TQAA 3OEHD 4CGZA 4PC1A 1GNPA 4XVUA 1LS6A 2BDTA 4FMCF 4DLTA 3ZQ6A 3SDZA 1SXJC 3KTAA 3BB3A 3AP1A 1IONA 1OYWA 4A4DA 1N6NA 4DLZA 4URUR 2ANCA 3TIFA 4OI1A 2WTUA 4HAVA 1S8FA 2CHGA 2XNDD 1VKJA 3QG1A 2QMUA 2CLSA 1NLYA 1OXUA 4B76A 4LGMA 2YKGA 2DWPA 1AGPA 1N6HA 3W34A 4MKGA 121PA 1KMHA 3R7WA 2CVFA 1JJVA 1P60A 3WHLA 2BCGY 3GJ8A 3LH5A 2KE5A 4AIIA 3GJ5A 4PO8A 1QVRA 4XD7A 3WBKA 4CW7A 1S3GA 1CJUC 2WMOB 1SVLA 4XWKA 1WP9A 5EZ6B 2QUZA 5KTYA 1CRPA 1HYQA 5JFGA 4JLMA 1PLKA 1G7RA 4TL9A 3FDIA 5GJVC 1T8UA 2WM9B 4MQBA 5DYIA 1W0KD 3TQFA 4JSTA 5E7IA 1Q1QA 1KY3A 5EXXA 1CRQA 3LVQE 4AYWA 4N3NA 3ZVRA 3GLIA 3CRRA 2WOOA 1E2FA 1Q22A 3FPAA 2BBWA 5C1BA 3LVRE 4HAZA 3QXSA 1GKUB 2JLSA 3THOA 3CRMA 3BGWA 2I3BA 3QKRB 3THYA 1TTTA 2DFKB 1YZTA 2W6ID 4Z8YA 1ZM2A 1E0JA 2Q6TA 1KSFX 3ZDQA 3NWJA 1A7JA 3LAWA 3SQWA 4Q66C 1GSIA 2ZS9A 1DADA 4BZXA 1CTQA 4HLCA 2ZE5A 1E2NA 3ZZTA 4C0LA 4RZUA 1L7VC 1U0HC 2O8DA 5JEEA 5HZKA 4TYWA 2X19A 3P32A 4IJMA 3SN6A 3C14C 1NBME 4C0KA 2R6AA 1GG2A 2DBYA 4ASUA 4CYMA 1OIXA 2G88A 2VRWB 2NG1A 2O0KA 3FTQA 1GKIA 1N2CE 1UKEA 1WE2A 4TLEA 3U44A 2IXEA 4YMUA 5L3SA 1M1YE 4BRWA 5SZKB 3PUZA 1E2QA 4NYJQ 3KQNA 1XD2A 3HPRA 1XPOA 1AN0A 1TQ4A 1MABA 4Q9KA 3GFOA 4HLUA 4W5JA 4CZ2A 4OHYA 1S1MA 4GT1A 3RS4A 4JVNA 4WBSA 1M2OB 1W4CA 1NLZA 1NMZA 3SQXA 4G5SA 2PZEA 4TMKA 5C4MA 2GJ8A 2VHUA 3LBNA 4JBWA 1Z08A 3MG9A 3M0EA 5FOUA 1T6NA 4UXHA 2JASA 4A6PA 4PZLA 3BIFA 2GJ9A 5EE5B 2JLXA 3OIYA 4Z1MD 4HZUB 4UNNA 4KCGA 1KNXA 4Q01A 721PA 2ELIA 1P4SA 1Z5ZA 2B6HA 2JIZD 2KBFA 1IY0A 1W46A 1G17A 3EZ7A 5AJVB 4GZMA 1TU3A 5G3YA 2IBMA 3GP8A 1PTQA 3EZ6A 1ELOA 1T9HA 3QJYA 1G5RA 2RGCA 5J4HA 3O8CA 2FOLA 2ZE8A 2FF7A 2XZLA 4QG7A 3H1TA 1G19A 1KDOA 4IHQA 4PXAA 3KJGA 4PPNA 5HE8A 3X1WA 1CKEA 4F4IA 3I5XA 3A6PC 2XTZA 2NIPA 1WDTA 1UJ2A 1NVXQ 4Q9LA 2FFBA 4JJZA 2R2AA 1HQCA 3VHLB 1ZNXA 1KI1A 1E2HA 3CO5A 4A9AA 2AFHE 2XZOA 4O3MA 4XTCS 3K9GA 2YJTD 1XF9A 4A2WA 2VH5R 5JLJA 2ZI3A 2GXUA 2V55B 3RYTC 2ZRJA 3FHCB 4QRHA 4DLVA 3HDTA 2BBOA 4DLRA 4TSFD 4W9MC 2A9KA 1ZNWA 1UBEA 1XFAA 1ZP6A 4PZZA 1OH5A 4JLKA 5FPSA 3A36A 4LJ9A 1Q21A 3HU2A 4MRVA 4HI0E 1AZTA 3A1TA 2KJQA 1S9DA 1E98A 1JR3A 3QPWA 3OIUA 1Y63A 2ODNA 3FMPB 1HQYE 4LRWA 3B1WA 3RWOA 1J99A 5EUMA 5K8LA 2ENZA 1VCOA 3NIBA 1NY6A 2CMKA 2GEVA 5AR1A 5FPHA 3RSOA 5GJWC 1MO5A 4Q4HB 3U7FB 4L5BA 2GXQA 1CXZA 5CK5A 1G16A 3QF4A 1AZSC 1MRNA 4EPWA 4D81A 2PZFA 1A5TA 2ZRPA 1V43A 4RZ3A 3DKVA 2IXFA 4Q1CA 4PQYA 2OILA 4ZI2A 3V00A 2TMKA 4URXR 3BXZA 3O8DA 4FINA 2XSZD 4MKFA 3U6KA 1VG0B 421PA 5JHGB 1NN5A 4TT3D 1E4YA 2FU5C 3Q8XB 1VG1A 3JVUA 3I4LA 3GMTA 1RYFA 4B32A 1GRQA 3R9IA 2W6JD 3C5CA 4US2R 2JATA 3QXJA 3OFND 4WA7A 4DVGA 1M7HA 3CBQA 4B6EA 4DDWA 2JLYA 2IK8A 2OHFA 3OIWA 4AK9A 5TMPA 1CJTC 3A1UA 4XOIA 4P4UA 1LS1A 1VIAA 2QP4A 3TGPA 1GL7A 3A1WA 2WZQA 1EX7A 2UZIR 2BBTA 3QIAA 4U5XA 2JLQA 2XTMA 4P0TA 2E1RA 2HYDA 4AI6A 2ATVA 3VMFA 2V6IA 4JLOA 3JZMA 4PFSA 4ZPXA 2ORWA 1S3SA 1UKVY 3L82B 3LW8A 4QXAA 4WXRA 4XWAA 4K46A 5AJZA 1EGAA 4N0EA 4RY2A 1ZC3A 2W2XA 4KLNA 2Q9AA 3L2OB 4OQNA 4IKEA 2JDIA 2QTFA 4PHTA 4DZZA 4AYXA 1A2KC 2XXAB 4L4UA 1N25A 4IVQA 4V02A 1CR0A 4A82A 4FCWA 1SVOA 2J41A 2FNAA 3UXMA 2ZRAA 4F91B 1EXMA 1E0KA 4LC0A 1G41A 2R65A 4Q03A 1F3OA 2IL1A 4EPVA 4JKYA 1ZNZA 2VF7A 3ZD6A 1Q44A 2OEPA 1YZKA 1W4AA 2VF8A 1BMFD 1QZXA 1ZM3A 2RGGA 3AF1A 4JL8A 3ADDA 4E07A 2F43B 5KDLA 2DFLA 3AVPA 3SEAA 1XEXB 2K5UA 5F9HA 1HA3A 2DY1A 3I72A 2GEDA 3TE6A 1SVSA 3UG6A 3DDCA 2IYRA 2ZRLA 1FUUA 3WHKA 3BWDD 3LD9A 1E2GA 5KSOA 1D9ZA 3AVOA 1CP2A 1HT1E 2CJWB 2A5GA 2HXSA 2ONJA 2YWHA 1OFIA 5EZ5A 5B30A 1U9IC 1KZGB 4E5UA 3DPUA 1II9A 5EE0A 2J9RA 3FHOA 2W2VA 3QKSB 4Z8XA 4ZDWA 1XCGB 3T61A 2CL0X 2V8OA 2Z0MA 5HE9A 5CIQA 3RDPA 3UATA 2IYLD 1NJGA 3UMSA 5ANRB 2A5JA 1E2JA 5EUQB 3WYGA 2ZU6A 4UJ5A 5JBQA 4D0GA 4KODA 4IOLA 3AF4A 4BGDA 1R5OA 2GZDA 4TLDA 4B3DA 1OH6A 1OIVA 1UPTA 2ZQ5A 3AP3A 4KITB 4PQFA 1G3QA 1XB2A 5F98A 1Z3IX 4YC7A 3IO3A 2WVJA 1AKEA 4PR0A 1IY1A 1G7TA 2G3YA 1E1QA 2EFGA 3CX8A 1DAFA 4JLDA 2RGDA 5CLQA 4EJSC 3K70C 3A4NA 5FTKA 3SFVA 1BO6A 2VLIA 4IFBA 1KAOA 2X2FA 5C2JB 2ODEA 1WA5A 4RD3A 5FUVA 2B7CA 1W2HA 1UAAA 2AFIE 3QENA 1X8JA 1CR1A 2WICA 3UANA 1N0UA 4NHOA 2AN9A 4G5GA 4QHYA 