2J9RA

Thymidine kinase from b. anthracis in complex with dt.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
195
structure length
178
Chain Sequence
SHMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPTKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 44
structure length 178
sequence length 195
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2j9rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j9rA01
4LJ7A 1W46A 3VKGA 4NHOA 5EE3A 5F9HA 1G3RA 4QBIA 2GHIA 4G1UC 2X2FA 4WAUA 1N2CE 1GL7A 3GLIB 4HZIA 4O25A 1ETUA 3RS5A 2YINC 1H65A 1G3IA 1P7CA 4BRUA 1KAGA 3U7EB 4L16A 3K1JA 4JLAA 1N6KA 3KJIA 2V7QA 4MGZR 5HKKA 4XVUA 1XZPA 1P60A 4O2LA 3U3OA 2ZJAA 2W2TA 1R4AA 2RHMA 1W4RA 1E2IA 2OM2A 4I4LA 2BEKA 2OHFA 4Q1AA 4AYWA 1E1QA 1TBNA 3BH0A 1KJWA 1TUEA 4FW9A 3PR1A 4YMWA 3X1WA 3R20A 1Z0AA 1W1WA 2V6JA 2QAGB 2VP4A 5LB4A 3WHKA 4QKQA 5KO2A 4HDOB 2CXXA 3GJ7A 2X2EA 3FYHA 4I1OA 4TN1A 1YZLA 1QG2A 3RWOA 4JJKA 3LH5A 5ANRB 5CIWA 4HAUA 2SHKA 3VR2A 4Y0AA 2WSSD 3LWNA 4P4SA 1HH4A 3R8FA 3UWOA 4DCSA 1G7SA 1HE1C 1KDTA 1NKTA 3DL0A 2C98A 3VKWA 4P31A 4PSKA 1EWQA 1DAHA 1W49A 3ADKA 4DLTA 1F3OA 1W2GA 3LQQA 1KDPA 2FZ4A 5KDOA 2ZJYA 4J0QA 1QG4A 1SVWA 4QL3A 4YMSA 1ZUIA 1FOEB 4K81B 1JALA 4EKDA 2H5EA 1IM2A 3EIQA 4KLNA 2GF9A 4D82A 3U4QB 2DR3A 2C9CA 1W36C 2YC4C 1KY3A 3P4YA 1PLKA 1AGPA 4TLCA 4B2LA 3CX7A 1Q20A 2CVHA 3B82A 1GG2A 3FFAA 2B21A 2ZRAA 2XZOA 3R9XA 5DIFA 1E9DA 1MKYA 4RD4A 4GDFA 3QI2A 1US8B 4KJZA 2P65A 3MMPA 3UGLA 1ESMA 1QHHA 3FKQA 4GZLA 4QBHA 5EP2A 1E32A 2REBA 4IFEA 3K70D 1U8YA 5B58C 2DWPA 4C0QC 4NYIR 1N0WA 4Y0VA 5FTMA 1JR6A 1DOAA 2WVJA 2QM8A 3TVDA 5CDFA 2IEZA 4BECA 5CITA 5GJCA 5FTNA 4US1R 1CS4C 1EGAA 1NN3A 1G18A 1XEXA 1II8A 1ZYUA 1SVLA 2BDTA 2OUKA 2CNWA 4M0LA 2XNSA 4LC0A 1QRAA 1W48A 2C95A 5DYGA 3TUIC 3NBFA 1OIXA 2IYRA 2WWGA 5EP1A 3RRYA 1PVOA 2IYLD 1ZU5A 2CK3D 4R98A 4B2IA 4G5RA 2RGNC 1PUJA 2ZRIA 1DAEA 5DGXA 2ZJ5A 3AH8A 3OIUA 4JLDA 3GPLA 4YXWD 4H9GA 4BFSA 1A2BA 3C16C 3W6PA 5HZHA 1XTSA 3T1OA 3MLEA 3OEEA 4JLJA 4PO8A 2AXPA 1P9WA 2JJ2D 1AGRA 2PLRA 1G4UR 3ZVRA 1T9HA 3QPUA 3KY9A 1TX4B 2QZ4A 2F7SA 2WICA 2AKAB 5G3ZA 4A9AA 4QG7A 4PXAA 1XWIA 2CCGA 4G0NA 4GT1A 4M2LA 2E9SA 5AUQA 4B71A 2VP9A 2YOFA 4QNRA 4NZYA 1AA9A 4U00A 5KSZA 3V4FA 3TW4A 4OHZA 2HT6A 1KAOA 2CJWB 2O52A 3PUVA 3W8RA 1Q57A 1Y63A 3FE2A 4PR0A 2C5LA 2NGRA 4D0NA 2OE2A 4ESVA 1ZNXA 2OCAA 3KUCA 1OHHA 1UBCA 2A5GA 2N42A 4MRPA 4QBGB 3I4LA 2Z6VA 2ODNA 3K9NA 4JS0A 2F1JA 1OW3B 3EZ7A 1MO4A 2KE5A 4PQRA 3AEZA 3LAWA 4BLSA 3FHOA 2W2XA 2ZAMA 1KMQA 1XEWY 3CX8A 4Q9LA 5FPTA 4B3DA 1UBFA 4LHYA 2P5TB 1NMYA 1ZINA 2BIFA 4D4MA 5EE9A 5C4GB 3KQNA 4ZCIA 3MUFA 2FX3A 3GLFA 4DCVA 4YQFA 3I8SA 1M7BA 3IBGA 