2J9RA

Thymidine kinase from b. anthracis in complex with dt.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
195
structure length
178
Chain Sequence
b'SHMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPTKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 44
structure length 178
sequence length 195
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2j9rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j9rA01
4O0MA 5FOSA 1RC8A 1P61B 4TLDA 1G8FA 1ZVQA 2ZS8A 3BAFA 3ZVRA 1G64A 1MABA 2AKYA 4EPYA 1W47A 2RGDA 3TAHA 1GG2A 3I8SA 4CIDA 1TQ4A 2O0JA 3QVUA 3QEOA 2V9PA 2WM9B 1G8YA 2D3WA 3NBZC 4PC6A 4EUNA 1NVUQ 3HYRA 4FWIB 1LW7A 3CNLA 4A92A 2B8WA 4MITA 3EC1A 2BMEA 4LPKA 4V03A 3QPVA 3LFUA 4FWTA 2BBTA 1JI0A 1UKVY 4EKDA 4BASA 3T5GA 1VECA 2FSHA 3ZDQA 1KZ7B 1JQJC 2HJGA 2QSYA 1CJUC 2GCNA 3I73A 2JASA 3ZZUA 2RMKA 4Q7LA 4LYJA 2IYXA 4BLQA 4NBSA 1JJ7A 4DVGA 2A5YB 5JCPA 2A5FA 2BM0A 1E9FA 2X1VA 2ZI9A 3QKUA 1KSFX 1YZTA 2NO1A 1U8AA 3LNCA 1KO4A 2FSGA 2A3RA 1BIFA 1IN7A 1Q57A 5UKDA 1JAIA 4AC9A 4EQ6A 1VKJA 1W7AA 1OF1A 1W48A 2C9YA 5DH9A 4BLPA 1W4RA 4TMZA 4H1VA 3B1WA 2FPLA 1XPRA 2JJ8A 2VP9A 3JZMA 4G5OA 2HEIA 3ADKA 3CR8A 3GEIA 1SKQA 2RGAA 4IOKA 3Q7PA 3K70C 4A6XA 3DZDA 2DBYA 3EXAA 3CX7A 3E1SA 4IRUB 3QG5A 3SS8A 4ARZA 5JJKA 1MV5A 4DB4A 5K8TA 4WA7A 3RDPA 3I1FA 1XTQA 1YZLA 3D31A 3W6PA 4B6EA 3BK7A 4FI3C 4JLNA 1NY6A 4I1VA 4RZXA 4CYMA 1CRPA 4ZI3A 2GCPA 4E09A 3KX2A 4CEJB 4QGGA 1XPUA 1Y63A 4MH0R 1UKEA 4I4LA 3LVRE 4BEBA 5EP4A 1RE0A 3EW9A 1W0JD 1XMIA 2K5UA 2ZAMA 4Z1MA 4LCBA 2IF2A 3KKOA 4D82A 3TSWA 1G18A 1TUIA 4B2IA 3KFVA 2ZUCA 1IJEA 2OHFA 2ZIAA 4TZ6A 3VR6A 3S1AA 5JJIA 1F2TB 1I2MA 1XXHE 4LYFA 4D80A 1A2BA 5CB8A 3U7GA 3R8FA 1GIAA 4JJKA 4DCNA 4BFWA 1PUIA 3AP1A 1E2HA 1GL7A 3Q3JB 1US8A 4Q4HB 1ESNA 3K0FA 1TBNA 2ZTSA 3DKPA 4RD2A 4FINA 4BEJA 3GLHE 1MO4A 1W0KD 1TBOA 1XU4A 2A9KA 2KI5A 1UBCA 4HZUA 3NEYA 3MSXA 4F91B 4D2IA 1GNPA 4JIMA 4UXIA 3RC8A 1H8HD 2IYRA 5C18A 3IHLA 4Q9JA 5DI3A 3IQWA 3KL4A 1RZ3A 4IDQA 3TW8B 1RRCA 3P4YA 3T35A 1N6LA 2C9OA 2A30A 2VTKA 4DSTA 1MO6A 4PQYA 4TYNA 4E03A 2QMEA 2CE2X 4URYR 3KB1A 4PPNA 2W6ID 3VX3A 1XMSA 2XEXA 1G3RA 1R4AA 4UNSA 1G21E 2QRZA 4O25A 3W5JA 1QHIA 1S1MA 4QBFA 4D0GA 1KDOA 4WXRA 2PLFA 3IEUA 4MGZR 1F48A 5CYOA 3TRFA 4C7OB 4MRVA 1DAEA 4V0KA 4EFLA 3TKLA 1E9DA 1K5GA 4XTCS 3LW7A 5G41A 3PCRB 1TQ2A 4I81A 4LSGA 3HWSA 1X6VA 1UFQA 2ZSEA 3LX5A 1J8YF 1RRPA 3ZJYA 1GITA 1ZM7A 5FR2A 5EXSA 2C77A 2QGZA 5SZKB 4RY2A 3U7HB 3GLGE 2RGXA 3X1YA 1XTKA 3GCGA 4TMKA 1HTWA 3UWOA 1XFAA 1KNQA 2V8OA 2ZRNA 2JIZD 2ERXA 4OJQA 2JLWA 1F2UA 3DHWC 1M7HA 1YQTA 1GKIA 1ZAKA 2AWNA 5F9HA 5A0FA 2ZRMA 5B58C 1N0VC 2ZI5A 4L4UA 3FYHA 4ZCIA 2VO1A 4NL4H 2J1LA 3MRSA 1JPNA 1NKTA 4NPHA 1XD2B 4MUAA 1OFHA 4R71A 1SULA 4M9ZA 4TQ9A 4JT4A 4MDEA 1H65A 1VCOA 2PEYA 1U8ZA 3TQCA 2PCLA 2W2VA 2GXUA 4I1OA 4Z51A 4U00A 4DB2A 4GPTA 1G41A 2XB4A 5JI2E 4HI0E 1AIPA 4GOXA 4LYAA 3SU8A 4OJKA 1YKSA 3C41J 4HDCA 4CEJA 3ZZTA 3R9WA 2EFCB 2L0XA 3AB3A 4IOJA 4HAZA 1KI8A 2WPDA 3OZXA 1NN1A 1KK0A 4DRZA 2YKGA 1XTJA 3HR8A 3KQLA 3OF5A 2J5XA 5DN6A 1DARA 3QPWA 1BKDR 3H0KA 2FA9A 4LJ6A 5C1BA 1CEEA 2XTMA 2F1HA 2ZVQX 3NXSA 821PA 1X86B 1IN4A 621PA 1TMKA 2QE7A 2R6CA 2VQSA 4XWKA 5J40A 2GBLC 3PUYA 3RLFA 1AN0A 3B8HA 1SXJD 4EPVA 1KGDA 3IHWA 4AY2A 2ZUDA 3I5YA 5FPKA 2WOJA 8OHMA 3NH6A 3AF3A 4KCGA 4LJ7A 3AF0A 1NVVR 1KKLA 1OFUX 1K6MA 2HV8A 4BFUA 3W5IA 3KKNA 4M0LA 2QPAA 1UKYA 3FKQA 4G5SA 2GF9A 4TSFA 1KSGA 1WP9A 3U7FB 2EU8A 2IHBA 3FTQA 4LOAA 2WSSD 3SJBA 4LBYA 1NJFA 2A5DA 4YXWA 5L3VA 5TV2A 4IXNA 1U8YA 4BFXA 4D4KA 3PENA 1KAOA 2VRWA 3VX4A 4A0GA 2G77B 3DEFA 1GRNA 2JCSA 1G3MA 2NGRA 3LQQA 1T8UA 2EFEB 4CRWB 5HZHA 1R5OA 1VIAA 3PQCA 3CH4B 3EX7C 4KFRA 1Z5ZA 4D4JA 1CTQA 4ACBA 3UPUA 1Z0FA 1S0UA 3GJ8A 5FPSA 1X8JA 2JLZA 4Q9LA 1W36B 2WV9A 4PPGA 2RGEA 1FX0A 3CR7A 1NVWQ 2HCBA 3LX8A 1XCPA 4Q21A 1XCGB 1QHHA 1VIYA 1E1QA 1T3HA 1YHNA 2UZ3A 2AKAB 3T34A 4HLQB 3RRMA 2ZJZA 3QXXA 1NJGA 4NYJR 1COWA 5FOVA 2KJQA 2XAUA 3D3QA 4MRPA 3MG9A 4B74A 1BYUA 2YYZA 4HAVA 3B85A 4PTLA 1KMHB 1GP2A 1VG8A 2QBYA 4UXHA 1Z6XA 1MH1A 4MYHA 2G83A 4YLGA 3O8RA 3I61A 2A5GA 5DO9A 1W2HA 4R7ZA 3EZ2A 4Q00A 2B92A 3DM5A 4LY6A 2XJ9A 4AWXA 1XMVA 3B1XA 3VR4A 1DAHA 3RS7A 2GETA 5CDFA 2QP3A 1FNNA 3K0EA 2VP2A 4PHGA 3V9PA 3DMDA 2J45A 4NE2A 2ZRBA 4IDPA 4HEJA 2J7PD 3A36A 4UNQA 2CE7A 5F98A 1XDBA 3P20A 3QE0A 2QY9A 1D8TA 4RKEA 4PQFA 3K9NA 3ADDA 1T5IA 4E5UA 4NCHA 3ASZA 2QMOA 5LD2C 3L2OB 3CW2A 2OO7A 3QVVA 5AJXA 3GLFA 4N0DA 3SJZA 2CLCX 1W2GA 4XVQA 4M22A 2ZRGA 1ESMA 1IAQA 2I4IA 2H57A 1GDDA 1FNMA 1C4OA 2H18A 2XZOA 4JVSB 1CBUA 3FKSD 4ON9A 5FUVA 4DC9A 3GMTA 1G19A 1Q20A 1E9EA 2JLVA 4A36A 4AKGA 2WMOB 4RZUA 4AKEA 3A1TA 2P6RA 4H9GA 2QTVB 3FMOB 5L3QB 3QKSA 3AQ4A 1KI6B 2O8CA 3IIKA 1XZPA 4FW9A 3GD7A 4LJYA 1M7BA 2J59A 5HKKD 2WWYA 4XD7A 1M74A 4V0LA 2DWOA 2H1LA 1X1SA 5KO2A 3FPAA 2WAXA 1ONBA 2GWHA 5F9FA 3B9QA 2EFHB 4UJ5A 1E98A 1KBFA 4GRAA 4MRRA 4PQRA 1PTRA 3N2IA 4UQOA 2ZRLA 4C0JA 4PSKA 2W0MA 3IKJA 2W6JA 2WWWA 2A78A 1S3SA 1ZUNB 5EUQB 3TJZA 2UZIR 4QHTA 2OXCA 4FD2A 3X2SA 3QG1A 5AK0A 1LNZA 4QKQA 1P7CA 2Z83A 3CNOA 5IRCD 4GMDA 