3SFZA 2WJVA 2HV8A 2AD1A 1EFRD 3I73A 5LD2B 1EWQA 2XXAA 2AK3A 4C7OB 4WVFA 1OXVA 1AS3A 1TF7A 3C5HA 4V0ME 3EG5A 4TZ0A 4NE2A 2J0QA 3WY9A 5FBRB 4A15A 1E2DA 4PAOA 3BD9A 5HKKD 1M7BA 1NY5A 1P73A 1XNJA 2WHXA 1QHYA 1WB9A 3AF2A 3E70C 4ZO4A 2OLKA 4BFUA 1EX6A 3GLGB 1BKDR 1XXHB 2EW1A 3K1JA 2YV5A 3L0IB 4M1KA 2NO6A 4IDPA 1ZCBA 3LNCA 3KQUA 5D3MB 1JB1A 5CDFA 4RD6A 1LTQA 3OESA 2PJRA 1GITA 3R20A 1FAQA 2ZJ5A 2J45A 2BWJA 1SXJE 1ZBDA 2YNMA 1IBRA 1FQJA 1R0ZA 3K9LA 5EP4A 3PEWA 3TQCA 1EESA 2V54A 3PITA 3T1VA 3QNUA 1LVGA 1G3IA 1ZIPA 3BH7A 2QP3A 4QJ5A 3WMFA 2VL7A 4TWZA 1JEDA 3G0HA 4DB4A 1U2RA 2PX0A 2ATXA 2CJWA 1XMSA 3EAQA 4TMVA 4QOSA 3PJRA 3QY0A 2FWRA 3C41J 1E69A 1C1YA 1T3HA 5KSPA 5KSZA 4KVAA 4MRNA 3QKSA 5FOWA 4YQFA 3W5JA 3SHWA 3T5DA 2PCLA 4XJXA 3PXGA 2ZI5A 2NPIA 4PANA 2GVZC 4MGKR 3ZVMA 1XEWX 2BHRA 3EIHA 1ETUA 1DAGA 2PLFA 4Q4LA 4AD8A 5FUXA 1GP2A 1KI4A 1QG4A 3KQLA 4D0NA 2C9OA 5J5CA 2O8FA 2IS2A 1WXQA 3CUEF 3D31A 4JS0A 4JYBA 5HPYB 3B82A 1G4AE 1ZIOA 4FCVA 2AKAB 3FGNA 3KXKA 5TVKA 3CNNA 3D8BA 1NN0A 4G5QA 2NGRA 1XTSA 1YKSA 3ZGXA 2V1UA 5E7MA 2R62A 4US0R 2W0SA 1JQLB 2VTKA 1KTVA 3UEJA 1CR2A 1NI3A 3ASZA 2QZ4A 4F4JA 2WWYA 3C16C 1XMVA 3G5UA 3BFXA 1NP6A 1F5NA 1NN1A 1H8EA 3WNBA 1NVVR 2X8AA 1TEVA 3GEIA 3TJZA 1VYVA 3ADCA 3BC1A 3L0SA 2N42A 4QFMA 1KBFA 3ZIAD 2BJVA 3H2YA 4CRWB 2PLRA 5IK2A 2ANBA 1NSFA 2MMCA 2GVDC 1M34E 2XTNA 4DHEA 2OFWA 5DYGA 2J87A 1AM4D 2FH5B 2AD5A 3TR0A 1XXHA 3MFYA 4MGIR 3P4XA 4XTRA 1SKYE 5D3MA 1AQYA 3IPXA 3P4YA 4LZZA 2CLDX 3ZVNA 2ZRGA 1KHTA 3P26A 3LWNA 3LX5A 4G1UC 1QHNA 1XMIA 2HCBA 3K0AB 3LLUA 4ZI3A 3UFFA 3EASA 3LBIA 3U5ZB 4GI7A 4AG5A 3FOZA 1I4DD 5EE9A 3GQBA 1HUQA 3RRNA 2GBLA 2KB0A 4U7DA 4W5WA 4QBGB 2CNWD 4H1UA 1ZJ6A 2JLZA 4TTRA 5DI9A 3SJBA 4DCUA 5G40A 1WF3A 1PJRA 2WSSA 5HCNA 1OB2A 5FBWB 1OW3B 2LKDA 3ZVLA 3KDSE 3QI2A 1YZGA 2OCYC 2R8RA 5DO9A 1S4QA 2QPTA 4HATA 1IOZA 3ZYCA 2IYZA 5AJWA 4FD2A 1Z83A 3QOFA 5CB8A 3T34A 3N5CA 2QMOA 1BH2A 1SGWA 3BB1A 3RANA 3NC0C 2ZE7A 2WAYA 4LV6A 2ZRNA 4LPKA 4KO8A 1IN7A 2N1BA 1KO7A 5FPYA 2GCOB 3BB4A 5P21A 4V0NA 5FOXA 2J0UA 2PEZA 1YRAA 2RGAA 1KSHA 3PUXA 3HU3A 4BWYA 5FOTA 2W58A 3KTAB 1KK3A 3OIVA 3W5IA 2BBSA 2XNSA 1ZCAA 4Q02A 1DG3A 1BS1A 4IFEA 2EVWX 4RCYA 1E1RA 2ZYUX 5A4JA 4LWZA 4JZKA 3AVWA 4C3ZA 1G20E 4Q7MB 2WPDD 3OEEA 1IAQA 2VBCA 2Q3HA 1YVDA 1Y8FA 3L8ZA 1Z6TA 3MD0A 4A92A 2C95A 2O52A 1KMHB 1XTIA 3R7WB 2C77A 1A82A 2H16A 1OHHD 1G9XA 2ZIAA 1Z0JA 3FMFA 5AK0A 2D7CA 4GOJA 1G291 4ZDKA 2O8CA 2ZS7A 4ZIRA 3ND9A 4MKHA 2ZRIA 3IDQA 3A1VA 4QNRA 1N6PA 1AGRA 1GRNA 4DDVA 3CH5A 2QA5A 1WBBA 1G21E 4LHXA 2OXCA 4F38A 1HV8A 2XOKA 3H4MA 1JXOA 1DG1G 1TEXA 2H57A 1XTJA 5JWRA 1FARA 1SULA 4A8JB 4BLSA 5LB2A 1IXSB 4NPHA 5JWOA 2CLCX 3Q9LA 2C04A 3GLIB 3RC8A 3AVQA 2WAXA 3GLFE 1P9NA 1GIAA 4TLAA 1JAHA 3ZS8A 1KDPA 2V9PA 4CVNA 4W7SA 1TMKA 1QVAA 3FB4A 3I92A 4MRSA 3WP0A 3KY9A 1P7CA 3THYB 3CRQA 4BFZA 2CHQA 2D2EA 2V3CC 2ZR0A 3U7EB 2GNOA 2ZRKA 4LBWA 3HYTA 3AEZA 1Z8FA 2BC9A 4BFXA 2XB2A 4LYJA 2ZAOA 1JPNA 4Q9IA 2IXGA 4LJ5A 3WRYC 4O2LA 5FBVB 3VR4A 5CB6A 1EFTA 1OV4A 3B78A 1K6MA 3C15C 3KZ1E 3B5JA 4G5RA 4OQLA 2O8DB 4DSOA 3O8RA 3K09A 3W6NA 1XCPA 4M9XA 4DIDA 3AM1A 4JLPA 2HCJB 4DT1A 3RRYA 5DHAA 4BFVA 1FNNA 2IEYA 4TL6A 1DEKA 2ODBA 5EXTA 3U44B 5L3SB 3EPKA 4JMPA 4OK6A 3VAAA 4UKDA 1N3BA 1XD2B 4HEJA 2FPLA 1Z28A 4BLPA 2F6RA 4GPTA 3T06B 1MABB 3N70A 4LJYA 3K70D 5B2ZA 1NBMA 3KL4A 2ZSFA 1DS6A 4OHVA 3OEHA 5KHOC 5FL3A 5KSYA 2ZRFA 3CPEA 1BYIA 3OE7D 3UGLA 1EG7A 4DC9A 4FW9A 4B2LA 1K5DA 1XPUA 3F0TA 2G1JA 5M04A 2C8VA 5KNDA 3GEEA 1PVOA 3VQTA 2Q3MA 5JI3E 1AIPA 3FMOB 2FSGA 2A5DA 4Q1DA 1W5SA 5FI0B 1HURA 1R8SA 1XP8A 1YR7A 1VDZA 3GJ3A 2HLDD 2IYVA 3HP1A 3I3SR 3OHMA 2JLUA 4C2UA 1M74A 1NKSA 3T1QA 1DBSA 2GF9A 3SHFA 3L0PA 1KGDA 1J8YF 2ECKA 2R6GA 4D26A 4URWR 3RS0A 3KXLA 2O0HA 3T15A 1RC8A 3W3ZB 4KI0A 1RPZA 4MYTA 1DO2A 1F6BA 5DGXA 1AA9A 3MWLA 4JLBA 2I1VB 3TVTA 1R0WA 3ZD7A 1ANKA 4ARZA 1NIJA 1W2GA 3KKQA 2RKOA 5SZHB 1DOAA 3IO5A 4JBXA 3AKDA 4NTZA 2Z43A 4XH9B 4A8JA 4EPRA 2IX3A 5CJPA 4DCVA 1XA6A 1U99A 2W0MA 1D9XA 521PA 4L9WA 3U3MA 2ZJBA 1IHUA 3ADKA 4LJ8A 2QP9X 3V4FA 4EFMA 2BMDA 2ERXA 1DARA 3MWYW 2GZHA 2OFOA 3B85A 2QENA 5FI1B 2AXPA 