5JS7A 2QY9A 3OZXA 2J0VA 4QXAA 1X8LA 2KBEA 1U99A 2GJ9A 3GJ8A 5KUTA 1VCNA 2ZRJA 4AI6A 4WZBE 1ZCBA 1SXJB 2BJWA 3K09C 3KQKA 221PA 2X19A 3C8UA 2ZJ8A 2CL0X 2P5SA 4V02A 3CR8A 4MYHA 5F9FA 4JLMA 5AJZA 2V54A 1E2HA 2IYTA 1Z6XA 2ECKA 2NOAA 5J4YA 4R7ZA 2GVIA 4PZLA 2OEPA 4Q5IA 5BWMA 1G5RA 3TQCA 1R10A 2JDIA 3FMPB 4A4DA 1GRRA 1ZNWA 1N0VC 2G0TA 5FL3A 4PAOA 5E7MA 3QEJA 4ZPXA 1S9DA 1Z29A 3QKSB 2ASEA 2FPMA 1KI2A 1N6NA 4EPXA 4CGZA 2F9MA 1NL3A 1OFHA 5J5CA 3MWJA 2F3RA 1XA6A 1IOZA 1P2VA 1E4VA 3VR4A 2BOVA 4FWIB 2GDJA 3PEUA 3THXB 5CK4A 1PLJA 4NU0A 4PPQA 1OKKD 5FOVA 4GZMA 2PEZA 3A8TA 4ZKDA 3Q7QA 2IXEA 4CIDA 1CJMA 2Z4SA 3PJRA 4MUAA 3LO5A 4Z1MD 3BFVA 4P0TA 1N5IA 2WJJA 4A0FA 3K0SA 1J90A 2H17A 3FDIA 2FEOA 2IYZA 1UF9A 4ITRC 1ZNZA 5GADl 3D31A 1EWRA 3NBYC 2ZROA 4M1TA 3RS7A 4A8JA 1TEXA 2IUSA 4RD0A 3WYGA 4IW3B 4LPSA 5TMPA 1Q21A 4A0HA 4WXPA 3TSZA 3CXLA 4E22A 2OV2A 2XJ4A 4DLWA 5SZIA 1GSIA 4LJAA 3UATA 4EJSC 5JCPA 4C2TA 1YVDA 1KI1A 4TLAA 4JLKA 2CNWD 2R6CA 1LF0A 1H8HA 1XJQA 3N5CA 1Q1BA 4OK6A 1KBFA 1OXUA 3I5YA 3HPRA 3LXXA 3B9PA 2C2HA 3QOFA 4Q02A 1FPMA 3THYB 4NH0A 2HEIA 2WSSA 3DMNA 4TZ0A 1R2QA 3GEIA 4Q4LA 4ESHA 3JZAA 4TLDA 5DHAA 2ZI3A 5JS8A 2DCUA 1E9SA 1W0KD 2CE7A 4DIDA 3K0FB 1YR7A 5KNDA 1OIVA 4QJ5A 5AJXA 4DSTA 3ICQB 2BMJA 4B75A 5K8IA 3K0FA 1G5TA 1QF9A 1FUKA 1VG8A 1WCV1 2V3CC 1NMZA 1V43A 3TAUA 4DT1A 3O8CA 4EUNA 2MSCB 3IIJA 3EPKA 4XTCS 3CRMA 4O3MA 2QORA 4U5XA 5AR1A 2IYWA 4HAWA 3WP1B 3TAHA 1UBEA 3ZZTA 2B8WA 1KY2A 4A92A 3MG9A 3ONWA 4B6FA 2CL7X 2R2AA 2ZVPX 2QTFA 3S1AB 1T8TA 1EXMA 4KYIB 4PHGA 4Z51A 1CTQA 2HDNB 4FIDA 2NO6A 4ON9A 1KKLA 2O8FB 4ZIRB 3EZ2A 3P20A 2ZRBA 4IFBA 5FUWA 4XOIA 3EZFA 2XITA 4DIEA 2QGZA 3FMOB 4ZI2A 4I1UA 4HUQA 2W00A 3AKEA 3EA0A 5SZJA 2C03A 1XTQA 4QGHA 4HAZA 2PZFA 4URUR 2IYUA 2GXUA 3QE0A 2A9KA 1CULC 5L3RA 1M1YE 1U81A 3DMDA 2BC9A 3TGPA 4QHYA 2OCPA 2ZSBA 1HV8A 1RC8A 3ZZUA 3U7GA 3PUXA 2VHQA 2K5UA 3KFVA 3QXCA 1GZSA 3B8HA 1G4AE 3A1VA 5J47A 2D2EA 4DEYA 1PTQA 3R9WA 1UPTA 1ZNYA 1EX6A 2ZIAA 3CB4A 4GOJA 3OE7D 4JVNA 3LXRA 4PSVA 4YONB 4JLBA 4CEIA 1ESNA 1K8RA 2ZE6A 3EXAA 4ARZA 1P3JA 2QG6A 2ZEJA 2JLVA 3IGFA 5M04A 3IQWA 1S8FA 3ETLA 1VG0B 2XTMA 4OK3A 5JMTA 2J5XA 1MABB 4HEJA 2I1QA 2CLCX 3CF0A 3QENA 2D62A 4JBXA 2QAGA 3TBKA 3LX5A 3AVTA 4L9SA 3W34A 5J4LA 2XAUA 1LV7A 3UMFA 2VP5A 4DKXA 1ZJ6A 4LDJA 3RSOA 4TLBA 3CF2A 3SFZA 4LUCA 3MD0A 1E1RD 4TSFD 1ZC3A 4C7OA 1IJFA 3PQCA 5KPJA 2IXFA 4MKHA 4N3NA 4A8JC 2G83A 3DOFA 3P26A 2BM1A 2D74A 4Q1DA 4Q7MB 1I4TD 1XTIA 5FPSA 2GA8A 4WXRA 3RYTC 4M22A 2V7QD 1QHGA 2BVNA 4PO1A 4A0GA 3CIOA 2VO1A 3W6NA 1TEVA 1R79A 1ZD9A 4C30A 4CVNA 2GF0A 2IK8A 4QHSA 2GAOA 1D9ZA 4EAQA 1E9AA 2QE7D 1P61B 3GJ0A 3KUDA 1FTNA 4ILEA 4IDQA 4OQLA 