3TVDA 2XZLA 4B3DA 1P72A 4KSCA 5K8IA 2R6AA 4BLOA 1E1RA 3FHOA 2IS1A 2CL6X 1MO3A 2YWEA 1XNJA 2FPMA 2ELIA 3WYGA 3GQBA 2A7QA 2FNAA 2FFAA 4P31A 2H92A 3I4LA 4EJSB 4D25A 4CW7A 4AYXA 4A9AA 1ELOA 1G7TA 2XTZA 1FAQA 5KUTA 3PEVA 4HDOB 1KK3A 4KU4A 4C2UA 4OI2A 1KHTA 2BEKA 2IUSA 2CXXA 5JJLA 1QVRA 3IPXA 4L15A 2GAOA 5E3HA 1KNXA 1EK0A 1ZRHA 1X8KA 3AVUA 1CR2A 1AS2A 1JECA 2QGNA 3NKVA 2WKRA 5JEDA 1L4UA 1Q1QA 3CNNA 5D3QA 1NBMD 1FMLA 3A1WA 4QNMA 4CGZA 1EWQA 2NO6A 3IIMA 1II0A 2EW1A 1UDWA 2WJVA 4GP7A 4IDHA 1U94A 3SBEA 1W4CA 3A1UA 3TSOA 1E2IA 4DLVA 4U7DA 4E22A 5CK4A 5C46F 2EWVA 4Q4LA 4UXJA 1T0JB 2WIAA 2OBMA 2C5LA 3DMNA 3L43A 2DFLA 2JJ2A 3IQXA 4LGMA 721PA 4TQUS 1IM2A 2BKEA 3GFOA 4QC2A 3VKHA 1OLOA 1DAFA 1E9AA 1U98A 1D5CA 1JNYA 1G8HA 2D7DA 4D6PA 4FIDA 2CJWA 2E87A 3EG5A 4LPSA 2V54A 4FXPA 4M1WA 4OQNA 1EXMA 3ZQ6A 3T1VA 2REXB 3BB3A 1YRAA 2A2ZA 2BMFA 1W36C 3THWB 2G0NA 3DPUA 4D26A 4UNNA 4QNRA 1AKYA 4X8LA 2A5JA 3R7WB 1GWNA 1QF9A 4RD0A 4QM7A 2EWWA 4A0RA 4Q47A 3LWNA 5EE0A 2B7BA 4MRNA 1RKBA 2GJSA 4U02A 4ZKDA 5CDFE 1HE1C 3A1VA 1N6RA 2GAAA 3WY9A 4CZ2A 1Z0IA 4XJXA 4L5BA 5KPJA 2ZI6A 1A82A 4JS0A 4PPFA 4C0BA 3U6KA 4LJ9A 2F6RA 3N5CA 3LV8A 5FL3A 4G5GA 5C4MA 1RFHA 3C4JA 5L3RA 1E2KA 3PR1A 4RSGA 2ORWA 3VU9A 3EPHA 3GLFE 4BQSA 3U44B 3U4QB 4QHYA 1XJ0A 2C8VA 2P65A 4EPXA 3U2QA 2C04A 1GRRA 3THXA 2ZXUA 1FP7A 1P2TA 3QKTA 3L0IB 2GZDA 2QPOA 4GMXA 4NHOA 4JLPA 1AQUA 3M0EA 1Z0AA 2VP4A 2IYVA 3CF2A 1KAGA 3QENA 4HZIA 4ZV4A 1NRJB 4B35A 2J87A 3PV0A 4UKDA 4DT1B 1ZC4A 2OXRA 2WHXA 3A4MA 2IXGA 3O47A 1BO6A 3GFPA 1M2OB 3KTAA 3NDPA 2AL7A 4XH9B 2Z0MA 4PO8A 3B1VA 4BECA 3SJCA 2O8DB 1CJVC 2NPIA 3PUWA 3H86A 4Q4JA 2NPFA 4A0FA 2HXYA 3ADBA 4KFTA 3WXMA 1A7JA 4Z1MD 3Q72A 1KDPA 5FBWB 2VEDA 4V02A 5FTKA 3V00A 1SQ5A 2ZJ5A 4NONA 4J0QA 2WKQA 2QTFA 3WBJA 4EAQA 3UGIA 1CR4A 1XTIA 3AKYA 1OE0A 5CITA 1R5NA 1TU3A 2FZLA 3RANA 2QMHA 3MJHA 3LBNA 3OEEA 1YR7A 2OCPA 1B0UA 3M4YA 2W83A 1W44A 3I8XA 3WNBA 2YC4C 5SZIA 3FWYA 4KXFB 4ZCMA 1FP6A 1R0YA 1A5TA 2ZROA 1LY1A 3A8TA 2V3CC 4JLAA 1GUAA 4B43A 3ONWA 2XITA 4IFBA 3UKDA 1DOAA 2MSCB 1YR8A 5EE1A 4OI1A 1E4YA 1Q0UA 1NIJA 1Z29A 4B34A 2OESA 4GZLA 1SVIA 3PITA 2I1VB 1GKUB 3KQUA 3U60B 3CRMA 3CO5A 2ZSDA 3OFNA 2NTYC 1TQ6A 2VF7A 3TNFA 4M9QA 3JVVA 2OSBA 4IEEA 4LX0A 2NOAA 4CT5A 2ZRDA 4YONB 3AF4A 5JMTA 2F9LA 4BLSA 3QOFA 4EJSC 3HU3A 2BEJA 3ZH9B 3CB4A 2GK6A 3K09C 1UEIA 2PJRA 3GLHA 2KBFA 3OHMA 4PHTA 4B33A 1ZW6A 4RZ3A 4C0AC 2IL1A 3P1JA 2F43A 2YWHA 3N70A 4PZYA 2IYQA 5DNYB 2IS2A 2C78A 2G9NA 4OI0A 3GPLA 3AEZA 4DEXA 1OHHA 2FJUA 2AFHE 3C15C 3P4XA 2F3TA 1GFIA 1V5WA 4NKRA 5FI1B 2CBZA 4KYUA 2R44A 1HT1E 2RGCA 4RCYA 5GJBA 4K46A 1L2TA 2C2HA 4GSYA 5CIWA 3ZQJA 3R9XA 2DWPA 2P0EA 4W5HA 1TPZA 3GJ5A 3L82B 4QM6A 4UNRA 3GLIB 1XX6A 1J2JA 1EGAA 2FFHA 2VHCA 3TR5A 2O0HA 3UEJA 2I3BA 4GT1A 5CM9C 2RB4A 4C30A 3NDBB 1HURA 1Z8FA 3TUJC 1E99A 1N6NA 3QPUA 3M6AA 2DWQA 4Q03A 5TY0A 5BXQC 2RGNC 5JS8A 4W5JA 3OAAA 5FR1A 3GLGA 1RJ9B 1EG7A 1NF3A 3K0AB 2R6DA 1OYYA 3FE2A 3BBPA 1DE0A 3MGCA 3TIFA 3U61B 2WPDD 1DEKA 3X1DA 4EDHA 4KVAA 1HA3A 2LWIA 4A2QA 1C9KA 1PUJA 2ZM5A 2YJTD 5DN6D 4A8JB 3EZ9A 2IXEA 3KJIA 3MMPA 4GFDA 4TMTA 5EP3A 5B64A 1TUEA 1J7KA 2QE7D 4NTZA 4YMSA 1YZKA 1NP6A 3QY0A 2BM1A 2R62A 3QXJA 4IKEA 3WP1B 4XWOA 2IYLD 3SHWA 4C0HA 3IO5A 1P62B 2JLRA 2GVIA 1ZCBA 4NCIA 1NLFA 1KZGB 3Q85A 1KJWA 4JYBA 4XTRA 3VR2A 4MQBA 2ZJ2A 4Q1AA 4C3ZA 4NU0A 2ZJBA 1PLKA 1SVSA 4QXAA 4TTPA 1D2EA 6Q21A 1Z6GA 3C14C 2YC2C 3FHCB 3KB2A 4HAXA 1A4RA 3ZIAD 1E2LA 1WXQA 2CCKA 4M1YA 1XBTA 2PX0A 4HAYA 3ZYCA 3TMKA 2HCJB 1GNQA 1OXUA 2WJGA 1CS4C 4TSFD 2QN6A 3F3YA 4US1R 2O8BA 2ZR9A 4Q1DA 1WCV1 4P4TA 1SHKA 1XCMA 1N5JA 1TX4B 3BB1A 4YXWD 1Z2CA 4MKGA 4R2IA 2FSFA 1EX7A 1T3SA 2V7QD 1E0JA 4CVNA 4DUGA 4HUQB 2J0UA 4JLBA 4TMWA 3ZVMA 1DBSA 3MWKA 4JVNA 1JAHA 1GNRA 1NMYA 4I1SA 1RYFA 4URWR 4P4SB 4BRWA 4OI4A 2PMDA 3PFIA 1N6HA 1IBRA 4QRHA 2PZFA 4AKHA 2ZJYA 2J0QA 3W6OA 1FQJA 1P75A 5TMPA 1AZTA 4JSYA 3BD9A 3IPYA 4ILEA 3VKGA 3KXIA 1NLZA 3QF4B 4GBMA 4DDWA 1E0AA 1ZD1A 4LZZA 1XEXB 3RS5A 3VNUA 4G1UC 3SBDA 3TLXA 1CJTC 1KY3A 3BGWA 2VSOA 2D2FA 2FPKA 4G3XA 3GJ4A 4IVRA 2O8FA 1COWD 2C95A 2YOHA 1Z3IX 1E2NA 1OSNA 3QUSA 4ZCLA 5H68A 1ETUA 5JWHA 3T1TA 2W2TA 4CEHA 1KSJA 1G4AE 4B44A 4PHFA 4IFEA 4LK2A 2ZAOA 2IW3A 3I3SR 1P4SA 1S8FA 5FTLA 1FTSA 4N1AA 2JATA 1WBBA 2O8EB 3MJRA 3QKRA 4KYIB 4OHWA 4Q7KA 4Q9HA 2FEMA 4JKIA 2YWFA 1IY1A 1MKYA 4IDOA 1EFHA 3IDQA 4JKYA 4RD3A 2HLDA 3DO6A 1DELA 1TTTA 2BJWA 2HDNB 2KE5A 1WE2A 4NCNA 1SVKA 3NBYC 2ENNA 4XOIA 3OIUA 1FPMA 5J4HA 2ANCA 2EVWX 1L8QA 3LQRA 2BHRA 1KI1A 4AKIA 2D62A 1RRGA 2VSFA 1VG1A 4DLWA 1AGRA 4Q1FA 4DIEA 4AD8A 5A5GA 4M1KA 2C03A 3OIYA 5JHHB 1E3MA 1BMFA 4HLDA 5BN3A 1QHYA 4K8OA 3GP8A 5JRZA 4WVFA 1KBEA 1N0UA 3LD9A 2BBOA 1II8B 1OXVA 3LO5A 3RHFA 1Z63A 2YWGA 2ZJAA 3C7KA 5DE3A 3IILA 2IBMA 3K9GA 1ZP6A 4US2R 5FPTA 3AF1A 3HJNA 1ANKA 5KYKA 4BPBA 3Q7QA 1G4UR 2QP9X 2ORVA 3FGNA 1K5DA 1NSTA 4QGHA 5FUXA 5JS7A 4DDVA 1CIPA 3JVUA 2ODBA 3UIEA 4XD7D 1H8EA 4A15A 2GBLA 5FOWA 3U6BA 4POAA 5TDHA 1OKKA 5DSZA 3BXZA 5KDOA 4IOMA 1JQLB 4NYIQ 2X8AA 2X19A 4LJ8A 1T4GA 4HLUC 3AKCA 1P60A 2W6JD 2GJKA 3D7MA 3SOPA 