2P3SA 5E4FA 2QTHA 5F2EA 1HEIA 1SHKA 1R79A 1TBNA 2OZEA 5ELXA 5HCIA 2OAQ1 2ZSDA 3DKPA 1IQPA 5J4VA 4CDGA 2IYQA 3NC1C 4DSTA 1Z63A 3VKHA 2O5VA 1UF9A 1E9SA 1KI6A 4LI0A 1ZW6A 3PENA 1Q0UA 5AUNB 1E94E 1NLFA 3AGPA 5AJYA 3UWOA 2KI5A 3X2SA 1MT0A 2CE2X 3QF4B 4X8MA 4IEIA 4EUNA 2FFQA 2IYUA 1OH8A 4ASUD 3QEJA 4EIWA 4IVRA 4WAUA 2H17A 1G8HA 1U8ZA 2BM0A 3MRSA 2FZ4A 5BN3A 1Q20A 3GPLA 2R9VA 1TL7C 3CW2A 2GJKA 3EIEA 4B3FX 2H7VA 4M1TA 4YMTA 1QHHB 4G01B 2OCAA 3HR7A 1EFHA 1F2TA 2XEXA 1U90A 1EWRA 2VHCA 1FTSA 2L0XA 3AVTA 4HUTA 3SYNA 1GNRA 2QRNA 5AUPB 1II8A 4ZDJA 4AURA 2I1QA 2RGNC 4B33A 1DELA 1LNZA 2UZ3A 2DPXA 1Z0IA 5JHHB 1S0UA 2OBMA 5H70A 4Z1MA 4B6FA 3RS7A 2GRJA 4TL8A 5C4GB 2IWRA 3VR2A 2JIZA 1FL9A 1OLOA 2GWHA 3GD7A 3QKTA 5FOSA 3BBPA 5EP3A 3TSZA 3WYAA 1X3SA 3X1ZA 4P33A 3NHBA 1QHSA 4E09A 4AWXA 5DE3A 4R2HA 3E2IA 1XEWY 4A0RA 2HDNB 2IC5A 1LW7A 3BFKA 3CLVA 5DIFA 5FH9A 1EFUA 3MCAA 2B8WA 3TUZC 1ZM4A 1E9CA 2CK3A 3EIQA 4JJKA 4RFVA 3G82C 1KI9A 3TW8B 3WRXC 4GL2A 3UIEA 1Z0FA 2EQBA 2Q9CA 4JLVA 4A0FA 2IS6A 4NYIQ 4ACAA 1DVRA 4BFWA 4DIEA 2OSBA 3VKWA 4NL4H 4ESHA 3GLHE 4JVSB 1UKYA 5KDOA 2HXYA 4D4KA 3TAUA 1G8YA 1UKZA 3QF7A 5C46F 2G77B 3BJIA 1E9RA 1E9BA 1SVWA 5LD2C 3D3QA 2WWWA 4LYAA 3CIOA 3EPHA 1XU4A 2GDJA 3F5FA 4M4SA 1E2EA 5CYOA 1KO8A 3IBGA 5DLQC 1BYUA 4NBSA 1W0JA 1R0XA 4OK5A 2DHRA 1QG2A 2YUUA 1L8QA 5G3ZA 4HLDA 1KK1A 4URZR 2CHVA 1JR3D 1AS2A 4XSGA 2QMHA 1KO4A 3PR1A 1YU9A 3IILA 4MGZR 2BIFA 4D4JA 3NDBB 4PTLA 4CF7A 3IEVA 2VSOA 2ZM5A 2J7PA 4DCSA 3AQ4A 3UEYA 1NSTA 3DM9B 3FVQA 4ERNA 2I4IA 1G7CA 2WKQA 4RD2A 2VEDA 3W90A 3DZDA 2V7QA 4M0LA 4B3XA 2AWNA 1QHHA 3RS2A 5JJIA 3FYHA 4WOPA 2GCPA 1XJ0A 2PT5A 2YWEA 2G1KA 4MRRA 5C18A 4PPFA 1LB1B 1H65A 4RCZA 5DN6A 2XSZA 3DVLA 3W6OA 4LHWA 4CEHA 4TT3A 2H5EA 3KQHA 3R8FA 1JJ7A 2JAQA 3BH6A 1ZC4A 4C30A 1IN6A 3ETLA 3AVUA 2AXNA 4KJZA 2JJ2D 2QM8A 5KNCA 3MLEA 1Z6YA 2G0TA 4RFSA 1G3MA 3S1AB 3PFIA 4I1VA 2YOFA 3T12A 3TLXA 3PV0A 5JZVA 2O0JA 3NEJA 4M1OA 4D4MA 2F1HA 1KI2A 4Q4JA 2P6UA 4C4PA 5GJBA 2C5LA 1CLUA 2AK2A 4RD4A 8OHMA 3PCRB 1JALA 3K0CA 3VTKA 5KNBA 2VP5A 4TQ9A 2X2EA 5DI3A 1AJEA 2OE2A 1WRBA 3RC3A 1XBTA 2KWIA 4OL0A 4KFTA 4QKQA 1F48A 5J40A 5EXSA 1ZD9A 2HJVA 1N6OA 2E87A 1E9AA 1T8TA 3CB4A 3EARA 4I81A 1EFCA 5J47A 1CR4A 4NCJA 1RFHA 2R44A 2XB4A 1C9KA 3B13B 1W4RA 3H84A 5H1YA 4ZV4A 2JEOA 5FTNA 4FWTA 4I1OA 1ZYUA 1E9DA 2JDID 5HTKA 3ECCA 2F3TA 3O47A 2GK7A 1RRGA 5LB4A 3AB3A 3I62A 2OBLA 4PAMA 1IN5A 4NDZA 3B60A 4LV8B 5FL7A 2CE7A 4RVCA 1U0JA 3FE2A 4HZIA 4TMWA 4WW0A 2PX3A 1IXZA 2CCKA 1Z0KA 1H8HD 4I1SA 4DBLC 1DTSA 1NF3A 4V0MA 5JEDA 3UWKA 1CBUA 4O25A 4DUGA 5TARA 3WNDA 3MWKA 4ILEA 3VKGA 1ZRHA 3N2EA 2QT1A 4GFDA 3WXMA 2QBYA 4M9SA 4L15A 3SYKA 1YR9A 3T1OA 2Y8EA 2NZJA 2VHQA 3U7GA 4IDOA 4KBGA 3RWMB 4OHXA 5TB5A 4Q7KA 1JECA 3TAHA 1PV4A 2ROWA 3NH6A 1SZPA 3KUDA 3SC3A 3U2QA 1UFQA 1SXJA 1UM8A 3LDAA 2CL7X 3FKSA 2QROA 2ZI7A 2J7KA 4HUQA 4NYMR 4B47A 4Q00A 4IOMA 4KFSA 1YR6A 3LO5A 3ONWA 4F7WA 4WXPA 3EZ2A 3CZQA 1UEJA 2GEUA 2VO1A 3U4QA 5K8UA 4GNKA 5TV2A 2DWOA 5E7JA 3IPYA 2DCUA 2IT1A 4M21A 2ZETA 1P72A 3PG5A 3T35A 4AKGA 1HH4A 2J5XA 2W2TA 1ZMXA 3A8TA 4Q7LA 4EDHA 2ZRDA 3SOPA 3S1AA 2HF9A 4CT5A 2O8FB 1D5CA 1GVNB 4BLQA 1ZU4A 4U02A 2LCFA 3CF0A 5GADl 1WMSA 2V4ZA 1R5BA 2C78A 1GL9B 2IS4A 2ZREA 5AUQA 1ZNYA 2QEQA 4D2IA 5AUOB 4ZCIA 1XWIA 5E95A 4D0LB 4GP7A 3EZFA 1I4TD 3AKYA 3CONA 2WOJA 1O87A 2FPMA 4BEBA 4TMXA 4PAQA 3VR5A 3DO6A 1R2QA 1QHGA 4YMSA 1KIMA 1JI0A 2IYSA 2MSCB 2WMNB 3VR1A 2JJ1A 1II0A 4PHFA 4AKEA 5KPJA 3L43A 3NDPA 5BYJA 2AL7A 4OI4A 4C0BA 3H86A 4LK2A 2ZJ2A 1L2TA 1X1SA 2REOA 2WJYA 3W8RA 4KVGA 1VHLA 3IGFA 4MH0R 2YVUA 1TADA 4RJLA 5EE1A 1YRBA 1XTRA 4IDNA 4PZYA 2DFNA 4N0DA 1TUIA 1U81A 3DL0A 3T1TA 1OXTA 3BK7A 1JPJA 1TAGA 5CITA 4TYYA 4Q1AA 4XWOA 1XPRA 2F55A 1KJWA 4PSVA 1KI7A 2JJ8A 3TKLA 4S35A 2Q21A 1GZSA 1U8AA 4M8NE 5AWFC 2F1RA 4PC7A 2D7DA 3VNVA 2QRZA 1T91A 2GTPA 2OAP1 5IHPA 4M1MA 3P27A 4GRAA 4JYCA 4A8JC 1L4UA 3U61B 3RNLA 3SR0A 2GILA 3IKJA 2RMKA 4TYNA 2ORIA 3CWZA 2BMFA 3EWAA 3ZZ0A 3BERA 4TMZA 5KOYA 4OQMA 5FBLB 4WZAE 1A4RA 1P2VA 3NTUA 3C7KA 3PUYA 2PMDA 1I2MA 2QSZA 2VA8A 4TL7A 1W36B 2O8EA 5BN5A 4LDJA 5TY0A 3RHFA 2XGJA 5BW8A 