5LD2C 2ZU0C 5B30A 1COWD 4KVAA 2J41A 4TQAA 2REXB 1KO1A 2CJWA 5B57C 2PBRA 3RHFA 5EQTA 4OJKA 1BKDR 1CLUA 4DSNA 1VIYA 4DWJA 4DZZA 4MQBA 1UM8A 1WA5A 3U4QA 3UPUA 5C18A 3X1ZA 3ZIAA 2AKYA 2GILA 3P32A 3R9IA 621PA 1BYUA 1SVKA 4FD2A 4OHXA 2QQ0A 2BMDA 1E0KA 2GK6A 3DZ8A 3IIKA 4HI0E 4CRWB 1FAQA 4Q9IA 1AS0A 1EX7A 1NI3A 2FF7A 3AKYA 4QM7A 4CEIB 2QMEA 1M6NA 3K9LA 5CDFE 3WRXC 3AVXA 5KDLA 5G40A 2BEJA 2O5VA 4OQFA 4JVLA 1ZRHA 1QDEA 3HR7A 5CJ2A 1NJFA 1IJEA 1XNJA 4FI3C 5SZKB 2O0JA 3J81k 1IXZA 2W83A 5TB5A 3FVQA 1WRBA 4D25A 1E94E 5AJWA 5JRJA 3U6KA 3NDBB 1L2TA 3A1TA 4PX9A 4PPNA 3SS8A 1X3SA 3A4NA 1Z08A 3V4RA 3TLXA 2WJVA 5G53C 2GJ8A 3RS0A 2ZS7A 2F1RA 2VF7A 1JI0A 4K8OA 4PO9A 4ZI3A 1E98A 2R8RA 3I8XA 1NF3A 1IN6A 2J0QA 3QXJA 1HQYE 2EFEB 1U8AA 1KK2A 4C0KA 3ZS8A 2WZQA 1EFTA 3ZLJA 1YZKA 1OB5A 2F1HA 5GVSA 2P2LA 1XJCA 821PA 1VPLA 4URXR 2P6RA 2ZXUA 2WPDD 3BERA 3NEYA 2FFBA 4HAVA 4C0SA 1KJYA 1SQ5A 2B6HA 5G41A 2IBMA 2QMHA 2TMKA 5KPDA 2AK2A 2IYVA 2F9LA 1GAJA 1SKQA 4IVQA 1W36D 3K0AA 8OHMA 2CHGA 4F93B 5EJEA 1DAGA 5TV2A 3QBTA 2WWWA 4NCHA 1B0UA 1C1YA 2NO9A 3UMSA 2ODEA 4LYHA 3FHCB 5A4JA 3UEYA 4FCVA 1MOZA 3U6BA 4TYNA 2E87A 5JJIA 3LY5A 1IN7A 4HUTA 1P4SA 2QNRA 4RKEA 5CB6A 2F1IA 4US2R 4LBZA 3TE6A 1G7RA 2BMEA 4IDOA 4JT2A 3UG7A 1K5DA 2GXQA 1ZVQA 5BN3A 3GLGB 4XSHA 2R6GA 3EIEA 3X1XA 5JBQA 5EUQB 1BH2A 2G1KA 2GJAA 1E79D 1KIMA 4B34A 4PSAA 1J8MF 1W4AA 4LJ5A 4NDZA 4XWOA 2OLKA 4Q4HB 2ONKA 4RFVA 4GP6A 4WIAA 3IBYA 3KXLA 4GMXA 3UXMA 3ADDA 3GD7A 2IS2A 2OAP1 1ZU4A 3LW8A 5HE9A 1D2MA 1T0HB 1U98A 5E3HA 3Q5DA 2A78A 2O8CB 3BJIA 4XTRA 2IXGA 1OE0A 1TADA 2WTUA 4LI0A 2C9OA 2ZRKA 1JPNA 1ZIOA 3B1VA 1P75A 1HY3A 2WV9A 4OI0A 2XJ9A 4FWTA 1XMSA 4UNNA 1SHZA 3FB4A 3QKTA 3WHLA 2YZ2A 1IBRA 1IY2A 1IHUA 3EG5A 4IJMA 1W36B 4I99A 4HDQB 1P2SA 1RJ9A 2D7CA 3QEOA 3RABA 2H7VA 3RWMB 3THWA 1LFDB 1Q44A 1O87A 3IPYA 1CBUA 2ZYTX 4Q1CA 3AF0A 1OXTA 2HYIC 2J0SA 1P5ZB 5DH9A 3I5XA 5IK2D 2ZUCA 2JCSA 1SXJE 3AF4A 1LW7A 4ARZB 1E3MA 1L8QA 2IHBA 4IOLA 4MKFA 2ZRPA 4JL6A 4BZQA 3PV0A 4FINA 1GTVA 4TT3A 1BS1A 3NC1C 3SQXA 2ZI9A 4C4PA 4D80A 3QIAA 5FBQB 2GVZC 4HAXA 2GEVA 4IVRA 2XZPA 4TL9A 4E03A 1SVOA 2VF8A 2OBNA 3C7KA 4Q4JB 2J7PA 1HTWA 4X8OA 2NO0A 2VPPA 3EAQA 3RANA 1DAMA 1Z28A 4FCWA 4YC7A 1UFQA 1YR8A 2P67A 3L0PA 3LLUA 5C2JB 2O8EB 2ZR0A 1E99A 2QU8A 2WWFA 4MDEA 1GFIA 3ZJYA 3H0KA 3N2IA 4LOAA 4NYIQ 1X6VA 1XBTA 2C9YA 2DBYA 3BE4A 4OI4A 4BEJA 2F43B 3AM1A 5FFMA 4POAA 1RFLA 2CCJA 4D26A 2VIIA 5BQ5A 2JLYA 5KNCA 2FEMA 3KKPA 3CR7A 3RC3A 2WJHA 2FFAA 2GEDA 3K9HA 3A37A 1Z06A 2P6UA 4TL6A 4RZUA 1GL6A 2QE7A 1J7KA 3UK6A 1JJ7A 1CJUC 1W0JD 3ND9A 1M34E 1DAKA 1YR6A 1IY0A 5AUNB 2ORWA 3AVQA 2FWRA 3SBEA 1HE8B 2H92A 4BFTA 4KHZA 2PZGA 3BC1A 