1VCIA 3AVTA 4RFVA 3CLVA 1N5LA 3VFDA 1S96A 5EZ6B 1ZIOA 2WWFA 2WWIA 5GJCA 1KY2A 3KY9A 3PEYA 5CJ2A 1Q12A 1E2JA 1W1WA 4A82A 2ZRKA 4WBSA 3WYFA 1IXSB 4A8JC 1N3BA 4MDFA 1P6XA 2IYYA 4MUBA 1HT2E 4HSEA 2CLSA 3AKEA 1XTSA 4A1FA 2B21A 4IVQA 4M4SA 4B76A 4MYTA 1XA6A 2PH1A 3TGPA 2CNWA 1C1YA 1G7CA 4GL2A 1G9XA 2IXFA 2EYUA 1Z6YA 2VP0A 4R98A 1I2DA 2XSZA 1F5NA 4WZBE 3HR7A 1NN3A 1F2TA 4RD6A 5A4JA 4ZI2A 4Q4AB 2GF0A 1YU9A 2Q21A 3BB4A 5FH9A 1YZUA 5JBQA 4ZO4A 3EWAA 3U3JA 3KQKA 2IA5A 3GJ7A 3KKQA 4DLYA 2P2LA 5AJZA 1JR6A 3DOEA 4Q4HA 4ZDJA 2ZPTX 4EPRA 2X77A 5FBRB 3ZVLA 1ODFA 1V43A 4DXAA 1II9A 4PPQA 2ZSBA 3ICQB 4FMDF 4OQXA 4A4DA 4JL6A 1I4TD 1AZSC 2IYSA 4IXMA 4JLJA 3B7GA 3LDAA 4D81A 3WNCA 2F55A 2JEOA 1Z0DA 2ZU0C 1Z22A 1Z07A 4N0EA 1X1RA 4QBHA 3H1TA 4XWAA 2P3SA 1CULC 4A2PA 2ZRHA 1KOFA 2QROA 4Q48A 2GXSA 5FBQB 3ZS8A 5BN4A 1N6IA 4YMTA 2Q9BA 221PA 5P21A 2GILA 5FOUA 4DKXA 3AVOA 4NMMA 1DAIA 4JVLA 1Z28A 4C7OA 1KKMA 1UKZA 2VL7A 4MYUA 1R7RA 3W34A 1E2FA 3ND9A 4LHXA 1G7SA 2J7KA 4KVGA 4W7SA 4D0NA 1Y3AA 2YOGA 5DYIA 3BJIA 2QQ0A 4NH0A 4HUTA 4PX9A 4FKDA 1KIMA 1DG3A 5BN5A 4DLXA 1W0JA 1GL9B 2EFGA 4E07A 3RRYA 4L16A 2OFWA 1P73A 2BOVA 1UAAA 2OBLA 5CJPA 4IDNA 3VKWA 4M8NE 4EFNA 3WMEA 2NO7A 4TYPA 1JEDA 1KI9A 2WMNB 4QJ4A 1ZCAA 4Y0VA 1OV4A 4DLSA 3UATA 2XNSA 3HU1A 2GTPA 5EZ5A 1GOTA 1KDTA 2XB2A 1XD2A 1SXJB 4BFVA 4Z8XA 1Q1BA 4URZR 1ZJ6A 3VR1A 1EFUA 4X8OA 4DCVA 2B7CA 3RSOA 1JPJA 2CL7X 4FMCF 2F1IA 5C2JB 3FOZA 1E69A 1OYWA 5DLQC 3I62A 5J4KA 2W2XA 1AA9A 4JL8A 1RVDA 3VR5A 2D06A 3AVVA 1W0KA 2PT5A 4JLMA 1NIPA 3BJIC 3MUFA 4WZAE 3ECCA 4B3BA 4MGYR 5G3YA 5IF9A 4P0TA 3WHKA 1U81A 2MMGA 4DLRA 1G3IA 1YZQA 1HV8A 4EFMA 2XZPA 1EFTA 3CPJB 3HPRA 5L3SB 2Q6TA 4M1TA 2ZR0A 3D8BA 1NVXQ 4BZXA 1BOFA 2FGKA 3AF2A 1LVGA 1Z0KA 4P3YA 3B60A 2XXAB 2NZJA 2WJJA 2GZHA 5FOXA 4HB4A 3K1JA 1JB1A 1VDZA 2ZYVX 5JSZB 4TYWA 3PUZA 3ETLA 1LS6A 2ZYWX 1D6JA 2JJ1D 3A58B 3IUYA 2P67A 1KI2A 1CKEA 4RD1A 1UM8A 2H8KA 1S3GA 1R8QA 4NYMQ 5G3ZA 3SN6A 5BW8A 2G88A 1J8MF 4Q1BA 1JR3A 3C16C 5CYPA 4MKFA 3I5XA 4BWYA 4MRSA 4FN5A 1N25A 2QU8A 3OE7D 5DHAA 1CXZA 5FTNA 2ANBA 2WVJA 3LAWA 2WJHA 3ZD7A 1RFLA 2O5VA 2QEQA 2JIZA 2XNDA 2ZYUX 2W58A 1DS6A 1FTNA 3GFTA 2XX3A 2GNOA 3ADCA 1YZNA 1E79A 1TEVA 2ONKA 4TLEA 1OW3B 4C0SA 1VCMA 1ZUHA 4TMVA 5FTMA 3OESA 3THYB 1IXRC 1CJKC 3KKPA 2ATXA 3AVWA 2AX4A 4ZIRB 2VA8A 2VYFA 2ZREA 4QBIA 2BKUA 3C8UA 4KHZA 1WB9A 1UDXA 3E5HA 1G5PA 1P2VA 1G291 3EIHA 1G8PA 1XMJA 4G5QA 5GADl 1R79A 3KJGA 3GJXC 3BORA 4OYHA 1NMZA 2QP4A 3A6PC 3FB4A 1KO1A 2CDNA 2GA8A 5F2EA 1ZM2A 4MGKR 3UANA 3B1YA 1F60A 4N3NA 2HT6A 1ZNZA 2ZQ5A 2QT1A 3UK6A 3WHLA 1KI7A 1P9RA 2G3YA 3SI7A 3PVSA 5AUPB 3CKLA 4Z8YA 1NL3A 1G7RA 1WQ1R 2FWRA 3CRW1 3LBIA 4DEYA 1ZBDA 1ZU5A 2V1XA 1CR1A 2B8TA 1XRJA 1KMHA 4LC0A 3CX6A 3CONA 2F7SA 2IT1A 3F0TA 3KUCA 2FH5B 5E95A 3B82A 5KSZA 1IY2A 1GVNB 4ASUA 2QAGB 1J99A 2HF9A 4CEIB 1NSFA 3B1ZA 1NG9A 4FCWA 4RCZA 1N0WA 2CMKA 3OAAD 3X1ZA 4B6FA 2VP5A 4WW0A 2CK3A 4KI0A 5KOYA 2ZJOA 3K70D 3P26A 5D3MB 2DY1A 2VLIA 2BJVA 3AKDA 1GTVA 4D0LB 4GP6A 3X1XA 2AD1A 3AUYA 2HJVA 5IK2A 4FCVA 2Q0HA 1E2MA 2GCOB 3RVBA 3U3RA 1KK2A 5LB2A 1YE8A 2RHDA 1LB1B 2Q9CA 3NHAA 1XXHB 3ASYA 3QF7A 1DADA 2WSSA 4HB2A 5FPHA 3TE6A 1R5BA 5E4FA 3CM0A 2CL0X 3VHLB 3A37A 1G17A 3RABA 2Z5FA 5JCZA 2I1QA 4JLOA 2GRJA 4XVRA 3SYNA 4P33A 5TB5A 3KZ1E 2WIBA 3C5HA 3BWDD 1BS1A 4HLCA 1RIFA 3KXLA 3RS2A 1MOZA 1LF5A 5AJVB 4URVR 2ERYA 1NI3A 5L3QA 2OEPA 1KI6A 1SXJC 1Z08A 1IONA 2KBEA 1KMQA 2NO0A 1XEFA 2YINC 4JMPA 4TT3A 2DPXA 1HEIA 3BE4A 4L9WA 4XIGS 4KODA 1ZINA 2IHYA 4B2PA 2HYDA 1TEXA 3VR3A 3O8DA 4HYYA 3T15A 1MO5A 2OCYC 2OCAA 4F7WA 4EIWA 1G5RA 3BFKA 1GILA 2FDCA 4ZDIA 1R8SA 3L0SA 1W4BA 3I32A 3Q5DA 4B48A 4C9BA 4RFSB 2XGJA 3AUXA 1KI4A 3AGQA 2E73A 1MABB 3QXSA 3UWKA 3U3KA 3EA5A 4TL6A 3EC2A 1JR3E 4AURA 3V4FA 3CRRA 3NBXX 1TU4A 3U3OA 4OQMA 5E7IA 3EAQA 3WRXC 2IWHA 1AKEA 5GJWC 5JECA 1MRNA 2NMVA 2ZJ8A 3CPEA 1T5LA 3TUZC 1GRQA 2JDIA 1PZNA 1O3YA 2WOOA 3FMIA 5HTKA 2J7PA 4F4CA 1K8RA 1E0KA 4D4MA 5KNCA 2G1JA 2QQEA 4EJSA 1ZIPA 1ZNWA 3K09A 4DLUA 1ZNXA 1Z2AA 5GVRA 3LXXA 1S9HA 1J90A 5FUWA 2NIPA 2OV2A 1N5KA 4M1OA 1OH7A 1KSHA 1IN6A 1UPTA 2CEAA 2ZRFA 3W3AA 4M9SA 5AJWA 1QZXA 3CZPA 4X8MA 1FARA 2FN4A 4G5RA 4C0KA 1QG2A 2Z4RA 2GJ9A 2OLJA 2KWIA 4S2EA 4YC7A 4TLBA 1KO8A 3SEAA 4D4LA 2XOKA 4UJ3A 1EWRA 1E9BA 2ZETA 4BFZA 2PMKA 2ZRIA 5KSYA 3QSYA 3KDSE 2IS6A 2GK7A 4PC7A 5EE9A 2WWHA 3E70C 2OILA 4ZDKA 2JA1A 2IYUA 2ZS7A 4RZ2A 1CR0A 5SZHB 2E1RA 3WP0A 1VYUA 4EQ6B 1Z47A 5KNDA 5B30A 2TMKA 4JLKA 3SYKA 3KFXA 1VMAA 2HLDD 4NP6A 2HF8A 4CF7A 2GXAA 4ABYA 3OEHA 1E96A 3U7EB 1NNEA 5J4YA 2JLUA 4LBZA 2ZUBA 2PCJA 1ZUIA 1AGPA 5HZKA 3ZGXA 1QG4A 1NN0A 4ARZB 2G1KA 2RGNA 3UEYA 1EX6A 2KSQA 3AP3A 1PJRA 4US0R 3F5FA 3KXKA 2FGJA 1G1MA 3THWA 3CWZA 4M2LA 3CBQA 4OHXA 1QHNA 2ORIA 3TH5A 2ODEA 3KJHA 4ZKEA 5EP2A 3R7WA 2DR3A 5KNBA 3K0CA 3VNVA 1VYVA 3QI2A 3HDTA 4KO8A 1SVWA 5J4VA 2QAJA 3B9PA 3H84A 1AK2A 1IHUA 4F38A 4G0NA 3RC3A 3UG7A 1DTSA 2FFQA 1U0HC 2WJYA 5JLJA 2OAQ1 3IEVA 2P5TB 3R8CA 4L9SA 4WZ6A 4TL7A 1R0WA 3UMSA 3W8NA 4LJAA 3S1AB 5JRJA 4URXR 1P5ZB 2PLRA 4Q9KA 4DIDA 1N2CE 3U44A 4DBLC 1OKKD 