1KJYA 3I61A 5BYKA 1X86B 1YZNA 4ZKDA 1D2EA 2H92A 2WJHA 3UKDA 4FKDA 5BQ5A 1CS4C 2NO0A 4KV9A 2NTYC 3X1DA 4QGHA 2IS1A 3PQCA 1KAGA 2BKUA 2HF8A 4Q9HA 2VP2A 2H8KA 3FFAA 2EFEB 4P3YA 1G8PA 2Z4SA 4V0KA 5EJEA 2CBZA 1NL3A 2J0UB 3KJIA 2VIIA 3B1VA 2BMJA 4GOXA 4PPQA 2A30A 4EQ6A 3U60B 4D6PA 2VYFA 4HDCA 1FMLA 2GZAA 1GRRA 1QBKC 1TUEA 4MKIA 4QGGA 3QPVA 4HLUC 2Z83A 5CJ2A 2YC4C 3QG5A 3QE0A 2JGNA 4QC2A 1YJ5A 4TQUS 1I2DA 1YHNA 3GJ6A 4X8OA 5EP2A 5L3QA 1NG9A 3UG7A 1MR3F 1OIWA 4BQSA 2P5SA 1NMXA 4LYHA 3M6AA 3VFDA 1E2LA 2A5FA 2O8CB 3U3KA 4ZIRB 1G4UR 4C0JA 4YXWD 2C96A 1DAHA 3F3YA 1UBGA 3ZIAA 2ZYVX 5FPKA 4BRUA 1LFDB 1GKYA 4ZCLA 4YDSA 1XJQA 3OAAA 4MDEA 1E79D 3R8CA 2QAJA 3CX7A 4H1VA 4KYIB 5CDFE 2P6RA 2FX3A 2ZR9A 1NVWQ 1ZD8A 3EA5A 4GP6A 4R98A 4AYTA 2BEKA 4CEIA 1KI3A 2ZR7A 3NBFA 1TNDA 6Q21A 2QE7A 5TXGA 1N5JA 2RGEA 2VHJA 1XD8A 4RD0A 4R71A 2VP0A 2ZUDA 4G3XA 4DLSA 2IW3A 1UDWA 3X1XA 2IA5A 1E6CA 4LV5B 4OI0A 1TU4A 1FUKA 4QBIA 4BLOA 1LF5A 5A5GA 4DSNA 2ZJZA 1KJZA 3K9NA 4M9ZA 3WBJA 4JLNA 1P75A 3OF5A 2RGXA 1MOZA 4PX9A 5JJLA 3LXXA 2G6BA 1E96A 1MH1A 1MRSA 3KKOA 4WZBE 4L8GA 3K0FA 5J4KA 3IIKA 4NYJR 1NMYA 4D25A 1N5KA 3DMNA 1Z0DA 3GLFA 3OZXA 3R9WA 1VHTA 4PC2A 4BFYA 5FTJA 1B0UA 2F9LA 2WSSD 3TRFA 1FFHA 3U3OA 3FKQA 4GSYA 3PUWA 2FPKA 4DT1B 1G64A 4DDUA 2ONKA 1SKQA 1W36D 4FIDA 2RHMA 2X1VA 1TBOA 3GJ4A 4KLZA 2FG5A 1E2IA 4KSCA 5DISB 3AKEA 3BH0A 1VG9B 5EQTA 4UQOA 1OKKA 4HB4A 1Z6XA 3TH5A 5JECA 4KXFB 4OQFA 3A4MA 3KFXA 3LBHA 2QPOA 3MGCA 2A7QA 1N5LA 2ZI6A 4M9QA 3BOSA 4NMMA 2IUUA 2NO1A 3PUVA 3UK6A 1DO0A 4QHSA 5JCPA 1VCNA 2W83A 1P6XA 4DLXA 2C2HA 2EWWA 2IYYA 2ZJAA 2D3WA 3SJAA 2ZU0C 1CJVC 1LV7A 3DEFA 4MYCA 4TMTA 1TPZA 3HPQA 4L16A 3PEVA 4LJAA 5FOVA 3T5GA 2GAOA 1W47A 4U00A 4HB3A 1B23P 2P6NA 5GVSA 2N46A 4JSYA 1D2NA 4YMVA 2R6CA 4RKFA 4PSKA 2VHTA 4RSGA 5L3RA 4C0HA 2ZTSA 3PVSA 2WPDA 3SZRA 1GWNA 2FEOA 2XX3A 2GF0A 2LWIA 1RW4A 5IDVA 2OLJA 4Q4AA 3OEED 4US1R 1Z06A 2B7BA 4HSEA 3GLGE 1M6NA 4W5HA 1F2UA 1XXHE 1COWD 1OHHA 1KMQA 1RRPA 3HJNA 4PC6A 3CWQA 3IBYA 1OPXA 4Z51A 2OBNA 3QXCA 4PC3A 4MA4A 1UEIA 5E3HA 3EPJA 2FSIA 4DB2A 4EFLA 5FR1A 1G5TA 2ERYA 1AS0A 4ARZB 1T5IA 1KY2A 2IF0A 1K5GA 1KO5A 2D74A 2IUSA 4B3GA 2ZSBA 1SVMA 4Q19A 3NBYC 2PMKA 5H68A 4FN5A 1R0YA 3PIRA 3THWA 4I99A 1R10A 2EFDB 1VMAA 1J90A 2AKYA 2XOKD 3K0CC 4M2LA 3ZS9A 3RRMA 2Z6VA 1XCMA 2A5YB 621PA 4AKIA 1YQTA 4LHYA 1OT3A 4NCHA 4Q48A 5JCZA 2QL6A 2PL3A 1N5IA 2VSXA 2ZJ8A 2GKSA 1X8KA 1XD9A 3I1FA 3D7MA 2G9NA 1U9IA 1JNYA 4LHZA 2ZRCA 2AWOA 1VPLA 5CM9C 4HAYA 4K81B 2QT0A 3TUIC 1KI6B 2X77A 4IRUB 4O0MA 1OFTA 3ADBA 3Q5EA 4II7A 1JEEA 2NZ8A 4UNQA 2RAPA 3EW9A 2FMXA 3IHWA 4HB2A 2OO7A 1US8A 4GDFA 3R9XA 2ZRHA 1BOFA 1ONBA 1QHXA 4M1WA 4GOKA 4R9UC 1ZUHA 2ZEJA 3RABA 2ZXUA 2F1IA 1JXMA 2VQSA 4BZQA 4MUAA 2OT3B 4JKIA 1RJ9A 3AVVA 1IM2A 1CIPA 4EJSA 3LA6A 4GMDA 4LUCA 1VCMA 1F2TB 3VR6A 2IHYA 3IIJA 5FUWA 3LQQA 3VU9A 3OE7A 1MKYA 3MJRA 2XNDA 3K8YA 3REGA 1RFLA 1II8B 2GJAA 3CM0A 4N1AA 2C98A 2GHIA 4A0HA 4OQXA 5HZHA 1PLJA 2KSQA 5G53C 4CEJA 1ZM9A 5CM8B 3KFVA 2BV3A
chains in the Genus database with same CATH superfamily
5JJKA 4DBLE 1VB5A 4UE6A 4YPFA 5ILOA 3ROXA 2C99A 1IEVA 1K8RA 1X7ZB 1JG4A 1NR1A 2PKRA 4G81A 1DV1A 5D86A 1BQ3A 4DLWA 3RVBA 4XD7D 3MFQA 1MW9X 2C0PA 2CUKA 4JV5B 3NAZA 5CYGA 1U6JA 5B3JC 3I1JA 3M5PA 3SZLA 1RYZA 4QJ3A 5C7IO 4Z49A 1TJYA 4PYRA 4HUJA 5HZGA 3T5PA 3ZWCA 4QDTA 5D5PA 1CUUA 1NKTA 3MINB 2FSHA 1GQSA 3DE1X 4WEQA 2PG3A 2G36A 4WX2B 4HDAA 5DGHA 4CMKA 4JQYA 2ZUCA 4GQIA 3DW1X 4LCBA 1O9GA 4Y2JA 2ODDA 1BVRA 1NPDA 1OTXA 2P8JA 4QQRA 1MVNA 4D1YA 3MTDA 1K6IA 4DC1A 4MYRA 1EQ2A 1XTVA 2MSDB 1F60A 2ODPA 1D2HA 2IH4A 2VP6A 1VYTA 1OFUX 3FYUC 2UU9B 4MGEA 2AUTA 4QU0A 4TTQA 1LI5A 2YWRA 2ZSHA 4ALJA 821PA 3OU2A 3PD0A 2XKBA 1E7MA 4C0QC 4DSUA 2JW5A 3GZNB 1OZHA 4KWCA 4TTVA 5GV8A 2W43A 3OZFA 5BV2P 3GLUA 3JD0A 4F9EA 1WD5A 1C7JA 4ENUA 3QA3E 1CEYA 1BWQA 4ZA2A 1ZUNB 4MQFA 3MUFA 4S1OA 5JAQA 3ZK8A 2G4CA 3I8SA 2DJIA 4B34A 2ZB4A 3EX7C 5FPTA 1TYDE 4FB4A 1CT0I 3GLHA 1BQ4A 4Y1GA 1U31A 1J2YA 4ZDIA 1DRWA 3VX4A 2ZWVA 3RRZA 2ZJ3A 3JVVA 3OU7A 2XPCA 1JPUA 1Y8RA 3DM5A 3X2EA 1KEEB 3BIWA 3QVMA 4RDIA 3DJFA 4H9GA 4JOSA 1ZVVA 1YC2A 