5FBWB 4YMVA 3CONA 2C77A 4TQUS 4M21A 4A2PA 2XTNA 5JHGB 5F98A 3NVAA 2YC2C 3AF3A 4GNKA 1Z5ZA 1KI6A 3W3AA 4R2IA 2ONJA 4MITA 4LWZA 2ATXA 2BCGY 2YNMA 5JECA 1E2KA 2IW3A 3NEJA 4YDHB 1VMAA 3EWAA 4OI1A 5FPKA 3DM9B 4FXPA 2MSDB 3WXMA 3E70C 2VHJA 1FTSA 1LTQA 2XXAB 1T0JB 2FSHA 3QBVA 4LBYA 4W5JA 1ZIPA 5P21A 4LHWA 2HXSA 3QKSA 4DLVA 4PQYA 5FOWA 1EFHA 5F3WB 4BLOA 2IF0A 2PMDA 3BFXA 3T34A 3L2OB 1KO8A 5L3VA 2QA5A 3TMKA 3A1WA 4H1UA 3HU2A 3THXA 3QG1A 1AK2A 1UDWA 2FZLA 1G20E 2AL7A 3IPXA 1S2MA 2ZR7A 3U44A 3H86A 2G6BA 3E1SA 1DG1G 4QOSA 3QF4A 1DEKA 4OHVA 2OFXA 3LDAA 4FMDF 4KFUA 5E4FA 1KSGA 2KB0A 2JLUA 1N25A 2P0EA 1R5NA 3WRYC 1G6HA 1WF3A 4OK5A 2YWEA 5HCNA 2VL7A 2IUTA 3KXIA 4NTZA 2QI9C 4Q9KA 3F8TA 4D4LA 1D2EA 2P3SA 1IONA 3K0EA 1Z3IX 2HLDD 4NONA 1CP2A 2J3EA 3L43A 3OHMA 4OQNA 3RDPA 3RRNA 2HCBA 3BFKA 1G8HA 3T1QA 3ICEA 5AJYA 3C14C 1VHLA 1GM5A 1SHKA 1VKJA 4DC9A 3D6TB 3SHFA 4AKIA 3I73A 2GXAA 1RZ3A 3SJAA 5SZHB 3NG1A 2HYDA 3IQXA 1XRJA 4B6DA 1TQDA 4RD6A 2NTYC 1SVIA 2VA8A 2OG2A 4KSCA 4ZCLA 2GBLC 1RRGA 2HJVA 4RY2A 2L0XA 5GJBA 2J87A 1CR0A 1SKYB 1RYFA 1OHHD 3HR8A 2ZUBA 2VP2A 2FSGA 1KK3A 4EIWA 1MV5A 4PAMA 4UJ3A 2ZITA 4EFMA 2X8AA 1Z0FA 3KDSE 1OH8A 1KO7A 1AJEA 4I1VA 3NHAA 3WP0A 1N6PA 1U9IC 4EPYA 2ZYUX 2ZRDA 4US0R 1GIAA 4Q4AA 4XJXA 5TY0A 1CR2A 3U5ZB 1NN1A 2QTHA 3CPHA 3SE0A 4OHWA 1E0AA 4QNMA 1L7VC 4YMTA 2O0HA 2EU8A 4LX0A 5C1BA 4HB2A 1RW4A 1GKYA 1RRFA 3EW9A 1TPZA 4YLGA 5FBVB 3FHTA 2FA9A 4ZO4A 2JJ1D 4OHYA 1GL9B 3AUXA 4HB3A 1Z0IA 1HURA 1MRNA 4IOMA 2NPFA 2BM0A 4KFTA 1NRJB 4NCIA 5E95A 2D2FA 2IEYA 4KU4A 4M1WA 4DDUA 4Q19A 3LNCA 2XSZD 5JJKA 4MRNA 1X1RA 1ZW6A 3CZQA 5FPYA 3W8NA 2Q9CA 2BKUA 3MRSA 4U02A 4DLZA 4CZ2A 2OZEA 3VR5A 3VU9B 3AB3A 4Z8YA 4L9WA 3RSLA 4PQFA 3CF6R 4D81A 5BN4A 3LFUA 5KOYA 2XNDA 4QM6A 1RKBA 2H57A 3GMTA 5B2ZA 2JDID 3TR0A 2FNFX 1G3UA 2IWHA 3AVUA 4JSYA 2WHXA 2YKGA 3NKVA 2V1XA 5E7JA 1CF4A 1FFHA 1QVRA 3VR6A 1X8KA 1Z6TA 2ZJOA 3AKCA 3PUYA 1II8B 1D9XA 1P9RA 1RYHA 3IDQA 4B44A 3G5UA 4V0LA 5C4MA 3D3QA 3ZVNA 1G5PA 2QRZA 4WW0A 3ZDQA 2ZM5A 1ZMXA 2UVQA 1OKKA 1F2UA 5CK5A 1H8ED 5LD2B 2N46A 1XPUA 1MO5A 3H84A 1XF9A 4XVRA 4E09A 5EXXA 5KU1A 3B1YA 4A6XA 1VYUA 4Z1MA 4IOJA 5FBRB 5FH9A 1UJ2A 4C0AC 1G8PA 4M9SA 4MYCA 4F4JA 4EPWA 3CX6A 1WB9A 5HPYB 1R5BA 1TQ6A 1TU3A 3NBXX 4RJLA 3BB4A 4N1AA 2NMVA 2G0NA 4F7WA 1KSJA 4PHFA 2B7CA 3Q9LA 1FW6A 1NVWQ 4KVGA 4NYJQ 5CLQA 2ATVA 3PCRB 5GJVC 1OFIA 4M1KA 1Z07A 4TWZA 3ZH9B 1XXHE 5EP4A 1XTKA 4F91B 2B8TA 4M1MA 5JEEA 3THYA 2J0UB 1H8EA 1US8A 2MMCA 1OF1A 4S35A 4LHZA 2Q21A 3K53A 4JL5A 3JVUA 4CT4B 2ZI5A 4K46A 2XOKA 1DPFA 3MWYW 4PHHA 2V1UA 4M1YA 2BHRA 4OL0A 2IYXA 5K8UA 4M4SA 1U90A 4XD7D 4LPKA 4MRSA 1F6BA 2XB2A 2BV3A 1IN8A 2GCNA 3T5GA 2EWWA 