4DZZA 3U4QA 4PC2A 4TTRA 3U5ZB 4BGDA 1JXMA 1OH6A 3O8BA 4LV8B 4DSUA 1US8B 1HYQA 2EQBA 3K0FB 4ESVA 3AVYA 1VCNA 3CIOA 3TQFA 3ND8A 421PA 4R9UC 5BWMA 4DT1A 2GESA 4V0NA 5HE9A 2RGGA 2J41A 4HZUB 1R2QA 4LYHA 2BV3A 4EPWA 4F92B 2YV5A 4DSNA 2HYIC 3K0CC 1NBMA 1KI3A 1M1YE 3CUEF 3J81k 2RCNA 2PEZA 5DI3B 5FPYA 2O8DA 3LLUA 4URUR 4BFTA 2AR7A 4PAQA 2YOFA 1OJLA 1IJFA 2CNWD 3W90A 1HE8B 4TZ0A 1EFCA 1EFRA 1D2MA 2BCJQ 3LBHA 4OHYA 2RH5A 2MSDB 2BBWA 2XSZD 1UF9A 3AH8A 4PSAA 1U2RA 4Q19A 5KTYA 3ZVNA 5EJEA 2ZANA 5FTJA 1OFIA 4IVPA 1FL9A 3BS4A 5AUOB 1T3LA 3CF0A 5EXPA 4P32A 2FSIA 1U0LA 4FMDB 4Q66C 5FOTA 3KQHA 1HQYE 2SHKA 2CLDX 1AS0A 1XF9A 4ZDWA 4RKFA 2GEDA 2IYZA 1XTRA 2GEVA 2ASEA 3REGA 1Y8FA 4HATA 3R20A 4I1UA 3SFZA 3NBFA 3QEJA 1GM5A 4GOJA 4LWZA 5E7JA 5BYJA 5C4GB 1MR3F 3FMPB 3Q9LA 3DZ8A 5DGXA 3B6EA 2N46A 3PG5A 2ZRPA 1BH2A 1WF3A 1F2UB 1J70A 1LS1A 4JJZA 1ZMXA 1WMSA 2VH5R 4PFSA 1DG1G 1YR6A 1ZM9A 2BIFA 3OIWA 3EPKA 3BFXA 3LW8A 1M7GA 3NVAA 1E4VA 1AQYA 1R6BX 2YHSA 1I4DD 2D7CA 5CK5A 3F8TA 2BCGY 1UBEA 2O52A 2OG2A 3DL0A 3NHBA 2QG6A 4K81B 4II7A 1JXOA 3MCAA 1FW6A 2Q3FA 1P3JA 3T1QA 1QHGA 2FFBA 5ELXA 2ZVPX 1WDTA 5EP1A 4JSTA 4LHWA 3UXMA 1IOZA 4PSVA 1D9XA 4DHEA 4F4IA 1EESA 3K9HA 3H4MA 1FQKA 3BFVA 4PAMA 5H1YA 1LF0A 2E9SA 5DI9A 4DCUA 5EQTA 5ANRB 1E1QD 5EE5B 5CB6A 1U9IA 2V6IA 4B75A 5LPNA 2QNRA 1W49A 3CRQA 1ZYUA 3NIBA 5IHPA 3EPLA 2CHQA 4KAXA 4KLZA 2Q3HA 3AVQA 2VIIA 2F1JA 3LRPA 3IBGA 3QXHA 1TF5A 2NZ8A 2BDTA 2RKOA 3MAAC 5AR1A 4BZQA 2DB3A 3CF6R 4Q7JB 3ZD6A 1L7VC 2X2FA 2JGNA 3EZ7A 5JWOA 2AWOA 4MKHA 1VHLA 3EIEA 2B6HA 4FMCB 5DYGA 4NYIR 4WOPA 4R2HA 1FFHA 2C99A 2ZSFA 3W9YA 3BC1A 4WIAA 3L8YA 3G0HA 2GKSA 1E9SA 4BE7B 2QL6A 3GLIA 1RW4A 1Z83A 3DOFA 2RGBA 1OB5A 4LHYA 2AXNA 2VHQA 3I72A 2P5SA 3L0OA 4OK3A 4V0ME 1Q3HA 3A4NA 4PZLA 5DIFA 5HCIA 5LBIA 2HT1A 2VHJA 2BC9A 5JZVA 4PR0A 1AM4D 1Q1EA 2YUUA 5FBLB 4TLAA 1S2MA 4IHQA 1RJ9A 1XP8A 2PX3A 3K0AA 1E32A 5FFMA 2FU5C 3MFYA 4HLUA 3QBTA 1VTKA 2JLSA 1U9IC 2P6NA 2Q9AA 3FDIA 3TSZA 3VMFA 2ZEJA 4TL8A 3CXLA 2QM7A 3SFVA 2AHOA 3U3MA 4LHZA 4DDTA 3SC3A 3ZZ0A 2VRWB 2RHMA 2QRNA 3T1OA 3TW4A 1E9CA 1YJ5A 4A8JA 2V4ZA 3I92A 3PEUA 4TQAA 2JLYA 2WWXA 3K8YA 4QJ3A 1OPXA 4JL5A 1PLJA 3NG1A 1FUKA 3SHFA 2IYWA 3UFFA 2DFNA 1NBME 4LBVA 4AG6A 4C4PA 4EPTA 5FL7A 1SGWA 5B57C 1AS3A 2VSXA 4M53A 3UGLA 4B3CA 4M1SA 1FX0B 5LD2B 1TADA 1SVOA 1QHHB 4GDFA 1JR3D 1Q1ZA 2WJIA 2LKDA 4HB3A 2EFDB 4B3GA 3TK1A 3VHXA 2GXQA 1QDEA 1Z6AA 4IW3B 2YNMA 1OIVA 1TF7A 3RS3A 3PIRA 1P2SA 3EARA 3W8RA 2XNDD 3ICEA 1SZPA 3HYTA 5K8UA 2NG1A 4IEIA 2QBYB 1E79D 2ZYTX 2DYKA 4HUQA 5TARA 5LB4A 1LTQA 2WZQA 2ZRCA 4QHSA 2HXSA 3LH5A 4RVCA 4YDHB 4MGIR 5HCNA 1E1RD 4TLCA 2OLKA 4B71A 1E2QA 4P4SA 4KSBA 5FUYA 5B2ZA 4C0LA 1OIWA 1OH8A 4OK5A 4FMBB 1IN5A 4NZYA 5KPDA 3GEHA 4KJZA 5KU1A 3AM1A 1DPFA 1QHSA 4JLVA 1W36D 1D2NA 1FUUA 2R65A 4LJ5A 3QF4A 1DO0A 1RPZA 1UBGA 1XEXA 4G01B 4TTQA 1JALA 2FMXA 3GLFB 3Q5EA 4YMVA 1KO5A 3MD0A 1SKYB 1N6KA 4GZMA 4GI7A 1TAGA 2G0TA 3PEWA 4Y0AA 2OUKA 2KB0A 4OBEA 1M34E 3UMRA 3E2IA 1ZM4A 5KDDA 3AV0B 1G6OA 1OFTA 3P27A 2XJ4A 4WXPA 4HAWA 2VBCA 3SQXA 4F93B 3MWJA 4ASUD 5CIQA 1XWIA 2H5EA 3KJEA 2IUUA 3QKSB 4IOLA 2O8CB 4BLTA 2O8EA 2J46A 2JJ2D 2CK3D 1NG1A 3FFAA 4U5XA 1R0XA 1XEWX 5H70A 5G40A 4GNKA 2P6UA 3RS0A 4DJTA 5H8WA 3FVQA 2QPTA 3V4RA 4KV9A 3ZIAA 5F3WB 4Q9IA 2QENA 1HQCA 1WRBA 2JLQA 5IK2D 1E2GA 1S4QA 1X8LA 2OZEA 2UKDA 5LDDC 3TUIC 4O2RA 3NH9A 3GLIE 2FOLA 4A2WA 1BYIA 2ZRJA 2V7QA 1B23P 2PZEA 3BOSA 1ZD9A 2ONJA 1FOEB 4B2LA 2AFIE 3SE0A 2QTHA 3JZAA 4DLZA 2HUPA 1UJ2A 1QVAA 1LFDB 3OIVA 5JFGA 1II8A 2JLXA 1E9RA 2PT7A 1HH4A 1IN8A 4LI0A 2VP6A 3T61A 3G82C 2AN9A 3BH6A 2OT3B 3BRWD 4XSHA 3W6NA 1R0ZA 4NYMR 1PV4A 4Q1CA 4QL3A 2V6JA 3SDZA 2WKPA 1MRSA 3CRVA 4LHVA 1CLUA 3WBKA 2DFKB 5AWFC 2D4HA 2EYQA 2W0SA 5TVKA 2PL3A 4TL9A 1KO7A 4TT3D 2J0SA 3SJAA 3SYLA 2ECKA 1G3QA 1AJEA 3T12A 1YVDA 1Z6TA 1OXTA 3GEEA 3C5CA 4TYYA 1SHZA 2MMCA 2GJAA 5J47A 2C96A 4OKSA 3B13B 4P4UA 3LY5A 2WICA 3RWOA 1Q21A 2ZS9A 1NY5A 1U0JA 2ZE7A 1F3OA 2Z43A 4QFMA 5JEEA 1LV7A 1M8PA 2FX3A 2JAQA 3CH5A 2WSMA 4OHZA 3QBVA 2R9VA 2MSEB 4XVUA 4AK9A 2GEUA 2D2EA 3CPHA 3QNUA 2DFTA 4M1MA 4AYTA 1PLLA 1NVVQ 4TMXA 4HB0A 2VHTA 2ODNA 4NCJA 4B73A 4PANA 1H8HA 2IX3A 2GHIA 4BZPA 4V0OA 4S35A 3D6TB 5FI0B 1T0HB 1IY0A 2YZ2A 4KBGA 4OQLA 1XJQA 4RD4A 3VTKA 3FHTA 1PVOA 1CF4A 2FV8A 2FF7A 2BVNA 1N6OA 3N2EA 5KSPA 2JDID 2OCBA 2IF0A 2CJWB 1GL6A 3UG6A 3SR0A 3QXCA 2W6IA 4AIIA 3OEED 1VG9B 1OH5A 3L0PA 3CX8A 4KITB 3MWYW 3ZS9A 5BQ5A 2BWJA 2QM8A 4QGAA 3VAAA 1VHTA 4M9XA 4DDUA 3A4LA 4ERNA 3GJ6A 2D74A 4I99A 2GDJA 4Q4AA 5KSOA 1E2EA 1KJYA 3RAPR 4JBWA 4A0HA 4BFYA 2ZE8A 3A1SA 3IGFA 4IJMA 4GOKA 1UBFA 4LDJA 2XOKD 3IIJA 1VG0B 3EZ6A 3Q8XB 3TVTA 5K8LA 3LVQE 2IS4A 2UVQA 3WMGA 1DAMA 5SZJA 3K53A 1YZGA 1OXSC 1QBKC 3WMFA 1RRFA 3RNLA 3VU9B 3TAUA 3B5JA 1VYTA 4B3XA 3OFND 3RYTC 1T9HA 2IEZA 1U90A 3QJYA 3OEHD 4JT2A 4KLNA 4NYJQ 4PZZA 3EZFA 1T6NA 4C2TA 3TBKA 3THXB 2ZITA 2RAPA 2YVUA 4BUJA 2ZRAA 3LA6A 5KDLA 4AYWA 1KJZA 1FMJA 4C0QC 1CP2A 4W5WA 3UMFA 3GJ0A 5J5CA 1IXZA 3AP2A 3ZLJA 1TQDA 4NDZA 2ATVA 2R6FA 3CWQA 1L4YA 3KTAB 1ZD8A 2ZU6A 5DHFA 1VPLA 3WYAA 