3O90A 3QXGA 3OT1A 3FZGA 1VSTA 3K32A 5FNZA 5FWDA 4A36A 3VI3B 4MCAA 1T4GA 4F56A 5GPBA 3G9XA 1AZLA 4IJWA 3TVDA 3VI4B 3LJKA 4EKGA 2PNFA 4IG4A 1GQ2A 2JARA 4U63A 1W94A 2HIAA 4Z86A 1BDHA 3I6MA 3F90A 5EE3A 2EW2A 4IDBA 5EERA 3HR8A 5BQPA 2BGMA 1P1KA 1OWOA 2OGZA 2JFFA 1ST3A 5LQAA 3ZV5A 2OV2A 5AI5A 3TRHA 3DYVA 3L46A 4L0DA 4EHDA 5B3LA 4KFRA 1Z8HA 4F9FA 1IXRC 5DSTA 4CEHB 2P3QA 3E1SA 2QY9A 1GDHA 3P9PA 1W7AA 2UUAB 2WG0A 4QJ4A 1I32A 5ITZB 1J8VA 1T1JA 3JQGB 3Q85A 4FMPA 5JANA 1C0KA 2I6TA 4YJ3B 1N8NA 5FYQA 4KPUB 2W4IA 5KQLA 4BRZA 1VFNA 2ZYTX 1CS0B 4HMOA 2IV3A 4RFSB 3TVYA 4U2FA 4FBGA 1X7XA 3N76A 1B6RA 4IGFA 1CZUA 4JCOA 3QEBZ 3A3KA 5F3WB 1E9FA 3MYRA 4UDOA 1Q0SA 4FGUA 4Q4JB 1KQPA 3KB2A 3TTUA 1TX4B 1UJMA 1W48A 1D0VA 1RWMA 4OM7A 4M87A 1H2XA 3WMXA 2IBSA 5HRCA 3GLIE 2ZIXA 1K3TA 3WKAA 1C1DB 4G1MB 4EVSA 1TE2A 1JHAA 1ML3A 2RB4A 3RVDA 3UK2A 1A8SA 3QKUA 4WJKB 3BMNB 3TZEA 2Y66A 3CR8A 3L77A 4OU5A 1N3IA 3DBLA 2EU8A 4ND7A 1R6DA 2WK1A 2BFFB 2FE4A 3I2FA 3D1VA 3WLPA 2A3RA 2QPAA 4TV9A 2AB0A 2JKYA 2JZCA 3CRW1 1RIIA 2CDNA 4FOPA 2PXHA 3L7NA 5CX1A 1HE8B 4BO3A 5LR6A 3DKKA 1BFKA 3IV7A 2FGJA 3N0VA 1XZPA 3LBYA 4RA9A 4L5YA 4C4AA 2B1JA 1V0JA 3SYLA 2Q1YA 3I09A 3UH1A 5K0SA 2Q1WA 4MW9A 4TSFA 2GYWA 4DRZA 2AFIB 4NICA 6ADHA 2J5RA 2AW5A 4ZAGA 4TYMA 2Z8YM 3WTBA 1TMOA 4HX2A 3FC3A 4PXYA 1WUKS 3G59A 4Z0NA 3F6EX 2PJZA 3HZRA 4MVJG 2BKVA 3HFJA 4WOKA 2W6QA 1CD5A 1IN8A 1LFAA 3GFPA 3N6RA 1EUDB 2P0AA 3HWRA 4FWIB 1XTKA 3Q3JB 3BXXA 1X6VA 3RTCA 5KU7A 4NVRA 5IF9A 1YH3A 5AVTA 4DW8A 5HZMA 1WPRA 2BKXA 2K6GA 4YJ3F 4A73A 4YAGA 2Y1EA 2G9VA 3WWDA 1U3VA 4EQZA 4QTYA 3OCWA 1JJAA 4IMPA 1SBNE 9GPBA 1KO1A 3NVAA 1Y34E 3IVRA 4GMXA 1FLVA 3IEXA 4GM4A 5B7GA 2Z1DA 1UFVA 1NWHA 2C8JA 3FBTA 4PRZA 4LDQA 1TQ6A 1UJ6A 2V1CC 1SK9A 3TCKA 5DT9A 2IY9A 1YBAA 1ESMA 2OGSA 2QLLA 3DOEA 4OU4A 4Q3BA 5HXAA 1T2AA 3C3XA 3BWEA 1XZQA 1NNI1 2JIOA 1P7PA 3BS4A 3D4LA 1HDEA 3GEHA 3D43A 1J8MF 3C8DA 5GIOE 2N52A 1C3VA 1W5TA 1XMPA 2J3HA 1M0TA 2XITA 2YXLA 3I37X 4KE7A 2H1LA 4K6CA 3BWVA 1A9XA 3AL0C 5I7UA 2ID7A 2IIPA 1U2DC 2P5TB 2VCYA 5FV7A 5B1SA 4D92A 1QYDA 4IMJB 1D2MA 5K1ZA 5TMBA 2O50A 2OHVA 1Z12A 4Q7JB 1ZRNA 2W6JA 3H2SA 4GS5A 1DZIA 4R2LA 1GRVA 3IUYA 1QRSA 4R05A 2WU1A 4EUEA 3JQBA 1ESDA 3ZLBA 4C4XA 3AERA 2ZDGA 3JWEA 4FYYA 2J1LA 4MQEB 4YUYA 2FR8C 4AJ9A 1X7WA 1N9GB 3NXSA 4LJ4A 1A9ZA 4NP6A 3F7MA 4J6EA 1XNQB 1UIRA 3BREA 1R9JA 4X92A 3KKMA 3PDCA 2Z2ZA 2HRZA 1HFJA 4KFUA 5EX3A 2YZGA 1YZUA 1XVVA 3AJ8A 4ABYA 1BJRE 3HP4A 2QN2A 2RCYA 2X7HA 1E7RA 4G85A 5M7EA 3WL7A 2OKCA 1U8XX 4ZVVA 3NRCA 1D2RA 2CCJA 4AVYA 2Q9BA 1DCMA 1C8BA 1G8AA 2CF6A 4KU4A 3GJ7A 3BM5A 3TN7A 1N2OA 3KO8A 5DTMA 3F73A 2Z5FA 3HJCA 1DXHA 3MWEB 3TOZA 3JQAB 1JIIA 3M9XA 5T3YA 4ZGWA 4S05A 1GLNA 2Y2VA 1E5XA 4LE0A 4TM8A 1MXHA 1PYGA 2OAEA 1A97A 1KBEA 3L92A 4KQEA 5D7NA 3G9UA 2EYUA 4ZQBA 1JR2A 2BM1A 3F8TA 2W4MA 3GUUA 4O4JB 1ICEA 4JT2A 4RUKA 5C52B 3N07A 4JXJA 4QVIA 4PYLA 4ZHQF 1XEFA 1B8PA 1JR3E 3GPBA 4V0OA 4E2WA 2R8XA 1XMXA 1YQWA 3X0DA 1Z2PX 3EGXB 3ST7A 5SYMA 3UOEA 3IQXA 1OVGA 4C14A 3K0BA 2PZGA 1A7AA 1XJWA 2PH1A 1GEEA 4FCTA 3GCWA 5GY7A 3VC2A 4BMCA 3NPAA 1T6XA 4D46A 1SXHA 4RFLA 5ECDA 3H9JA 5BOVA 1A3CA 2O48X 2V5VA 1KARA 1Q57A 3CX3A 1TVKA 1NJFA 3B1ZA 3GBPA 3LRPA 2XTAA 3QMWA 4AKHA 3PDIA 3DQPA 4IXNA 3SBEA 2Y1WA 3JR3A 5DCWA 5J2TA 2J5QA 2JJYA 1XQ6A 3UAOA 2JCXA 4RQBA 1UWVA 3UGDA 2AN3A 4M98A 3BFJA 1FRFS 3MMSA 3U9TA 1Z2IA 1ADFA 2REBA 4D4LA 3T3NA 5KCMA 1G3RA 4BUCA 4ZHQB 4B48A 4UEKA 5CVTA 2OG2A 3HV0A 3V4OA 1C7QA 5H0IA 5T6BA 2OWEA 5BYBA 4AY3A 3D0RA 4OLJA 1KK2A 1BC5A 2K7ZA 3SQMA 1QS0A 3PEYA 1VLQA 3ETJA 1SU6A 3PFHA 2RKBA 1O2DA 1C7FA 2RGWA 2FUG1 1EUCB 2NQ2C 3GDGA 4Z0HO 5EIWA 3VNQA 2ZTVA 1GTVA 4P53A 4QRIA 5G41A 3K8QA 3BPSA 2H1CA 1X7DA 2NSJA 3KQTA 3PGJA 2HA4A 4UDNA 3MC1A 1ZDMA 3UQZA 2J46A 3RS8A 4R0MA 1DCTA 1U2GC 1WCV1 2VQFB 2YQPA 2MSNA 5C1DA 3WL5A 1FW6A 2JI7A 1BX3A 1NNUA 3C7DB 1YRHA 3KU1A 3U26A 3TTYA 2VXBA 2YMPA 3BK2A 3S44A 2DFTA 1RAAA 4B4UA 4DGQA 4ZICA 1DEAA 1VE3A 3DZKA 1H2ZA 10MHA 3CT6A 4O4JF 3H1BA 5ALEA 2H0QA 3RBVA 1VHQA 3RKRA 1H1TA 5DWVA 2AMFA 1XX6A 4JAVC 3ASYA 2O1WA 3CS3A 3HBFA 5KDDA 1NBWB 2X6RA 2YYZA 3QLTA 4KIFA 4ZC1A 4AG6A 1I6WA 