3VX3A 3A4LA 3GEEA 2KI5A 4B48A 1VYTA 1XXHA 4HYYA 4P3YA 1VG1A 1G3MA 1R0ZA 4G3XA 1R8QA 3IEUA 4LYFA 1XTJA 1SVSA 4LGMA 3KXKA 5JI2E 3T1TA 3EPHA 2G3YA 2R44A 5FTLA 4RD3A 1E9CA 1GOTA 1Z6AA 3HYTA 4IDPA 1HA3A 5BN5A 2XOKD 3T15A 3U60B 5DI9A 3DKPA 2JLWA 3DEFA 1JXOA 3ZZ0A 1NSFA 1W44A 4DRZA 4JLNA 2ZSFA 2ANBA 2CDNA 3CH4B 4B43A 2FV8A 4BUJA 4ZCMA 2O8FA 3C5HA 4LBWA 2AK3A 3NHBA 2G9NA 1CR4A 3AF2A 2BBWA 1FP6A 2V9PA 4GRAA 3VU9A 4RFSA 2VHUA 4MA4A 4EJSA 3JVVA 3HU3A 1QHXA 2I1VB 4NCNA 3U44B 3GP8A 3RRZA 4R71A 4CDGA 1K5GA 1G3QA 3LA6A 2RCNA 3FMIA 1G6OA 1KI7A 4G5QA 1W2HA 2ZI4A 4AYTA 2H18A 2Z5FA 1I4LD 1S0UA 2VTKA 4TQ9A 4ZDKA 2DFTA 4KI0A 4JYCA 1IAQA 1SGWA 1YJ5A 2RGEA 2IT1A 3I32A 4JKYA 2ZSAA 3L0SA 3C15C 4LK2A 3WNCA 3ZD6A 4KLZA 5J4VA 1PLLA 2PMKA 1IN4A 2ZQ5A 2GZDA 3FMFA 3LQRA 5LBIA 3TK1A 3CRRA 3I92A 3GLGE 1NP6A 2WM9B 2OXCA 3B1XA 4L8GA 1G7TA 3QKUA 1LNZA 3VNUA 4LCBA 1QZXA 4JVMA 4KSBA 4KODA 4A82A 2ZE5A 3SJCA 2VSXA 4LRWA 3TUZC 3Q5EA 4BFZA 4L9MA 1DBSA 4DLYA 4RKFA 4NL4H 2GTPA 2ZAOA 4LJYA 4BZPA 1NY5A 4BLTA 5L3SA 3FTQA 1PV4A 5FUYA 1PZNA 1J70A 3ZD7A 3BWDD 4BLQA 2HV8A 1FUUA 3U3MA 5L3QB 1G7CA 1TNDA 4CEJA 2Q3HA 2ZVQX 3CM0A 3U61B 1AZTA 2DY1A 2EVWX 1DAFA 4QGAA 3P27A 1KSFX 4LV5B 4CEHA 2YUUA 1UKZA 2DFKB 2VSOA 1JEDA 3AP1A 4KITB 4B47A 2GAAA 3TRFA 2GXSA 2YYZA 1EFRD 2QL6A 2PZEA 1ZD8A 1G8GA 4KV9A 4WVFA 1LVGA 1MO6A 3BJIC 1GRNA 1KO4A 3K8YA 3CO5A 3KX2A 2QUZA 1E2FA 1E1RA 2C78A 2REOA 4TSFA 4C3ZA 2QENA 3G0HA 3EPJA 4IEEA 3UWKA 2XGJA 5BXQC 1UEJA 3A36A 3MCAA 4CF7A 2J46A 4LHXA 4EPVA 5HZKA 4HLCA 2A5JA 1CR1A 2OO7A 4DLRA 1A7JA 2QP4A 4URVR 1TU4A 5JLJA 4IDNA 3SOPA 2GZAA 1R5OA 3LRPA 1T3SA 3PIRA 4G5GA 1AZSC 1DVRA 3M4YA 1YKSA 1KOFA 4G5OA 4PC3A 5KHOC 2JLQA 3WYFA 1WE2A 2QMOA 2VRWA 2JIZD 2WPDA 5KSYA 4I1SA 2QEQA 3GCGA 2ZETA 2EFDB 4NBSA 3SQWA 2VLIA 2VP0A 2D7DA 3CUEF 4XWKA 3BXZA 3AVPA 4KBGA 4UJ5A 2ODWA 1XEFA 1FZQA 4Q47A 5KNBA 2NG1A 1B23P 1XU4A 1XFAA 4BFUA 2IC5A 2OCYC 2XEXA 4B3BA 1KI6B 2V8OA 2NZ8A 3TR5A 3SN6A 4MGIR 2XB4A 2ZE7A 3PFIA 1TTTA 4EQ6A 1XCMA 2EW1A 2HLDA 3TNFA 2QMUA 1OLOA 5D3MB 2VRWB 1OH5A 2ZUDA 1YQTA 4Q4JA 2X77A 3MWLA 4GBMA 2RAPA 2FFHA 5EUMA 3EX7C 1T4GA 3BBPA 3X1DA 1NBME 5L3QA 1E2EA 4AD8A 1XD9A 2FE4A 1OT3A 1E2JA 2FDCA 3U3JA 2IL1A 1YRBA 4TYQA 3O8RA 3ZS9A 5L3SB 2V6IA 5E7IA 1IQPA 3OIWA 3SYNA 4UXHA 4XH9B 4JKIA 1EESA 2FNAA 4R2HA 3EA5A 4B35A 3CPEA 2OILA 4WZ6A 1I2DA 1D8TA 1WDTA 3Q85A 2BBOA 2Q3MA 721PA 1T8UA 4TLEA 1OXVA 2GESA 2WWHA 1NBMD 4M9ZA 2PCJA 1R8SA 2FU5C 2W6IA 2QT0A 5B64A 1G21E 5A0FA 2JATA 2IS6A 2J1LA 4UXIA 1KI8A 1XMVA 2AD1A 3KTAB 1XTRA 3IILA 4O2RA 3W90A 3LD9A 3T5DA 2G1JA 2ZU6A 3R8CA 1E2LA 3ECCA 2IA5A 2IS1A 1YZNA 3RVBA 1N6LA 1E4YA 1KJZA 1NVVQ 3IHLA 2MSEB 1YZUA 1VCMA 