4L9MA 3KKMA 2BMDA 2VHUA 3BERA 3IO3A 4O2LA 1OB2A 1OIXA 3PJRA 4Q4JB 1WA5A 3H2YA 2H17A 4OL0A 1P9WA 2NQ2C 1JJVA 1CU1A 5BYKA 4MYCA 4PAOA 2CHGA 1XB2A 2C98A 1OHHD 2R2AA 4WAUA 4O3MA 4LC1A 2FZ4A 2WBLC 4OK6A 2FE4A 3T5DA 4MA4A 2QORA 2AK2A 4LUCA 1TL7C 1DAKA 1XZQA 4ESHA 1GKYA 1CJMA 4ACAA 4LV5B 3M1IA 1S1CA 2PBRA 3G5UA 4DSOA 1NLYA 1D9ZA 3B78A 1SXJA 2CCJA 4MKIA 5JI3E 1E2PA 3R9IA 3X1WA 1T91A 1W4AA 5EE3A 1Z0JA 5AJYA 2DHRA 4OHVA 5IT5A 4QG7A 1PTQA 3REFA 2C9CA 4ITRC 2CCGA 5AUQA 2REBA 2XTNA 3PXGA 1YRBA 4DCSA 5GVSA 5CLQA 5EUMA 2ROWA 2Q3MA 2F3RA 3QIAA 1S9DA 3KUDA 4BRUA 1YR9A 3AVPA 2OFOA 1GSIA 4KBFA 2AXPA 3K9LA 4JLDA 3RS4A 1XEWY 1O87A 4AG5A 4Q7MB 1QHXA 3HP1A 1N6PA 1EFRD 4CDGA 1TNDA 2WWGA 4B32A 5L3SA 3SQWA 1W5SA 4B6DA 2IK8A 2QA5A 5FBVB 5M04A 4CT4B 2FNFX 5CM8B 2X2EA 1OXXK 5KHOC 5G53C 5JWRA 1UADA 2IYTA 4RJLA 2OM2A 5EXXA 1WBDA 2OBNA 4YDSA 2XXAA 3GLHB 3W3ZB 3RSLA 1G3UA 4PO1A 4QBGB 3CZQA 3VQTA 2J0VA 2WAYA 4Q01A 5JSZA 1G6HA 1N5IA 1OT3A 2F43B 2QT0A 1E2DA 3B2EA 4PXAA 4ZPXA 2Z6VA 2OAP1 4DCTA 2J3EA 2N1BA 1HY3A 2ODWA 2ZI7A 4LRWA 1G8GA 1DO2A 3MLEA 3KQNA 2OE2A 3K0SA 4LV6A 4AI6A 1XD9A 1KYIA 3QQ5A 4H1UA 2CHVA 3WRYC 1GAJA 2QI9C 2ZI3A 1JBKA 4YMUA 3TR0A 2GZAA 2V1UA 4DUGD 3NC1C 4LBWA 4FCTA 1E6CA 3UGDA 1P9NA 2FEOA 3BH7A 521PA 2QZ4A 3HPQA 5E7MA 4DWJA 1R10A 1SKYE 3SZRA 1X3SA 4B47A 1RYHA 2ZSAA 5HPYB 2PZGA 3DVLA 1A2KC 2LKCA 4JBYA 3P32A 1Q22A 3L8ZA 3THYA 3MWLA 1W5TA 3AVXA 1GZSA 4ZIRA 1FZQA 3GLGB 2ZR7A 4YMWA 3GJ3A 3THOA 3K70B 1A1VA 2ZE6A 2F9MA 4Q02A 1SVLA 1KTVA 2H7VA 3DKVA 4NCKA 1Q3TA 3BIFA 1U99A 2ZE5A 4L8GA 1ZNYA 2BBSA 2Y8EA 5CLLA 2ENZA 5L8VA 4F4JA 3RRZA 4Q1EA 3WNDA 1CRQA 4QGFA 1Q44A 2AD5A 1ZC3A 2CVHA 4Z54A 3HU2A 4PHHA 2LCFA 5AUNB 2O0KA 2CVFA 3EWSA 5JHGB 2NO9A 3FKSA 5TXGA 4OQFA 3DM9B 3LXRA 2IWRA 3NC0C 2DB6A 1NN5A 2V55B 3NTUA 4A6PA 4HAUA 2GJ8A 2PJZA 2QAGA 3FMFA 4CEIA 2N42A 1HUQA 1KDRA 4KFSA 3EIQA 2VPPA 4JYCA 3LLMA 5DISB 1G20E 2BMJA 2JJ1A 1KK1A 3NEJA 4Q5IA 3PUXA 5EXTA 5HKKA 1NKSA 2OFXA 5D3MA 2O8BB 5IDVA 3RWMB 2GVZC 5J4LA 1MT0A 2IEYA 2R8RA 2ZI4A 3NWJA 4LJ4A 4XSGA 2W00A 3OE7A 4B3FX 4YQFA 1P2UA 2GCOA 2G6BA 2IC5A 4PC3A 2J0UB 4M21A 1BMFD 1XXHA 121PA 4TWZA 1SXJE 2QSZA 4PC1A 2J9RA 4W9MC 4JBXA 3SNHA 3FFBA 5HR5A 4QJ5A 4V0MA 1QRAA 1XPOA 1E94E 4PO9A 5GJVC 4JVMA 1Z06A 4KFUA 2REOA 1I4LD 3AGPA 4JZKA 4HDQB 4TN1A 1JEEA 1XD8A 5FL7D 3RRNA 4BFSA 1DVRA 3PUVA 4TYQA 1G16A 2QAGC 2R6GA 1H8ED 3EASA 3EPJA 1SVMA 1ZM3A 1G5TA 1NMXA 2O8FB 1M6NA 2H16A 1UEJA 1E0SA 2DCUA 1T8TA 2VF8A 3O8CA 1IQPA 1W46A 4Q18A 1TF2A 2FG5A 3BH0A 2GVDC 2WTUA 4UNPA 2Z4SA 1DAGA 2QUZA 1XJCA 1ZU4A 2AK3A 1F6BA 4QOSA 4BLRA 4CEHB 2F1RA 2QMUA 3T06B 4X8HA 3DDCA 3IBYA 4DLTA 3EA0A 2IUTA 5HE8A 4RFSA 3QKRB
chains in the Genus database with same CATH superfamily
3JARB 1SELA 2CWGA 1VJ5A 1U0BB 1D1SA 4TLDA 1K5PA 2OBYA 1ADYA 1ZVQA 2ZS8A 4G9BA 3UOEA 3C3XA 1NTOA 4OAOA 4TS3A 1U3FA 1GGNA 1L4FA 2HFJA 1P7ZA 1WPQA 2WRZA 3AEXA 3DWIA 3WGGA 4CM6A 3EUEA 3QEOA 2OD2A 4RTJA 1C3OA 4YT2A 1MJGA 1G8YA 4IDFA 2HJWA 4BBJA 1TRHA 4RMNA 1VA5A 3LF1A 1QIKA 4P53A 4C04A 1RWVA 3HYRA 4FWIB 2YDXA 1U7UA 4KRGA 4MITA 3GLTA 2H1FA 1TMOA 4LPKA 4PXSA 1U5KA 4D9CA 1UOEA 3SC2A 4EHIA 3LC2O 3QITA 1J33A 3ODGA 3WHIA 4FWTA 2BBTA 3GPBA 2HUNA 2VK1A 3VZBA 2V3VA 2QE6A 4BASA 3T5GA 4KACA 3ODPA 3ZDQA 3ILVA 3F5QA 3WL8A 5DN9A 3FTPA 2GBGA 3MGAA 2HJGA 4ZFNA 1UC5B 2H3HA 2QSYA 2BFOA 4MVXA 3LKBA 3K8OE 3D8UA 5BWBA 2JASA 4CETA 1Q2UA 4LYJA 2IHVA 2B2CA 4BNLA 4RQAA 1NXXA 5DCUA 2ACVA 2I3ZA 5A6SB 2CUTA 4QOEA 5EIFA 4OKIA 1KSFX 2WB4A 2NO1A 5J2TF 1K3FA 2EKPA 3LNCA 1R12A 1KO4A 3DFKA 3OA0A 1FFGA 5BR8B 2XD4A 1T1SA 1VKJA 1W7AA 1F8XA 1OF1A 4P36A 4WZAB 1IBSA 2D13A 4EI9A 5DH9A 1W4RA 3ZLBA 3C6KA 2FPLA 2W6MA 3CWCA 4NX2A 2JJ8A 2VP9A 2P41A 3E61A 3IJRA 3LYLA 1FFCA 1PR4A 4IP0A 4HNGA 1IOLA 4MI9A 2ILVA 3BSSA 4P4LA 3U09A 1T9DA 3EXAA 2OSVA 3MWFA 3CX7A 5IJAA 2E4ZA 4LX8A 1CY6A 1NWHA 2YJ3A 2IRWA 2Q8PA 2W5UA 4ZREA 5JUWA 5K8TA 3E81A 1KF0A 1I2BA 1LI4A 3BK7A 2SGPI 1NY6A 1NW9B 1MPTA 1XZNA 2R00A 3TDKA 4E09A 3AR6A 5CDFA 4CEJB 4QGGA 2IJGX 3DBHB 3VPCA 1XPUA 1QK3A 4C5BA 5BQPA 4JOSA 3KSZO 4BEBA 4F11A 3ACCA 4G0MA 4YIKA 1FMFA 3BAZA 4GKAA 1GXSA 5EP4A 3EW9A 4I2NA 3P0RA 1IMOA 4J49A 4R9VA 1KE1A 1GKKA 1NVEA 2AG0A 2K5UA 3ZTWA 4D82A 1CUBA 2BHNA 3OA2A 3TSWA 1G18A 1TUIA 3W06A 3R0QA 4QLBA 5LP6A 3R5XA 3KFVA 1UOQA 3AILA 5AIAA 5JY1A 4N8EA 2OHFA 4TZ6A 1O6CA 1LCIA 1VKNA 1F2TB 2C9ZA 1I2MA 2OOSA 5D3ZA 1O4VA 2H1HA 4DRYA 2JH3A 1KOJA 3R8FA 2VJQA 4RPHA 3PPIA 3QTLA 4EZEA 4M98A 2DPYA 4F0JA 4IIEA 2NSDA 2WYWA 4AN4A 2PE5A 3B20A 2PUCA 1VL8A 4DMGA 5HWSA 1TBNA 2BP7B 5HMMA 1A0OA 3DKPA 4Z9XA 3V8EA 1GZ5A 2DT5A 4GX0A 2XB9A 4IMPA 2I1LA 3IPCA 1MO4A 1XU4A 3U37A 5FYDA 4XYLA 2W6CX 1XE3A 2OMEA 1ENYA 4LYGA 4F91B 4OLJA 1A97A 1L1RA 3RC8A 2ZJ6A 5A9TA 1H8HD 4NFLA 3L8HA 5EZSA 1FF9A 1U1GA 2A14A 3D8HA 1W87A 1N3LA 4GR4A 4CQNA 1E1CA 1BE1A 3T7SA 2Q1SA 3P4YA 4JWKA 3NIGB 4FKMA 2XWSA 1MO6A 4P7JA 4PQYA 3WISA 3WNZA 1DC8A 1NUQA 2QMEA 5BN4B 3PLAE 3DPIA 2PO7A 4PPNA 4KUEA 3WXBA 1QFMA 2DLDA 1FU8A 1XMSA 3JALA 3QVWA 1VJCA 2Q46A 1QUEA 4GM4A 4UNSA 4WEOA 1S1MA 3RSHA 4QBFA 3UHPA 4D0GA 1KDOA 4K9SA 3KKKA 