1QH9A 1BG6A 1FVHA 2HWXA 4LXXA 2RE8A 4IZOA 3BZBA 2AZDA 3JYHA 4RLHA 1E2MA 1PR9A 2I78A 4DTIA 3M4XA 3ADOA 4BFSA 4QM6A 1QGUB 5REQB 1KY4A 1X3LA 4J0QA 1UPXA 1E4VA 1YVEI 1A9QA 2BE7A 4MITA 5L3QB 1WG8A 3KAQA 1RRVA 1DJNA 2W48A 2IPLA 3IP9A 1RC1A 4JVMA 4D43A 1UMCB 4UPEA 3ORFA 3KUXA 3ZE6A 1M54A 2MOKA 1Q7RA 3FPSA 2OCXA 3H0KA 2HSEA 4YTEA 2JGAA 3ZDXB 4HN2A 4DUPA 2HUPA 2OGTA 2AHRA 3JR7A 3JRNA 3ZZUA 1G7SA 1JHMA 4FZRA 5ECGC 3T7SA 4CLXA 4XVQA 2M1ZA 3C6BA 3D1LA 3E4DA 3M4NA 4N47A 1HEVA 1D6NA 1KYIA 3A2NA 2J48A 2PYZA 4TQGA 4OHZA 2QN9A 4L4XA 3KC2A 3K2QA 4BLVA 2A94A 2X8LA 5TEVA 1X9HA 3RVOA 3L7JA 3LF2A 1RAHA 4JK3A 4M60A 3E23A 3PS9A 4D3FA 1GR1A 3ISVA 5GJCA 3DMRA 4I9NA 4E12A 4EAQA 1PK9A 1Z2DA 3IERA 4FFDA 2J9FA 4LDPA 4B6RA 3L1JA 3UK0A 1KS9A 4MUBA 3S7ZA 3LV8A 1U8YA 3EUAA 4YONB 3WRVA 1CEXA 2CKMA 5DCYA 5ER9A 3GG9A 3HLYA 3DTNA 2ET6A 4OMDA 1YONA 3WIBA 4R83A 4S1TA 3ABSB 3VR6H 1HRKA 1Y9JA 4W1SA 1CRLA 4EFNA 3QUAA 2OCBA 3KV3O 4DLBA 4ZI7A 1D7AA 2A1UA 1FDUA 1K5HA 4DUZB 3WP1B 3N6VA 4UAVA 5JNSA 2N75A 2XOEA 1BVUA 3V2GA 2F43A 2O8VA 4EYKA 4AJNA 1EB8A 2XZDA 1MORA 2V0CA 5BXYA 1FQKA 3TSWA 4YRPA 1ECCA 5AHOA 2ZITA 4YCBA 1S5PA 4M8LA 1TIPA 3W9SA 4CL2A 3CYFA 1O6FA 4B2YA 4DKXA 4NARA 4Q4CA 6YASA 2G76A 1E3IA 5GOTA 1T1GA 4KI7A 1B6SA 1CULC 1XP5A 4O4LB 3UAWA 3GI1A 4C4OA 3DPSA 4NH0A 1JHXA 1MAVA 2FZCA 3SU8A 1FZQA 1PLLA 2B3DA 4URVR 1CUSA 5IBRA 2FKNA 3M81A 2C61A 5CK4A 2Q2OA 4H1HA 1OAOA 2DHDA 2NO9A 1DHRA 2Q5QA 2AJLI 2H2FA 3ICEA 1RTKA 2X52A 1UHAA 1FMJA 1NFFA 2F1KA 1LU9A 4EY7A 4RVFA 1WKXA 5EY5B 1DKMA 4MRMA 3TFOA 3GRFA 4LHEA 1YA6A 1N1DA 3QKIA 5C5DA 3MWJA 4RA6B 4QBHA 2V7UA 1PGOA 2GAJA 1GPKA 4JL6A 4I4LA 3G0CA 3KOOA 3VNRA 3TBKA 3UJPA 4X1IB 4BEJA 1Y7HA 1DXYA 3GLTA 3T5MA 3WYCA 3QSYA 4FFRA 3OA2A 3I5AA 4B3BA 1UODA 1U0LA 3KSZO 5BXQC 4C89A 2RJOA 2J4CA 4BO6A 3OXGA 5HGJA 3NUQA 5FXMA 4ACBA 4D9HA 3EA0A 4YUVA 4ZCMA 1QUEA 2VTEA 4ID3A 4PIPA 1XIVA 3SSAA 4D5GA 1IQRA 2QTNA 1NULA 2FV8A 2UDPA 3LRXA 3BCHA 5LOVF 1FOEB 3B89A 1PTRA 2QAGC 4CU2A 2P4UA 5A4DA 3C3DA 5B1HA 3W8NA 2P67A 2FFHA 3KPUA 2DR2A 3VYVA 1D1QA 4GR9A 1WIWA 3HNPA 3QEAZ 1JR4A 3C3AA 1Q1NA 1DUSA 5EYPB 2R5NA 4E5SA 4QGBA 2WPNA 1WX1A 2V8BA 4HQNA 1N6IA 2GAAA 2WUFA 1HOTA 5CVCA 5IKXA 4UTPA 3FLBA 2WF7A 4K6MA 2QF7A 4YHHB 5HBRA 1PL6A 1CRWG 3FW1A 3N0RA 1H3NA 1GL6A 1E79A 4BL5A 3EQ8A 4HDMA 4RMHA 1IB6A 1GM5A 2FK7A 2YW9A 4MYHA 5C31A 3ZWOA 1GNSA 3QELA 4REQB 2J3EA 3KM0A 5T4FA 2ZRBA 2IYTA 3NETA 1MVOA 5SZIA 2AR7A 4TUYB 4WK4B 1R6BX 2FA9A 2JH9A 1U1GA 1GGMA 3K53A 3LHSA 4YCAA 3WI7A 1IHXA 2GN6A 5LDDC 1DAMA 4Q1FA 5EMHA 2Z2KA 3WDMA 5BWOA 4LQ4A 5I4CA 4YIHA 2VDQB 3ACCA 2QTGA 4CM8A 1R0LA 4GM0A 1NFRA 3E8SA 1GG9A 3KP1A 4ECAA 4DNFA 4ILKA 4M46A 2PA3A 2HYIC 5IH3A 2JGLA 2WUVA 1KOFA 2C4WA 3NONA 4OHWA 4QUIA 4FYJA 5B3AA 2E9SA 2DXIA 1I8TA 1TJ4A 4ENSA 4XAQA 4FMBB 4OP3A 3OIGA 3W8DA 2ZP1A 1E3QA 1TTHA 1CDOA 1AVTA 2BEWB 5KUTA 3FYSA 2Q46A 5E3RA 3BSFA 4HF7A 1QPGA 3IVAA 3L93A 1YL6A 1Y8ZA 4LF7B 3R9XB 3NV7A 2A9OA 2P5YA 3H16A 5FJIA 3RKSA 2XWBF 5DN9A 2DH6A 3I52A 4EB6B 2G83A 3SX2A 1UL1X 3MQ2A 1EVEA 4BE7B 2Q99A 4YN3A 2UZ1B 4JU9A 2J08A 5JQWA 3A58B 5L4LA 1NWCA 1TAQA 4GYWA 4KMOA 3D8SA 1CZHA 2RJ3A 4NH4A 1OKKD 3KEMA 3OMLA 4WINA 1GAJA 5AHKA 1OU4A 3CRVA 3WLAA 4C76A 5LP1A 4MS4A 4LBVA 1OGYA 1KK0A 1UVFA 1NW3A 2QV7A 2ZI4A 4NYMQ 3OZEA 4CM3A 2CMDA 1M66A 4WACA 4HDNA 5D5HA 2QNRA 3DF9A 1LSSA 1JQJC 4WZ6A 4ZT7A 2R47A 3STXA 3AJRA 1E1RD 2VJMA 3RYIA 1Y48E 1GDDA 3UAYA 4DG8A 5FB3A 2C4HA 3Q0IA 5CFNA 1GZ3A 3HXTA 3GLRA 1FP2A 1G18A 2G72A 5ELMA 4TUYF 2OESA 5AVOA 2VHZA 5C8DA 4DN6A 4A6DA 5JS7A 4ZKEA 1T1RA 3AP2A 1DFIA 2AOXA 3CH6A 1NIPA 4HLQB 4MVJD 4IW3B 2HW8A 5TPWB 4ZYXA 4PEVA 4AKSA 3LUAA 3ROQA 3A6FA 3OETA 1T3TA 1ZUIA 4BO9A 2YVLA 1KHHA 4JCCA 4Q18A 1YZLA 2AG1A 2R1VA 5KJ1A 3JARB 2QJTA 2C9MA 4MNTA 1KWKA 4KQ6A 4CYMA 1REQA 3AR6A 4NZNA 1DAOA 3NHUA 2XUKA 3G2MA 4K9DA 5ALNA 3B7PA 3V1YA 1YOVA 3W9YA 4FMCB 5LP6B 3M4YA 5CT8A 1XZKA 2PTGA 3CA8A 3GRUA 4WRRA 1Q84A 2QR3A 3SC6A 3EGDA 3B5IA 3LFUA 3R24A 4DLLA 3SVTA 1PN3A 5DM70 1YE3A 2C4TA 2VJPA 4E2XA 1HTWA 1IEQA 1RE1A 4FNMA 2NO4A 5BR4A 8ABPA 4LYGA 3O4IA 2BI4A 4TLLB 1BMTA 2C7VA 4Z4FA 1BE6A 5GQSA 4D44A 3IAM6 5K4HA 1IK6A 