2O8BB 4KBFA 3PENA 4MKGA 2YHSA 4RFSB 5JZVA 4ZV4A 5JWHA 1E2DA 1U2RA 3B5JA 3DM5A 2W0SA 4RCYA 1FX0B 2IYQA 4ASUA 3UGIA 2WWXA 3RLFA 2QP9X 5JSZB 1U0HC 3B60A 5LDDC 2O8CA 1FNMA 3K0AB 1DO0A 2QT1A 2J45A 3CRVA 4LC1A 1F60A 2YVUA 3V00A 2FPKA 3QJYA 4TMWA 5EXSA 1E0SA 5JWRA 3ADCA 2BWJA 4RVCA 3GLFB 1JAIA 2W6JA 4LBVA 1Z83A 1ZAKA 4GOXA 4BGDA 2ORIA 1W7AA 1CKEA 1QHHB 1SVMA 2A5YB 3BH7A 4Q7LA 4DB4A 1X8JA 4R9UC 4BASA 4QJ3A 1A1VA 5FR1A 4Q1EA 5DO9A 4UNRA 2QM7A 3SZRA 1QHIA 3VAAA 1SKYE 4KFSA 1SZPA 5K8LA 4LYAA 4BFWA 1CU1A 1W5TA 3TVTA 2H1LA 2NQ2C 4NCJA 4Q1BA 5AJVB 1KMHA 2FOLA 1TAGA 2NO7A 1M74A 4II7A 3UFFA 3EZ9A 3FKSA 1Z63A 4A36A 5DI3B 3TQFA 1ZBDA 3NDPA 1M7GA 3AKDA 4JT4A 5FR2A 1A5TA 2A30A 2HF9A 2ZI6A 2ZRFA 4CEHB 3K09A 4TL8A 2WKPA 3VHLB 1OXXK 2V4ZA 2XTZA 2GNOA 5FTKA 5UKDA 3RAPR 1GNPA 1KDRA 1FARA 3MJRA 4OQMA 1JQLB 3GFTA 3CWZA 1P72A 3LBHA 4TT3D 2XSZA 3PG5A 3OIVA 2EFHB 4L4UA 4XIGS 3KKNA 1M8PA 4MRRA 1XD8A 4MUBA 2PLFA 3BB3A 3L82B 3L8ZA 4Q9HA 1Z6GA 4ZDIA 2GEUA 3K0CA 1CRPA 1T91A 3CW2A 3UGDA 3H2YA 4TMTA 4AIIA 3NBZC 2CEAA 3NIBA 1R0XA 4Q1FA 1T3HA 1AKEA 1S1CA 4B3XA 4Q21A 3EC2A 1IXRC 3HU1A 5TVKA 2QSZA 1GITA 4LV6A 1UKYA 2ZSEA 5FOXA 1NIJA 1E2GA 3TKLA 3GJ3A 3I62A 4YMUA 3WMFA 3WNBA 4A2WA 2RGBA 5JSZA 2AR7A 2DHRA 1R0YA 3BS4A 5CM8B 1E2PA 4MGYR 1E2MA 1XEXB 2CBZA 1S96A 3UMRA 3OAAA 1H8HD 1VIAA 3C4JA 3GLHB 5KTYA 1VDZA 1GDDA 1KMHB 5CYOA 3O8DA 1RFHA 2ZANA 3A4MA 4JLVA 1N6OA 3VHXA 2DYKA 4JLOA 4PAQA 4D6PA 2NZJA 4QJ4A 1CEEA 5C46F 2RMKA 3TJZA 1FL9A 2WWIA 3W6OA 4NKRA 2WSMA 1D2NA 1ZUHA 5FL7D 4V03A 3DO6A 2Q9BA 4B3CA 1G16A 4FMCB 4UNSA 1J8YF 5K8TA 1QHNA 1JBKA 4C0HA 1NJGA 1MT0A 2ZS9A 1W5SA 3B85A 1G8YA 4TTQA 3OFND 1CJTC 2FPLA 2C96A 5DISB 3ND8A 5IHPA 1JR3D 3EASA 3SJBA 4M1OA 4JL8A 1M2OB 1XXHB 3RC8A 2J0UA 3DHWC 2O8DA 2G88A 3FOZA 4DB2A 1YU9A 3CNOA 4EQ6B 4GL2A 1TQ2A 1C9KA 5HR5A 3LLMA 2C99A 4D4JA 3O8BA 4MRVA 4A15A 1II9A 4KYUA 2IS4A 3IO3A 3Q8XB 4ZDJA 4DJTA 2VQSA 5BYJA 1KI9A 3Q7PA 5EE0A 4DCNA 4JBWA 2PJRA 2HJGA 1HT1E 1COWA 3H4MA 4PTLA 2DB3A 1KI3A 1S1MA 2AXNA 1UDXA 1ZM2A 2B7BA 1W4BA 2YV5A 2DB6A 3GLHA 2JLXA 4FN5A 3ASYA 2JA1A 2VEDA 4BFXA 4NP6A 1I2MA 1GP2A 2Q0HA 1TUIA 4FMCF 2Z43A 4TTRA 4DHEA 1Q1EA 3KQHA 1E69A 4W5WA 4AURA 3Q3JB 3REFA 2ZRCA 2UZIR 2KBFA 4TYPA 2GKSA 1NLZA 1XDBA 3KQUA 4RZ2A 2CHQA 2UKDA 4IXMA 4OYHA 5DN6A 3IO5A 3K9GA 1KO5A 5EZ6B 3BD9A 5IRCD 2OBLA 2HF8A 1Y8FA 3KZ1E 4BPBA 1Z8FA 5AWFC 1R6BX 5BYKA 1XEWX 2RHDA 4LV8B 2PT5A 4HDCA 4D4KA 3UG6A 2WOJA 2Y8EA 1E79A 2JEOA 4Q4AB 1AQUA 1KZ7B 3DZDA 4JJZA 1DS6A 1YE8A 2KSQA 2XNDD 5FUVA 3VR3A 2O8BA 3GFPA 2ZTSA 4O0MA 4RZXA 1TF7A 1NVVR 2RGDA 2ZE8A 3SFVA 1KZGB 1M7HA 1JEEA 4WZAE 2KJQA 3RS2A 1T3LA 3A1SA 4QGFA 2ERYA 2QQEA 3BRWD 2AFHE 2VP6A 