1MOSA 5CYOA 4G41A 1F48A 4NFHA 1P1BA 3ZGZA 4ZCTA 4MRVA 4OX9Y 2V7BA 1IUPA 1J4AA 3QVMA 1XT6A 1E7QA 3TKLA 3ZI0A 5DNUA 4XTCS 2VPWA 1FP2A 1TQ2A 2W6PA 4W9NC 5U9CA 2D6FA 4C2AA 2ZSEA 4J90A 4UCFA 1VGVA 1RPTA 3LX5A 2HPHA 3RK4A 4LRSB 3E48A 1CIJA 1S89A 2L42A 4ZI7B 5FR2A 2UUBB 4NLLA 4MS1B 4EGJA 5DT2A 1KMCA 3X1YA 2HIGA 5IT0A 4KVZA 4MVJG 1P77A 3AR2A 5BN5B 3UWOA 1XFAA 3BRCA 2CSXA 1X4SA 4YI5A 3NT4A 3QFCA 1Y8CA 2JIZD 2OBBA 5ECYA 1M7HA 4TKUA 2OCGA 1X1EA 4BYGA 5F9HA 4NG5A 5HF9A 2UZ0A 3W2EA 1HFKA 4A73A 1XQ6A 5I7VA 2ZYRA 4L4UA 1Z3CA 5BV0A 1M5UA 4HGNA 4FP9A 3Q15C 4ZCIA 1N2SA 3N0RA 5AICA 3O1HB 1JPNA 4ID3A 3PGVA 3TBHA 3KPVA 1KY5A 4PZEA 3A10A 4JUCA 4O4IF 4O6VA 2QOEA 3O74A 2HMWA 1QP4A 1T2UA 3AHGA 4WXMA 5AFSA 4QATA 3KETA 1NSYA 3DTVA 5AXBA 4MW4A 5KX5B 2IHZA 2Q0QA 3DE2X 4MV8A 4QAJA 3K9QO 4RHTA 3RT7A 4RL6A 4JUFA 2XAAA 4U00A 1TFUA 4KKXB 4GPTA 3BF7A 3ZBTA 4DB2A 3TLBA 3K9FC 4MGEA 1GT91 1Z82A 2RAUA 3SU8A 4ZQHA 2VRBA 3IOEA 4EW6A 2NUBA 2VQ6A 3C41J 3V1KA 4GPD1 3R9WA 2L0XA 1H2BA 4CM8A 2DH6A 1RLIA 1KI8A 1HDOA 1NC1A 4R2LA 2GUWA 2I7CA 1XRLA 2AV6A 3K35A 4DRZA 3KHSA 1VC2A 2ETVA 2PZ8A 4KN5A 4O2AA 2Z09A 1RYMA 3M6MD 3OF5A 4E30A 2QRJA 3IPAA 1YCHA 1TUGA 2QV7A 3Q8LA 5C1BA 4S0XA 3P2OA 1BVYF 3NXSA 1U9CA 2OZLB 3OFSA 4X20B 1YTPA 4RC9A 1IN4A 1TMKA 1YVUA 2QE7A 1JIUA 4D8XA 1D4ZA 2GBLC 3RLFA 1SO8A 1EQ2A 1W8DA 5H9VA 5JTTA 1SXJD 2W43A 3QEAZ 4JJGA 3C7TA 4C43A 4BN0A 4EPVA 2K87A 2JIOA 2YV1A 1H0ZA 1DIGA 1VJTA 1IU9A 2ETXA 2J32A 3NUQA 3ZXIA 3I5YA 3BMOA 10MHA 1S8OA 3SP1A 2A0WA 3F3MA 3HB1A 1YJCA 4EYOA 3W5IA 1GGVA 5JAPA 3FB1A 2WA1A 3FKQA 1MA3A 1QDUA 3DWFA 1QIGA 2GN1A 3CVWA 4XIIA 4PLGA 2CXOA 1QQ5A 2JFZA 5DM2A 5A7HA 3WGHA 2IHBA 4TLLB 1WTCA 1PGPA 1NJFA 2HADA 4F60A 3WWZA 3WLIA 1D7AA 4X3OA 5B36A 1MQ9A 3OIDA 1X9HA 3KD2A 3ZDYB 4ZN6A 2OGUA 1SOVA 2HZ7A 2P1ZA 3NNNA 4IXNA 1E7SA 3BKWA 3C7AA 1C9DB 4REQB 3TZEA 4LHEA 2ZLBA 2RH9B 2JIMA 3FZYA 3ONNA 2E89A 3PGLA 5DZSA 5I7OA 2GKTI 2G77B 2IOYA 4RKWA 3KEQA 3ZDEA 2FSVC 3BMXA 1RMQA 5AVUA 1JFFB 3LLCA 4CRWB 1NXUA 1G8SA 1CW2B 1GQQA 1RT9A 2PWPA 4QLOA 4JJ4A 3U7IA 3UA3A 1CUVA 4NAHA 2VTBA 2IH2A 2ODQA 1VA4A 4LYDA 5AW6A 2D2XA 2R4UA 4LZPA 1EGHA 5EEHA 2GM3A 1SCJA 1X8JA 1J49A 4UFPA 4BNYA 2J4DA 1UUCA 1MW8X 1NVWQ 4HNAA 3KT3A 1XCPA 3K1AA 1JEQB 3B3GA 1M9NA 1SUBA 1EHIA 4R2WA 2UZ3A 4NC9A 3VVLA 3C6YA 3DYIA 2ZJZA 1FRQA 1NJGA 2BFDB 4PCVA 1COWA 2KJQA 2XAUA 2JZOA 3WIEA 2IGTA 1ABEA 2YYSA 4FDLA 2QVCA 4JU9A 4LF5B 3T3MB 2N71A 4MRPA 3MG9A 3JYNA 3KEGA 4HAVA 4E5PA 3JASA 1H93A 4YRDA 1NU6A 2C0QA 1H4VB 4B5LA 4UXHA 5I4IA 1MH1A 5IS2A 3LDHA 4YBZA 3AO0B 3FSXA 4LJLA 3BWEA 3BYZA 1J9GA 1PAUA 2CNDA 4MVWA 3I2GA 2OWDA 5EG5A 2F9FA 3RTAA 3GFVA 4OD0A 3DTYA 5E6RA 4Z4GA 2DTXA 3KL2A 2V6BA 2JB9A 1LPNA 2WFMA 1ZFNA 1XMVA 2RHGB 2XJ9A 3MT8A 3VR4A 4EG8A 4HWSA 4G2TA 2GETA 3A7EA 1VKZA 1PFWA 3A4YA 5IC6A 3K0EA 4PHGA 3QX3A 2J45A 1JHMA 4R7GA 4RTRA 3PXBA 1XDBA 3SDSA 3P20A 1OLXA 1Y1BA 2JI6A 2XA9A 2OKCA 3AOEC 2DBRA 3DBRB 4F2PA 3ZDDA 1PG0A 1SGQI 2OD9A 4RKEA 3OC0A 4Z1OA 2QMOA 5ERGB 1SQ6A 3FLAA 2QR2A 1RJWA 2O1SA 3NIWA 3P94A 3T7TA 2C5AA 4IWYA 4TXHA 3GLFA 4UM8B 2DF8A 3SJZA 3FDXA 4Z53A 1PGJA 3OC6A 2M1XA 4XVQA 4MGHA 3CJTA 4WPGA 2WP8J 4YPFA 4G1EB 3JQ8A 2X0DA 4UUBA 1JJBA 4YCBA 4K9DA 3R2JA 4KI7A 4DJJA 4NI5A 3WQBA 3I2IA 2VHWA 2XZOA 4HL6A 1X13A 1CBUA 1T1EA 2CNKA 3IDZA 3L7DA 4DC9A 3WLFA 3ZWMA 2CB0A 4PAGA 3BGIA 4AKGA 1IVNA 4MQ4A 3BIJA 1R9JA 4MZXA 2P6RA 1DC5A 2O5RA 2C82A 5L3QB 3FUXA 3QKSA 1YB6A 4EHJA 5AOAA 1DB3A 3IC5A 1TPYA 1LSSA 1XZPA 2XT0A 3M6XA 3SHQA 4YAGA 2H4FA 1M67A 1M7BA 3EIXA 4DCMA 2QJOA 4O4HF 1FY2A 5BWMA 1R6TA 1M74A 3E8XA 3ESYA 4UUAA 4V0LA 1X1SA 5ALUA 1V1RA 2BT4A 4MS4A 4C2BA 1Q3KA 2WAXA 3HK2A 4B3RB 3IPRA 2AIRA 5F7JA 2UXDB 2GWHA 1L7EA 5F9FA 1GZ3A 3LCJA 2EFHB 1E98A 4GRAA 1J0CA 2KLHA 4MDHA 4MRRA 1PTRA 5JJ5A 1EUQA 3N2IA 5LYJB 4UQOA 4OSPA 1PFVA 3AEQB 3F71A 3P0EA 1NV8A 3O84A 3NP7A 3IKJA 2WWWA 3I04M 1S3SA 2QDKA 5DLYA 4ZT5A 1AB5A 4BGUA 4ARIA 2O48X 2B9VA 4ZZ1A 4EHLA 5BV2P 4QHTA 1KR2A 3BHJA 5EZYA 2XWJI 1CUFA 1BEZA 3RU9A 4OY3A 1J7JA 1Y1LA 2H0RA 2H9AA 3G0DA 5AK0A 1LNZA 3QUCA 2C7BA 2GN9A 3RFTA 5IRCD 2AE1A 3ZWXA 1U3DA 5GM2A 3S70A 4KSCA 3CLSC 5K8IA 3FHOA 3WWPA 2C2WA 2CJPA 2CL6X 3D5QA 2XGOA 3JTMA 3NNDA 1G20A 1F9EA 4B87A 1N36B 1AURA 3JVIA 1XNJA 3TGWA 1VL6A 3EQ6A 3WYGA 1EB9A 4QTZA 5BR4A 3GQBA 5AVVA 1ZSNA 1X1DA 3R5FA 4N4AA 5IT9A 4RE6A 2FNAA 2FFAA 5TQ0B 2ZPAA 3PPWA 4D25A 1V7QA 1IG0A 2I3AA 3OWXA 5HIJA 4C2UA 2YIJA 3CEMA 1ECJA 3LOUA 4KU4A 3T54A 1KHTA 2BEKA 2IUSA 5JJLA 1QVRA 2WV7A 3IPXA 3LYUA 4AO6A 3LUHA 1XZIA 4PW0A 3IRUA 3JAMA 1KNXA 3EEOA 1R00A 1GUBA 2RIRA 3ZY3A 1QCYA 2CV1A 1CR2A 5EWLA 4KAAA 2QGNA 1T1RA 1PR3A 2ORYA 3I9LA 3EN0A 3NKVA 1L4UA 4LXXA 1SR8A 2GB4A 3CNNA 3RC7A 4PZUA 1NBMD 2F64A 2WF5A 4CGZA 1CGJI 5GV7A 4GVLA 5BOSB 4B2YA 1I3OA 3IIMA 3VV2A 2WJVA 1CK4A 1UDWA 3F8SA 3SBEA 5H3CA 1W4CA 1GNTA 3H87A 4OOEA 3A2LA 1MXHA 2C0PA 4GI5A 1JG2A 4F3RA 2VPXA 4CG1A 2PSJA 4IX1A 2RHTA 3CN7A 2PX8A 3DMNA 2DFLA 3MFQA 721PA 4TQUS 1HPTA 1IM2A 4MEAA 4NMXB 4YQEA 3I2HA 3IP3A 3U7QA 5LCXA 1YK1A 4GAEA 3VC2A 1U98A 1PT8A 1USVA 3Q7EA 4KE9A 1BJTA 4FGSA 5HDBB 5A6VA 2BZSA 1V1IA 