5JD4A 1SVIA 1KVSA 2W2LD 2X4LA 3IUEA 4HNHA 4EI2A 1X38A 5A7GA 3AH8A 3IJPA 3HEBA 4HG2A 2R7MA 5TC4A 3BD7A 3L0OA 1QC5B 3RLFA 1V26A 1SPXA 2XVXA 2PPVA 1KXJA 4XB2A 4D4IA 3VX3A 4JLUA 4CN9A 3NJ8A 4OBXA 3AI1A 2GYYA 4JIMA 1PVVA 2WHPB 2AI3A 4P4SB 3RSLA 2D0DA 4CG0A 5KX5A 4BJ5A 1J7KA 1H9AA 1KZYC 5JUWA 1AD2A 1HWYA 1FX0A 4K9OA 4ONEA 5JY6A 5A9SA 5JQGB 1FSGA 2HMAA 1I4WA 4WOBA 5AW5A 4F92B 1WZEA 3I5YA 2PTHA 1D03A 1PVDA 2VA9A 3UT5A 5KYXA 1AMOA 5K8TA 4S04A 2W2KA 2NV2B 1N5DA 2VHXA 1CIJA 1H94A 3E8MA 4IQGA 2XUJA 2VAPA 4JA2A 4LOJA 4YRTA 3PQ3A 3K92A 2I0FA 3QVWA 1PR0A 3QE9Y 3IPLA 2YC2C 3PQ8A 1D2GA 4Q9JA 1H5QA 5J4LA 3AL2A 3OLVA 2FZLA 2DCMA 2ZVQX 3WK5A 4F5EA 4X8HA 3B1YA 2GCOA 1LF0A 4FKMA 3TR6A 2X14A 1VLZA 5B57C 1KZ7B 3UPTA 3FPJA 4PC1A 3SYMA 2BDTA 1OBCA 3KYCA 4FMCF 4DLTA 1SXJC 3N28A 1QIIA 3RTAA 1DOHA 1WKCA 5HQJA 5E8RA 4JI5B 2ZIWB 1DCFA 4OCZA 2RHWA 1LSJA 1NX9A 3I8OA 3KZOA 2WTUA 2GN2A 5LXTB 1VKJA 1SKUA 3QG1A 5CD9A 2QMUA 3HZOA 3Q12A 1NLYA 1OXUA 2QX9A 1WMFA 4DZTA 4B76A 2VK8A 2Z2JA 4K9SA 4TTSA 3O83A 4KXNA 3E1KA 3CZMA 4FJ0A 3VU8A 1RM5A 3W34A 1U80A 1K27A 4MKGA 3LUHA 1V8DA 5BN4B 4Y6LA 3X1KA 3NC4A 2CVFA 4BB9A 3DVSX 3WLKX 3GJ8A 1NV8A 1SA0A 3DOIA 4CW7A 5BWLA 5JH7A 1ZCFA 2UZAA 1CJUC 2ONZA 1P2FA 1F8XA 5JZ9A 2AXQA 1SBYA 2Y6VA 4OHMA 3DVRX 3E58A 4BNFA 2JFPA 3QTTA 4BVBA 4BJ1A 2W5UA 1QPZA 1ZD4A 3LC1O 2OYRA 4TL9A 4ND3A 3RT1A 2NXWA 1NF2A 5A4KA 1YU6C 3I2GA 5DBIA 4TZTA 2F90A 5CBPB 1W0KD 1L4HA 3WLEA 2HDOA 4DA9A 4CG3A 5IJZA 1ORWA 3PNKA 1PCEA 1KY3A 3NAQA 4ZAXA 1P31A 1SR8A 1E3EA 2P4HX 4D9CA 2Z9BA 2GH1A 4QX6A 4AYWA 4CMAA 2Z8ZA 3EF3A 2GCIA 4GWKA 4FWBA 4NG4A 4ENQA 4K7JA 1C29B 2FR0A 3LVRE 5EMMA 3FXAA 1JYSA 4F45A 5CFPA 3PXAA 5HK9A 3PC3A 3QOWA 1ADJA 3BGWA 2I3BA 3QKRB 1P18A 2Y1OA 1WZNA 4YRQA 4FHEA 5F12A 2DFKB 3FF4A 4D9IA 4YBZA 4GDMA 1GL3A 1UT8A 2AOTA 3H13A 4UTXA 3NWJA 5DK6A 5DTRA 5I9LA 1A7JA 2WKWA 3AHHA 2X7JA 3C1TA 3UICA 4HDSB 3SQWA 2UYYA 1WHTA 1G2PA 3AESB 2AF3C 3KTOA 4HLCA 1ZVMA 2ZE5A 3F6CA 3QYPA 3WYNA 3ZGOA 4X7RA 2WF8A 4R2MA 3BFPA 3A7DA 1P9OA 1U0HC 3GO4A 5A9TA 5JEEA 3TZLA 4DR3B 1R64A 3QLVC 3P32A 3V97A 4O08A 2SGFI 4Y6RA 3CKMA 2RC6A 5EMJA 2VNJA 1AN1I 5LXTF 3Q9UA 2DBYA 4J1NA 4RADA 2NU8B 1ORHA 2VRWB 4FFBB 4ZVTA 3DBHB 3FTQA 1S7CA 1IAVA 1G98A 5K3EA 1OZ0A 1S20A 1UKEA 3KAJA 2BGUA 5EHXA 2IXEA 2VUTA 1JAXA 5IM5A 4BMXA 3PUZA 1CUEA 4BRWA 3KQNA 2C29D 1NAIA 1XD2A 2IKQA 3BCSA 2AW3A 3OPYI 3QWFA 4IVNA 3BHNA 2C4MA 3G88A 4PX5A 1FP4B 5GV7A 3BMXA 1LEHA 1LQ2A 2QLFA 2DBQA 1U0GA 4TXJA 1SC6A 3PXDA 4W5JA 6CHYA 5KC8A 5IBPA 3FB1A 1I3LA 2HDHA 2YIJA 1M2OB 1LVHA 4KUEA 2O2DA 3DQZA 1QE0A 4LE1A 4ESEA 3SQXA 1Y0BA 3NP7A 3E9EA 3K0KA 5EHNA 1XU7A 2VHUA 4JBWA 4R1LA 1ND5A 1X92A 3HFSA 2QAIA 5LWHA 3M0EA 4BBZA 3OQMA 1FY7A 2HFKA 4A6PA 2JLXA 5JHWC 2CJXA 1QORA 4XR4A 3PUIA 4Q24A 3O3OB 2B8EA 1WZIA 1GQFA 4UNNA 1QP4A 3ZNQA 1C80A 2JAXA 2O2SA 3Q7SA 1ZESA 2W6PA 3FMVA 1Z5ZA 3D4PA 1DINA 2JPDA 3D6AA 3PHJA 4Q01A 3RUDA 3UWPA 4RMJA 1IY0A 4RYLA 2FPPB 2FVYA 1RWKA 1G17A 2OHGA 2YW2A 3JQ7A 3WV5A 2GHRA 2GN0A 3DEIA 3SYRA 4D97A 4PFJA 1ZH0A 2IBMA 4HHEA 1PTQA 3EZ6A 1ELOA 3TRJA 5J3JA 1GHTA 3GP8A 1H5UA 3QJYA 4BKPA 4MIEA 2RGCA 3PUHA 3HEMA 3GRAA 3O8CA 2FOLA 1DZ3A 2EWMA 4EF4A 2XZLA 1U3TA 3EFOA 4GX0A 3H1TA 3N3BC 1G19A 1P4GA 2VWQA 5IASA 4OHRA 3I5XA 2VDWA 1Y6QA 4UFOA 5I4IA 2CNBA 2R48A 3FOFC 3A6PC 1DLIA 2FFBA 3SLKA 1G63A 1PO7A 2TMDA 1BX0A 1HQCA 1ZMTA 3Q2KA 1K9VF 4MDYA 2YJ6A 3OJLA 3I83A 4KACA 5FAXA 4DDMA 3GL9A 1N4AA 1E2HA 2QB5A 3HYCA 2DTDA 2QG9A 5HDQA 3NM5A 1ZXXA 2AC4A 4JP1A 5GOZA 1XF9A 2QVCA 4UTOA 1T2DA 4KDCA 1YZHA 3JRWA 4YX9A 2VWPA 3RYTC 4CIYA 1T36A 3FHCB 3T5CA 4QRHA 2VPTA 1E60A 1UAGA 1XWFA 2BBOA 2G28A 3HDTA 5AM0A 5F5NA 3ITNA 3UCEA 2A9KA 3CRZA 3ZY3A 1MJNA 1Z6QA 7ADHA 5F23A 4EGCB 2VDMB 1OH5A 4KNYA 2L18A 1EP1B 5FPSA 4XYMA 4LJ9A 1N2ZA 1UZNA 5EEGA 5ADWA 1UM9B 1I7SB 4CMJA 3A1TA 2KJQA 1S9DA 3H5WA 4V2UA 1Z17A 3ZOKA 1Y63A 1PJTA 1ZFNA 5U4QA 2RI6A 1J99A 3V1KA 2FRXA 1JL3A 3QX8A 3NX4A 3CRNA 4CTJA 4OMFG 3IV9A 2ENZA 2JFOA 2CMKA 4DQXA 3HXMA 1D1SA 5FPHA 3DDSA 2B4QA 3RSOA 4BP3A 1NJ5A 5K09A 2IYPA 4AZSA 1IUOA 2GXQA 4N3CA 5E0OA 4NJMB 4E7OA 5AQEA 3KE8A 3QPBA 4I6JA 3M6XA 1R3DA 1E4OA 5DM2A 2PZFA 