4JYBA 4PANA 3GFOA 2EFGA 1BMFD 3WMGA 4MDFA 1LB1B 3B78A 4LJ4A 2F55A 5EE5B 5FOUA 1TQ4A 2OESA 2ZS8A 3CH5A 4MYTA 1ZD1A 1U0LA 5FOTA 1XMJA 4V0NA 2AN9A 3ZIAD 4FKDA 2EYQA 2QBYA 5JCZA 1BIFA 1FMLA 1YR9A 4PPFA 1VTKA 4AG6A 4DUGD 3PUZA 2QRNA 3B2EA 4IRUB 4TYYA 1E9RA 3N70A 1N3BA 1Q1ZA 2ODBA 5KYKA 2JLZA 3QPVA 3OIYA 4DCUA 2P6NA 2QP3A 1E96A 1E1QD 3KL4A 2FJUA 4B76A 1GNRA 4HSEA 4I81A 4OKSA 3AVVA 1Z22A 1N0UA 2QN6A 1Q3HA 1VG9B 4HATA 5FI1B 2AWOA 1F48A 1GWNA 4ZDWA 3WNDA 4M9QA 4CEJB 3S1AA 2JJ8A 3BOSA 4A6PA 4JZKA 1KK0A 2XXAA 3CPJB 421PA 1SXJD 3KJEA 1P9NA 4HUQB 1LF5A 3NXSA 5AK0A 5JEDA 1F5NA 2ZJ2A 1ODFA 4GSYA 3SJZA 1KK1A 2D3WA 1QVAA 2ZJBA 3F0TA 2BMFA 4MH0R 5JWOA 3IEVA 1VHTA 2FN4A 3QKRB 5FL7A 5G3YA 3SHWA 3AVYA 1AS2A 4IKEA 1RIFA 4Q4HA 1DAIA 4DBLC 1UBGA 2RGAA 2WAXA 3BK7A 4B2PA 1NVUQ 5CLLA 4EJSB 2D4HA 5BW8A 1AIPA 1DO2A 4LJ8A 4URYR 3R7WA 1JXMA 5J4HA 1U8ZA 1NN0A 3WY9A 3ZVMA 3L0IB 2ZPTX 5DHFA 3LVRE 1NY6A 2BBTA 3EWSA 4F38A 1U9IA 3LX8A 1P62B 3MJHA 4GMDA 5TDHA 4N0DA 1UAAA 2DFLA 3OESA 5DLQC 1CRQA 1ZCAA 2IYYA 1JNYA 1MR3F 1NBMA 2H8KA 2QROA 2NIPA 1QHSA 4NMMA 4TZ6A 4IDHA 4IXNA 4AYXA 2QPTA 3ZYCA 3LW7A 4U7DA 5DNYB 1W0KA 3W5IA 2ZRGA 1N5LA 4AWXA 2AHOA 2A5DA 2ENZA 4TTPA 3T61A 4ACBA 2J9RA 2OSBA 2VBCA 4UNPA 1Z47A 2CLSA 1J2JA 2ANCA 2RB4A 3RS3A 3I61A 3BB1A 1DADA 4CW7A 1Z0KA 2R9VA 3F3YA 2JJ1A 3CRQA 3B6EA 2WJYA 3AP2A 2OFOA 3QF4B 1PTRA 3ASZA 1RRCA 1RVDA 1G8FA 1DARA 1A2KC 3PITA 4FMBB 3M0EA 1BO6A 5J4KA 4PZZA 4KCGA 2IYSA 5LPNA 1S3SA 3DOEA 1WBBA 1VECA 2B92A 2X1VA 4C2UA 5KSOA 5L8VA 1S9HA 1UKEA 4GOKA 4HLDA 6Q21A 3IUYA 1PUIA 4X8LA 1WXQA 4OBEA 2CK3A 5IF9A 2EWVA 2F3TA 4B3FX 5GVRA 1T5LA 2AD5A 2R65A 4L5BA 1OPXA 2WKQA 4MYUA 3VQTA 3MAAC 3QXXA 4V0OA 4V0KA 3AGQA 4F4CA 1GKUB 2XX3A 2JASA 3BGWA 3A6PC 2GRJA 4HB4A 3CWQA 1S3GA 3RRMA 2OLJA 1KKMA 4LZZA 1NLFA 4BLRA 4AC9A 1YZGA 1U0JA 3R7WB 2DWOA 3SBDA 1D5CA 4IEIA 3OFNA 1E9EA 4LSGA 5TXGA 3AV0B 4DLXA 2QSYA 3WMEA 3K0CC 4RZ3A 4FMDB 5FI0B 4B32A 3GJ6A 3HWSA 2PEYA 4QC2A 4EFNA 3RS4A 3U2QA 1KHTA 1NG9A 3FWYA 4M53A 2QAGC 2EYUA 3TIFA 3B7GA 4Q7KA 3ZVLA 2JGNA 2VHTA 2WJGA 2YOHA 1A4RA 4C0BA 4BZXA 2VSFA 4JVSB 3THOA 3BORA 3AQ4A 1PJRA 1IN5A 3IIMA 4TYWA 2FMXA 3I72A 2F43A 2WIAA 3LV8A 3MSXA 1Z0DA 2ZRLA 3GLIE 3NH6A 3SDZA 1G291 1KNXA 2YWGA 1ZM3A 3TW8B 1VCOA 3UEJA 4UKDA 1EFCA 3SYKA 1OSNA 2QTVB 1G1MA 3DPUA 3IHWA 3E2IA 3CBQA 2J7KA 3D8BA 3MWKA 1JR3E 4H1VA 4XWAA 2O8DB 1G9XA 4PC2A 1XMIA 3GJXC 2IWRA 4E5UA 4DDTA 2N1BA 5HKKD 1XP8A 4PHTA 3U3RA 5CYPA 1WMSA 1AQYA 3W5JA 2GVDC 1D6JA 2D06A 4F92B 3X1YA 2LKCA 3GLFE 1AN0A 2W6JD 4JMPA 1A82A 4FCTA 5EE1A 3P4XA 4DVGA 4M9XA 2JJ2A 3AP3A 1ANKA 2A5FA 1NVXQ 3T35A 3U7HB 2Q3FA 2OXRA 4EDHA 4HLUC 1NKSA 2W0MA 3AGPA 3HJNA 3CRW1 