3B1KA 4FXPA 4DW8A 3T1VA 3RE1A 2ISCA 3BB3A 1YRAA 2A2ZA 2I2WA 2BMFA 3ZEIA 1RDFA 3DJYA 4GPAA 3OTHA 3PDIB 4QOJA 3I53A 5JT1A 4JXJA 1CERA 1N1EA 1YR3A 4X8LA 4QOHA 5T67A 7REQA 5CB0A 1GWNA 1QF9A 1XK6A 1YUMA 4WT7A 4A0RA 1Z26A 1WB5A 2ZJ0A 1UJ4A 4PONA 2YCBA 3H7IA 4Q47A 2B7BA 3AEKA 4U02A 2DHCA 3GG9A 5CDFE 4J16A 1CUEA 1CY4A 1Z7EA 2V7TA 4Q7EA 4IO0A 3IQZA 5KPJA 3WAKA 1A82A 4RMIA 2IYPA 1QTIA 3ZCRA 1L4LA 3K0HA 1K63A 3QE4A 5DX1A 3U6KA 5KOJB 1RXYA 3M49A 2JFHA 3BTVA 3I2YX 4QPNA 3C4JA 4YJHB 5L3RA 1E2KA 3PR1A 4C05A 4ZYZA 4DMLA 2P9YA 4HWOA 4B85A 2VOEA 4UVDA 3QRWA 5DOZA 2G80A 4C7XA 2WVGA 3OWHA 4BXOB 3PIIA 1NBAA 4D8UA 3U4QB 1X1BA 2KHZA 3V4SA 5D1NA 3WGKA 4EPXA 3I8OA 1BWRA 3NTRA 4X6YA 3U2QA 2C04A 1FP7A 3VYRB 3DZIA 3QKTA 1JIJA 4IJQA 2QPOA 4NHOA 4ZVKA 4JLPA 1AQUA 3ZDZB 3PGXA 4XFDA 3VYTB 1Z5GA 1NRJB 3CT4A 4HDAA 4ZYYA 3C6MA 3SF0A 4J1SA 4JVOA 4UM9D 4Y9UA 1EP9A 1IHYA 4R7TA 2JK1A 1WSDA 2TMYA 2XKBA 2NUAB 2F3PA 2WHXA 2OZPA 3A4MA 4TN5A 2ZJ3A 1R8JA 3GFPA 3NDPA 4HDMA 1NHGA 3DDOA 2XMBA 3BZBA 4PO8A 1M2VB 5KI6A 2RI6A 2O8DB 2NPIA 2CFOA 3FPSA 3ZWVA 4Q4JA 2NPFA 4EL0A 3LUJA 4JQZA 1A88A 3IUMA 2CNNA 1RI2A 3DVAA 4K0RA 2E7ZA 4KFTA 3WXMA 1YACA 4WZZA 4C6TB 4DYHA 5CA1F 1PK7A 1UBNA 1KDPA 3Q72A 2VEDA 1JTVA 2P2GA 1SQ5A 1ZOOA 1JEJA 2BGKA 3ESAA 4I5IA 3GK3A 4NU5A 5DWDA 2KCXA 1TYEB 5KREA 1U2PA 3RR2A 1TLFA 1DRWA 4N0PA 4EAQA 3VR6D 3UGIA 3AKYA 1U2GA 4HY3A 1OE0A 4IUYA 5ICSA 1R5NA 2VRNA 1S4MA 1YTLA 3GJQA 1GSOA 2XUQA 3RANA 2QMHA 4V3BA 2EX0A 2HAEA 1YR7A 4H08A 2G82A 2VC2B 1Z39A 1Y81A 2OCPA 5HBGA 3VTAA 1B0UA 1DRVA 3MBOA 3ZY5A 2H31A 2W83A 3B36A 3MN1A 2B78A 2W2QA 5HKKA 5B12A 5FI5A 4FN4A 2R7MA 2G9QA 3KQPA 5JCOC 1SUEA 1YASA 3UJHA 4X94A 4AJKA 4AZ0B 3OCYA 1L7DA 4ZCMA 3PVCA 2V3CC 1QKKA 1HYEA 4C7MA 2HSEA 4DMUB 1GUAA 4FQ5A 4IFBA 3UKDA 2NUPA 2ACWA 2XE4A 2IDKA 5AVOA 3NXKA 2JFWA 1YR8A 5EE1A 2OO5C 3H3FA 3WLJA 1SC4A 5F1KA 3PVZA 1NIJA 1Z29A 3O26A 3GGGA 4ZA2A 2OESA 2DJ5A 4OFWA 1GUFA 3NJ4A 1GKUB 4E5YA 2OK8A 1NASA 1TT5A 2CHUA 3I0NA 3N76A 3BN3A 5CHYA 4WOBA 1Z88A 3PXAA 2PMFA 3JWHA 3OZBA 4IS3A 4M9QA 3VZRA 3NHWA 3FTDA 3JVVA 1U28C 4JBIA 4TVOA 1PR2A 1XGKA 4L74A 1E1LA 4OHMA 2Z57A 1M75A 2NAPA 4OLFA 3PFKA 3CN9A 5AKKA 4CT5A 4EATA 4F06A 3AF4A 1G55A 3I09A 2PPLA 3ZHVA 2HNBA 3EGXB 2F9LA 3MELA 2XGJA 1RAGA 5H4HA 2JIDA 3VPSA 3K09C 3GC6A 1UEIA 5LJLA 3VDMA 2IXBA 3HJTA 2FZWA 3W1EA 1P0FA 3PTZA 4CQLB 4L07A 2G17A 1EK5A 1WS6A 3G6KA 4EAAA 3TCKA 5AI5A 2VZ8A 2IIQA 2AF4C 3N70A 2GQ0A 5EYPB 3WFIA 1DLIA 4MQ5A 2WQ7A 4MLDA 2XNCA 3ZC3A 3G85A 2IS2A 2C42A 3MRTA 3AEZA 2AJ8A 3TZLA 1ZPDA 3A6EA 2XT9A 1TM7E 2KMQA 2AFHE 1YGYA 2FJUA 1LNQA 2F3TA 3D8TA 1V5WA 4OQEA 4BNJA 2X13A 4E6EA 4KH0A 1QAMA 4EG5A 2ZIUB 2R8OA 2IPMA 3VPHA 2B94A 1HT1E 2RGCA 4C5AA 3P0IA 3QIVA 1L2TA 5ED4A 1IHPA 2P0EA 2QB5A 4H31A 3GJ5A 1Z5VA 3L82B 2FWBA 4J2OA 4QM6A 4UNRA 5JZBA 3GLIB 1IBCA 2VJCA 3OZEA 4F4DA 3JD0A 2X0EA 4BX8A 2VHCA 2SICE 4N41A 4RPKA 3RVPA 2QX7A 3KT0A 1Q0TA 2I2CA 3HZHA 4FOSA 1HURA 4IG9A 5HFAA 1Z8FA 1P91A 1KYZA 1N6NA 3TUJC 1KBOA 1KJ8A 4Q03A 1PWZA 5TY0A 3TTYA 4W5JA 3EG9A 3MM4A 4Y2QA 1ZRSA 2TYSB 1RJ9B 4X41A 2EL9A 3PUKA 3KSDO 5CFNA 1TECE 3OEWA 4FLMA 2B5VA 3O91A 3UH0A 4XCQA 1OJ7A 2O7SA 2VTDA 1HDRA 3RC2A 2ZYAA 1NW5A 2P6PA 1VL1A 2OHVA 3BRQA 4OMFG 1EK1A 1YR2A 1LPBB 3MGCA 4II2A 4WLOA 1H2XA 1ODTC 2OV6A 3VOSA 5H0IA 3X1DA 5KYUB 3P71T 2C5EA 3OICA 4GQBA 1ZGHA 1ZL2A 1HA3A 3NAMA 4KIJA 4A2QA 2CYAA 4PSUA 1VRCA 5DCLA 3M6UA 3PHJA 2ZM5A 2WY2D 5FA8A 2VNSA 3RSFA 3KJIA 4HBZA 1XCJA 4YAUA 4HMQA 4C29A 2C1XA 4TOIA 4EHBA 1RLOA 2DUNA 1EVLA 3G2MA 4G5XA 4M7PA 3DJFA 4YMSA 3ABOB 1YZKA 1NP6A 3QY0A 2BM1A 5HP4A 5FJJA 4NZ9A 2QLNA 1ZXBA 4LGVA 4C0HA 4MP8A 2GVIA 4NH4A 3A9VA 2AR9A 1CUJA 2JGKA 3Q85A 4LDAA 4XTRA 4OP3A 1WF6A 4MQBA 4YYEA 4P81A 4YT4A 1UBSB 1H3NA 1OUMA 4R8MA 3W6ZA 1SVSA 5HQ3B 6Q21A 4AUEA 4KQ1A 3FHCB 4HAXA 2XIQA 1OX4B 3KB2A 4P84A 3TMAA 1E2LA 1WXQA 1IQ0A 2IIBA 3HS3A 4MR8A 5LU9A 1XCOA 2WJGA 1UM9B 2UUOA 2H4WA 2MYNA 4H1TA 4PINA 1T3TA 2QN6A 4C14A 1WCV1 4P4TA 3M1AA 4DIUA 5CD1A 2YS6A 5HF6A 1TX4B 4YXWD 3BCRA 4ZVVA 4EITA 3ORYA 2R6HA 1YR1A 4LZOA 4EMUA 4NBUA 3C2QA 4Z0TA 1MP0A 5H80A 1QUFA 2F17A 1ZLXA 2J0UA 4FD3A 4KPUB 5IVIA 5ECGC 3ZW8A 3KLBA 4AUMA 2IOFA 2Z8YA 3H2JA 4PG5A 3IQIX 2E5LB 2IODA 4MVJE 1QZUA 4P3NA 1KH2A 2PKRA 1CE8A 4AZTA 4BRSA 1SOUA 4QDOA 4P4SB 3PUIA 4TKVA 4OI4A 2UAGA 4KXVA 4B7CA 3R3YA 2PXAA 5DHUA 3VO8A 1QF6A 3KWLA 4O2BB 2OPHA 4CUKA 2UXCB 2PZFA 4KPYA 3MQFA 4B0PA 4BMPB 3A70A 4MI6A 3VH3A 3W6OA 1FQJA 3WGUA 3H5NA 1DG9A 3BD9A 5D01A 4A1OA 3NCTA 4MQEB 3NGMA 3E35A 2A6PA 1TVEA 1V1MA 4KWHA 4LOHA 1QK4A 3RS5A 3P9IA 5CBKA 3R3VA 4G1UC 2VDMB 3IUEA 4H2DA 4KAFA 3DZJA 3TZKA 5K6TA 1BA2A 4G3XA 1T2VA 3BJRA 1FQOA 1JG7A 2C95A 4OBBA 2FF5A 4I50B 4K28A 2R7KA 4YJ2F 1XQ1A 1PX0A 5IP5A 4TTIA 3W9BA 1GLGA 2D1YA 3AM3A 2A4MA 2QLFA 3N39C 2J6HA 2NVUA 3QUSA 4D92A 1RS0A 1L5KA 3URMA 2VH2A 2DC1A 1V11A 2D5LA 2PSFA 1BVRA 1XSEA 3KQWA 5JAQA 2B9EA 4PHFA 1EHYA 4LK2A 2IW3A 3ELWA 2OCDA 2V5VA 3EQZA 3I3SR 2O1WA 4FI3F 4FU0A 5FTLA 1HEUA 5JSUA 3SQOA 1DWUA 3MJRA 5JY6A 1CWUA 2QUJA 2EEZA 5FWYA 1ICEA 4K86A 4WUTA 5FBZA 1IY1A 1CS0B 3LPLA 5IEBA 1A8IA 2IP2A 3ANSA 