2FMKA 4IH9A 5LYYA 3QMPA 4RKQA 4Y9TA 5CRIA 1ZWKA 2TMGA 3V00A 1HPTA 2C83A 2I2AA 2J85A 4FX2A 2WV7A 1RT9A 4NSNA 2DM6A 2H9AA 4P36A 4OQ4A 4RWEA 4URXR 3T1YB 3BXZA 3EIOA 1PQUA 1VJDA 3EQ9A 3O8DA 4XM1A 4DDKA 5IDWA 3HB4X 1VG0B 4TS9A 1YA4A 1BGXT 1L5YA 1GPYA 3MTQA 1E5TA 1ZBQA 4TT3D 2DE0X 2FRDC 3N2LA 2EOAA 3UPDA 4OGGA 3DQQA 3U17A 3JVUA 2QQGA 3KZCA 1CB0A 3AR9A 3N87A 2JRLA 3QXJA 3LKZA 1M7HA 3BXHA 2DPHA 2PKWA 2Q7OE 3CBQA 2PPLA 3ZQ4A 2IK8A 4KR6A 2OHFA 2YQ5A 1NGSA 4R1PA 5FQOA 1D4OA 3ZK7A 4PINA 5CDYA 4Y1RA 2CSUA 5JD5A 1CJTC 4Y3UA 1M8JA 3Q3HA 2BFMA 3AMVA 4RAQA 5T57A 3JVIA 1GL7A 4BMSA 1H0KA 1QPBA 1PR5A 1XU9A 2JIQA 4KN5A 2UZIR 2BBTA 4ZO9A 1SD2A 4CETA 1UXHA 2E1RA 2ZPAA 4LQDA 3AO0B 4NCAA 3DTVB 3GD5A 2IZ7A 4E13A 4XWAA 1PT5A 2GPBA 4LSWA 4M7OA 4QXAA 4WXRA 1EGAA 3MW8A 3ZZ1A 4RY2A 1EEXB 1U02A 4KLNA 1QG0A 5AFSA 1ZOPA 1PGPA 2C4KA 4GRIA 4JUDX 2Q4RA 3KJXA 3LPNA 5FO0A 2OKGA 1O6CA 2I2DA 5P8WA 2O6HA 5CB4B 4PHTA 5IAGA 3W5VA 4DZZA 4EBBA 4AYXA 3W5SA 2XXAB 4HQFA 4L4UA 4WGGA 1N25A 5C34B 2IQIA 1JE1A 2BGLA 4AXXA 4R0VA 4B8YA 1N1MA 1SVOA 7WGAA 2LTAA 3GRKA 3UXMA 4F91B 3CT4A 1EXMA 3RSZA 5IBCA 1MZPA 3HU5A 2JXDA 5CVVA 4OSOA 4EPVA 5ISMA 4HOYA 4Q4DA 4ARSA 1ZNZA 4Q9AA 1NJ8A 2WJPA 1JIJA 4RH1A 4GX2A 4MW0A 3QX9A 5BSMA 3ZVKA 1OAKA 5HQ8A 1HG0A 3TLMA 1UBKS 1V3QE 4I8IA 2F4VB 1C3LA 3DC7A 1V16A 2XIJA 3AF1A 3FBWA 3NV9A 4UUPA 3LMKA 5CU7A 4JL8A 2P2CA 1AGYA 4D42A 4E07A 4FBLA 3ADDA 1ILEA 1W35A 5THXA 3CUKA 1GGJA 1P19A 3Q7RA 3A1DA 3K05A 1T1IA 1XEXB 2V6BA 1QHFA 5JYCA 1HA3A 3I72A 3VHXB 2EZ8A 1SVSA 3BG5A 1X14A 2IYRA 4QARA 5KSOA 4M83A 3WHKA 3LD9A 1X2BA 3BAZA 4U7HA 2RAUA 3AFMA 3AVOA 4UD2A 3HO1A 4W5TA 4EKYA 3LT0A 2A5GA 5JXJA 2QN7A 3MGGA 4RVHA 1OFIA 2ONJA 1CRZA 1XYVA 2E6KA 2CLIB 2GUGA 3K1ZA 2W71A 1WMEA 4M0PA 5EE0A 5JCJA 1N0HA 2J9RA 2JHCA 2O2EA 4UNIA 1CUBA 1JQAA 4ZOLA 4DCGA 2W8ZA 4WZBB 2W70A 4F3TA 3DWIA 2Z0MA 3P9RA 3IIIA 5HE9A 3E61A 4RDCA 3RDPA 2XE6A 2XDAA 1LBSA 1JZTA 3DR3A 2MSKA 5ANRB 4H7JA 3WYGA 3WFIA 1RWVA 5L51A 3KT0A 4RJIA 4UJ5A 1M5TA 4WKBA 2YWBA 3EPPA 4KODA 4BGDA 1PJ2A 2GZDA 2OO5A 3OZAA 3SHQA 5CB4F 4TLDA 1TVMA 3EVNA 3RGWS 4B3DA 4BB6A 3MAJA 1XB2A 3E7WA 4LDRA 2VTBA 4BNXA 1IY1A 5JW6A 2G3YA 2VSNA 1CNEA 3T3EA 2RGDA 5G0WA 3EK2A 4V3BA 3K70C 3ZHOA 1ATIA 2TYSB 1KAOA 4IFBA 5IJ0B 3HSSA 2AFVA 1QE5A 4N7RA 2BTEA 4WXMA 1R6VA 3MOSA 4B6JA 3B1KA 3ZDCA 1UQRA 4BYGA 3C7CB 4E3WA 1SXGA 2NSHA 3QENA 1CR1A 3EBOA 4WQMA 2L19A 3UANA 2J31A 4GYJA 4TXHA 4MO9A 5SYNA 2AN9A 3DCIA 4CBVA 4EJ0A 2WJVA 2PAAA 2OV4A 4FNOA 1HYHA 5K3DA 2EGHA 1EWQA 3PUJA 3VZBA 4BNHA 1R9GA 4IZIA 5IAEA 5BSGA 3GRCA 3JVEA 4RHUA 1C1XB 4LVUA 4Z2YA 3MS4A 3G85A 3PC8A 1GAQA 3BD9A 1RS0A 3VV2A 1BKYA 1M7BA 2XYGA 2A9FA 3CKKA 4Q9NA 4R9SA 2J3DA 2COKA 3AILA 3AF2A 3E70C 3R6WA 1EX6A 2NU6B 3NWBA 1Y1PA 3K1JA 5E3QA 1SC3A 3OLXA 4S0XA 1UJCA 2QX7A 3GEMA 5LUBA 1CZLA 3WYDA 2VZEA 5JBIA 1NNSA 4QSMA 1EJ2A 3CIFA 1JB1A 4P4LA 5EOVA 1Z13A 3RVKA 4K9NA 1SQ0A 4C03A 2QZZA 2O54A 1LDYA 4DTCA 2XI4A 3JYPA 3KPJA 5AKIA 2J45A 3T7AA 2BWJA 3PEWA 1R0ZA 3K9LA 1D0SA 1U8EA 4C29A 3QNUA 1LVGA 1YCDA 4ZPJA 1ZIPA 3BH7A 5F7OA 2QP3A 4DV4B 2FHSA 3ZNNA 2VPQA 5EHZA 1ZA1A 4IGAA 1PZXA 4TWZA 5B4TA 4J3JA 2O0LA 5C1PA 2PX0A 2X0EA 4E5KA 5ITSA 5MN4A 5KNDH 3PJRA 3ZGVA 3DZCA 4C6SA 2J6IA 1RJGA 2H48A 3OWOA 1VMKA 2LXNA 3DXZA 3WMWA 1E69A 2V6GA 2H29A 4F0JA 3PQEA 3ZWQA 4MRNA 3OLZA 4QYSA 4LC9A 2WQ6A 5C5IA 4J07A 3RADC 1E4EB 2HHAA 3AUUA 4ZO6A 4YH1A 1F4PA 3SHWA 2WJAA 1NBEA 4KRXA 4IIVA 5H80A 3QX7A 4CKZA 4B80A 3OG9A 3SZGA 3H1PA 3AF5A 3KKLA 3LF1A 5CCLA 2OCLA 2GNPA 2GQ0A 1R0RI 2A3NA 2I34A 3N2GB 4Q4LA 5DTIA 3TLZA 2N1MA 5FUXA 2QRPA 3LI2A 3KELA 1QG4A 4GR5A 1JG6A 3S2UA 1OLUB 4DCJA 2O8FA 2IS2A 4P34A 4P7FA 1RI1A 2IPNA 3CUEF 3O1JC 4LA4A 4ZK6A 4GKAA 1BMQA 4K9LA 1CQJA 5GZ3A 1UPAA 1LPMA 4FCVA 4KLAA 5FWXB 2HPZA 3CZCA 4YBRA 4YJFA 1V1IA 4XRRA 3VDXA 1AXEA 2IU4A 2W2NA 2NGRA 3GVXA 3HUFA 4C5AA 2I2XB 3IQFA 1ISRA 3ZGXA 3CE9A 4EG3A 2V1UA 2QLJA 1K97A 1OASA 5CXUA 1QX4A 2QZPA 4F1JA 2QNIA 2GN9A 1CR2A 2VN8A 4RLSA 2WWYA 1V6CA 3CV3A 3BFXA 1RI3A 1MAUA 1F5NA 3K1AA 1H8EA 4JR2A 4WNIA 3ZC3A 3GEIA 5HQTA 2WQ7A 3DZJA 1RQNA 1P0IA 1QRUA 3C70A 1SKBA 1L1QA 4MR9A 4NAUA 4X9XA 2OV8A 2QKYA <