2X8JA 3IDQA 5B5SA 4JX9A 3S1SA 3HSSA 3DO6A 1JHOA 1HSOA 4CMBA 1ZAYA 2HDNB 3FI9A 2AHRA 5A2QA 3I4FA 2ENNA 4XOIA 3SEQA 3OIUA 4V0SA 2VDQB 2ANCA 2ZCJA 1AUOA 3JZFA 4FUQA 5DM1A 5GOZA 1FUYB 1KI1A 5JNLA 4AKIA 2PV7A 1DCFA 1VG1A 4Y2YA 1EP2B 5KZMB 5BPFA 1DC7A 1K98A 4L1KA 5CX1A 3ULKA 1L5GB 4AD8A 1RHUA 4M1KA 2C03A 2Z6QA 4AJPA 1KFBB 4G9GA 3ZWWA 5BN3A 4GO1A 2L8EA 3L7CA 4YMIA 2BBOA 1U1EA 2BFBB 5TEWA 4RLHA 2YWGA 3EGEA 1HE3A 2AXEA 1I14A 5T5QA 5F4BA 3U16A 2VCHA 3E2PA 3EULA 4FGWA 3VZSA 1IEWA 3WKEA 1WPXA 3I04A 3ZTTA 1AD2A 4US2R 1J8FA 1T6XA 1SRQA 4Z0PA 3JWPA 2O2YA 5FPTA 2NU8A 1ANKA 4YMHA 1IB6A 1QH8B 1WLSA 3OBIA 3Q7QA 4IM7A 3U9LA 1ISIA 1E2UA 1K5DA 5B1IA 2Z3ZA 3AHFA 4MUIA 5CVTA 2OVOA 1L3BA 4LMRA 4DDVA 5FBHA 2WR8A 2QZSA 1CIPA 3OCUA 4WMLA 2ODBA 1SM4A 4N03A 4A15A 1VSQA 4EHFA 2G1AA 3MAGA 4F1KA 5TDHA 3C3CA 4D8YA 4D57A 5DSZA 3LHFA 3QFHA 4IOMA 1MCZA 4R4JA 3NYRA 4NYIQ 1O03A 5ERXA 3UEOA 4ZGBA 4LJ8A 2ZXEA 3HY6A 2XCTB 3CKKA 3K2EA 4U3JB 5JROA 3P2MA 1AKRA 1QOQB 4PBRA 3HADA 2NTJA 4MHOA 5DCYA 1VCIA 4RFVA 1KH3A 1BDBA 4B8ZA 4I4TA 1N5LA 3VFDA 3QX7A 2QU7A 2EZUA 3QUTA 4FYWA 2WWIA 1C7ZA 5BMVA 3ECSA 4OGGA 1MFPA 3BPSA 3CRNA 4U0JA 3L6OO 3PEYA 4CV3A 1YFLA 2Y1XA 3I9V1 1FDSA 13PKA 1P6XA 3F6YA 4MUBA 4PX5A 2ZIGA 4MYRA 3MYYA 4DM3A 1UUFA 2WU3A 5LYYA 2C7GA 3M7IA 3AKEA 1ISPA 2XYPA 4A1FA 2C61A 4BO0A 4M4SA 2VXBA 2PH1A 2CNWA 4DVJA 1W6RA 5DYNA 2AH5A 3HXOA 4GL2A 1Z6YA 2VP0A 3IMCA 2FN8A 4LHSA 4I6GA 3LCCA 2PKQO 2R1UA 5J9FA 1HLDA 1Z5OA 4DNOA 2XGSA 4ZI2A 2CLFB 1SOWA 4MQMA 1VLVA 3G2KA 4BO4A 5AVTA 3KELA 1YS9A 3W2IA 1QRTA 2Q4RA 3TLGB 2Q21A 1LVUA 3CUTA 2C5HA 5JBQA 2YNMC 3EWAA 1L5HA 3SKYA 3KKQA 2O4CA 3BJZA 4Q4HA 2V53A 1G9SA 2ZPTX 5TQJA 1ZWLA 3ZVLA 1ODFA 1YF3A 2HI0A 4CODB 4DA8A 2CC2A 3ZWCA 4D9BA 4OQXA 4R40A 4JL6A 1X80B 2O19A 2VT7A 3GXOA 4MHTA 2UZAA 4O63O 4OJTA 3B7GA 5JYBA 5ESWA 4JUIA 2NVOA 1U63A 1E3TA 1Z0DA 3IOYA 4GM0A 4UE6A 3VM6A 3H1TA 1TVKA 2ATCA 1IZZA 2P3SA 1FLAA 2I3GA 2R1TA 3KYCB 3G8YA 3FWPA 1ODSA 1KJNA 3P0HA 3FTEA 2PKXA 2GXSA 5LOVB 4NZOA 1N6IA 2C5SA 2YW9A 3Q3VA 2Q9BA 1RJDA 1SPXA 4Z4CA 2IPLA 3RSQA 1K7YA 1WKCA 3FCOA 3QV1A 3WJ2A 5FOUA 3WV4A 5K0FA 5JQGA 1DAIA 2X7XA 4JVLA 1Z28A 4NU6A 1N2JA 4NJMB 3VDRA 2VL7A 1KYVA 1BE6A 4N7BA 1R7RA 4JC0A 4JP5A 1E2FA 2AA3A 3MGGA 3ND9A 5D7NA 3RUCA 4D0NA 3HLKA 3E7XA 3Q6NA 3RKUA 2GBFA 1JTFA 4CQMA 2QQ0A 4KR9A 3ZVKA 2VP3A 4HLNA 4X84A 1E1YA 3L0CA 1E3LA 3KWJA 4WXEA 3RRFA 1MQSA 1KIMA 2IH4A 9LDTA 2GT1A 2BE7A 5KBYA 2C84A 4DLXA 3OKFA 4UBOA 5J1TB 3T4EA 4JJEA 4INPA 3SS9X 4D9GA 5CJPA 3R41A 2WJ3A 4TXLA 2WTAA 4FDVA 2JI9A 4RK1A 4RVOA 3C6ZA 1JEDA 3SIWA 5B3JC 1HZZA 2WMNB 1Q9BA 3AVWA 1VE1A 3PDUA 4TRRA 3H11B 3OVMA 2AF3C 4IVNA 1NOIA 4KIGA 3VBCA 4H1WA 2R5NA 4L9AA 2XB2A 2XDQA 3CGWA 2VAMA 3ENNA 3C5EA 4URZR 3KOUA 1DX9A 2UZ1A 4X8OA 1NMQA 1PZEA 3LT4A 1Y3FE 1T1JA 3IUSA 3RSOA 1ITZA 2RBGA 2Z9CA 5EX3A 2GHRA 4PCLA 3FOZA 2QTTA 3SR3A 2B30A 3KJQA 4MEJA 4OM8A 1OYWA 3MERA 3B89A 5F73A 3VRHA 3WOHA 1M5RA 4EF5A 1Y1QA 1ZJZA 4LRYA 3DMTA 4JL8A 4EDFA 2GERA 4D45A 2VAXA 4XPIB 1WKVA 4EY6A 2PT5A 4YY3B 4J76A 3MUFA 5LMNB 1QIMA 3ECCA 1J06A 4B3BA 3ZU4A 4CCYA 3RT9A 4PS0A 5HHTA 1CUHA 1Q1AA 1I0ZA 2CD9A 3TQIA 2XZPA 3NBMA 3CPJB 3HPRA 5L3SB 1N5OX 3ETHA 1XP5A 4M1TA 5FEMA 3D8BA 4ZXPA 1P1RA 2BUSA 1X1TA 1NVXQ 2YDYA 3PFFA 1TC1A 1YBMA 5DNAA 1D09A 1UKAA 3N8DA 1W29A 3WGNA 1P39A 3K9BA 2XMRA 4RH1A 5ILQA 2VATA 1XU7A 5DX0A 2V7GA 5IBCA 1VHJA 2EGHA 5GPBA 4R8RA 3PTAA 3BBLA 2V45A 3NC4A 3V8VA 4NCAA 3K1JA 4GLJA 1TAHA 1L5YA 1JB1A 2ZYVX 5C4IA 4MVJD 1L8OA 1LS6A 3EBLA 3JATB 4KGXA 3ROZA 4BRZA 3F3KA 1N4AA 3A58B 1DAOA 2HLPA 3CNHA 1CKEA 1E5DA 1SG0A 1YDWA 3ROKA 4UCQA 3SN6A 5BW8A 3Q2KA 1R0BA 3PIDA 3C16C 4O4JF 1S2OA 3MBKA 4FHFA 3UV7A 4BWYA 4ED9A 1U0GA 2AJDA 4WBNB 4OLAA 1Y3CE 2ANBA 3TCNA 5A5FA 2WJHA 1M6VA 4D3YA 3CIFA 4INJA 4FZ3A 1Z4QA 3ONEA 4HRYA 5DK4A 2XX3A 1PZFA 4ITUA 5LKAA 1KQOA 1QZTA 1E79A 1WDLA 3KRTA 3L49A 4WK6A 2ONKA 4TLEA 4P54A 2UVDA 1VCMA 4L3VA 4A91A 4F3KA 1KAQA 5FTMA 3THYB 4BMZA 2ATXA 3D4NA 4DCPA 2XQGA 5LQJA 2AX4A 4ZIRB 1KXJA 1PFYA 2VYFA 2XUJA 5FORA 4AW9A 1WB9A 1NX9A 3G5LA 1ISJA 3SNKA 3A1CA 4RZSA 1JN0A 1G5PA 3EVAA 1L7AA 4GPBA 1P2VA 5C5DA 4AWBA 4TUYF 4B3MB 3SQDA 2QL5A 2HRRA 2W2KA 2R8XA 4M9CA 5F9MA 2YJZA 4NV0A 3BORA 5YASA 4XRGA 1V4NA 2QP4A 1PDVA 3WSTA 3K8ZA 2CDNA 4GU5A 1IBLB 2CZCA 4W8HA 1RAIA 4EW2A 1S2NA 1F60A 3RASA 1BRTA 2HT6A 6REQB 5E1DA 2ZG6A 3E7PA 4LIPD 1IPHA 4PXYA 1RWKA 1VLQA 2R6JA 3PVSA 4WH0A 3SI7A 1W19A 3B3QA 2FTKE 2GIVA 2IPAB 2FWRA 3TKAA 1WPGA 3ILYA 5EKUA 4DEYA 5L4LA 5BVHA 2GAFA 4IMRA 3F90A 5FTWA 3WB2A 5DU2A 3FIJA 1HT0A 4X3CA 5TPWB 1P4GA 5LQMA 1MX1A 5G0WA 4CMIA 2VPQA 1M1XB 2XW6A 2JH8A 3O2QB 1JWAB 1YL6A 4JP2A 4YGYA 5IAGA 3DULA 1LEHA 3TLZA 1F0NA 2CMKA 3X1ZA 1SH7A 3JQAA 3ICPA 2VF5X 3P26A 5D3MB 2VLIA 2BJVA 3QEBZ 1BS2A 2Z04A 3KTDA 4GP6A 4WN3A 4HTFB 1VKRA 2AD1A 2A1UB 3AUYA 2HJVA 3H4VA 4FCVA 4PYNA 3BFJA 4KOAA 4M8KA 4CMCA 1G8JA 4ZVMA 4ZVQA 1U8UA 4H1HA 2BAGA 4DC0A 3PE6A 1FFXA 1RP1A 2WCYA 5A4IS 3PPXA 2BFCB 2IE8A 1XXHB 2Q6VA 4FBLA 3UF0A 2VOJA 5J2TB 1NNSA 3T9CA 1RM5A 1W9HA 4HEA1 2J09A 3RYIB 1FXWA 4O08A 4D8TA 1UJMA 3FYSA 3AW8A 4OXYA 5E4FA