2WWYA 3WYAA 1LS6A 3T12A 4AKHA 2WAYA 5H8WA 4XVQA 1XPOA 1Q22A 1EFRA 2F6RA 4DUGA 3VMFA 3FKSD 5IK2A 4IVPA 3PUWA 4P4SB 1F2UB 4Z8XA 4GI7A 2FSIA 4UXJA 2I3BA 3U3KA 4JIMA 2ZI7A 1HQCA 3OEHA 1ONBA 5EZ5A 1NNEA 2JLSA 1NIPA 1WQ1R 4Z54A 5JRZA 4KAXA 1Q1QA 1OFTA 1DE0A 2GZHA 1CJKC 1XCGB 1XB2A 3EIHA 4UQOA 2ELIA 1HUQA 5FTJA 3V9PA 2PCLA 5DYIA 4BFYA 2RGGA 4RSGA 2YJTD 4TL7A 3SI7A 2GJKA 1Z2AA 2RH5A 1BOFA 2IHYA 4C9BA 1KGDA 1XX6A 1OYWA 1GRQA 1XJ0A 5EXTA 1ELOA 2CL6X 2E73A 1G41A 2LKDA 3KKQA 4GPTA 4URZR 1Z0JA 2AFIE 2CLDX 4KFRA 2OAQ1 4Q01A 1W0JA 2W6ID 3GJ5A 2LWIA 4OI2A 3PEVA 1O3YA 5DE3A 3KB2A 1CIPA 1NSTA 3QNUA 3G82C 4Q7JB 4X8MA 5D3QA 3CLVA 1FQKA 3VX4A 4DSOA 3KQLA 2FSFA 4LJ9A 3B9QA 4EFLA 2Q9AA 2W2VA 2ZRNA 3JZMA 521PA 2MMGA 3CKLA 2VYFA 4Q18A 4KO8A 1TMKA 2FFQA 1P2UA 4QFMA 3UIEA 1GVNB 3T06B 3X2SA 5ELXA 3ADBA 4UNQA 2NO1A 1N6HA 2HXYA 2ERXA 2ZJZA 4JLPA 3E5HA 3GLHE 2UZ3A 2Q6TA 5A5GA 3VKHA 2ZREA 2R6AA 3W3ZB 4NYMR 2J7PD 1GILA 3QG5A 4GP7A 5CB8A 2C04A 4LJ6A 2PJZA 1RE0A 1WP9A 3AF1A 3CNLA 2FGJA 3K70B 4NYJR 4EPRA 1MABA 5HCIA 4HLQB 1G17A 1I4DD 1E9FA 3TSWA 3KTAA 1OJLA 3W9YA 2QAJA 2GCPA 4LYJA 4A0RA 1OXSC 2GJSA 2PH1A 1OV4A 4RCZA 3EZ6A 5KDDA 2OFWA 3SEAA 1AKYA 2WIBA 1KSHA 4MKIA 3KJGA 1UADA 3FGNA 3SC3A 3H1TA 1YZQA 2YOGA 2PX0A 3QPWA 4QBFA 3IKJA 4DLUA 5FUXA 2CVFA 4X8HA 4AKGA 1JR3A 1KNQA 3VR1A 3EPLA 2BJVA 1N6RA 1VCIA 2GETA 1QHYA 5IDVA 2CE2X 3K70C 1KI4A 3QF7A 2NPIA 3NTUA 4Q03A 2C8VA 4DDWA 1BYIA 3QVUA 3PEWA 2EFCB 1OFUX 3U7FB 3VFDA 1V5WA 2ENNA 4Q9JA 4GFDA 1T6NA 4DXAA 2DWQA 3LBNA 1ZC4A 3M1IA 4A1FA 1DTSA 4W7SA 1GUAA 1L4YA 4B74A 1ZM9A 5JI3E 1MH1A 2Z4RA 5JHHB 4QRHA 3QY0A 4PC1A 1FX0A 1XCPA 3P1JA 1P6XA 2BBSA 2WBLC 1E0JA 4HLUA 1X86B 3EC1A 3GEHA 1KYIA 4TMKA 4ASUD 4P4TA 3DDCA 4Q00A 4NYMQ 4TMXA 5HE8A 3GLIA 1Z2CA 2GCOA 1WBDA 2PT7A 4BRWA 1P2TA 5GJWC 1KDOA 1NN5A 2ZSDA 3GQBA 2AX4A 4BFVA 1JECA 2A3RA 4BLPA 1TL7C 3QUSA 4F4IA 3L0OA 1DELA 2IX3A 4E07A 1II0A 2A7QA 2VH5R 3CZPA 1TF2A 1Q0UA 1Y3AA 2CCKA 3QXSA 2RGCA 3TUJC 3KJHA 3DVLA 1JB1A 2JIZA 3C41J 3MGCA 5DI3A 1U94A 2ZYVX 3A1UA 4G5SA 1Z6YA 1F2TB 2OT3B 1G64A 3LBIA 3OEHD 4DT1B 4PPGA 1RPZA 2ORVA 2CMKA 5CIQA 4DSUA 3Q72A 4HZUA 2QPAA 3SYLA 4ZKEA 1N5JA 3QSYA 3WBKA 2GBLA 4BEBA 1FP7A 4NCKA 1N6IA 1E2QA 1NG1A 1YZTA 1CJVC 2WMNB 4OJQA 3AUYA 4DLSA 4WOPA 5FOSA 4LY6A 2ZRMA 1TBOA 5CJPA 2FG5A 4PFSA 4URWR 2VHCA 3OAAD 3DKVA 4OQXA 1JQJC 1OYYA 3UANA 4QHTA 4C7OB 1JPJA 4S2EA 2Z0MA 4BWYA 1R0WA 4ZIRA 1Q12A 2WMOB 4QGGA 4JSTA 2QPOA 4B3GA 5J40A 121PA 3OF5A 3KFXA 1JJVA 1XD2B 3GJ4A 4P32A 5F2EA 1KBEA 3MFYA 1SXJC 1MO3A 4IOKA 5KSPA 5EXPA 4LHVA 4AK9A 3RNLA 5FBLB 4DDVA 1ZUNB 2RKOA 2O0KA 1VYVA 1ZM4A 2R62A 2Z83A 4D2IA 4ACAA 1C4OA 1LY1A 4Q48A 3BH6A 3SR0A 4D0GA 4RD2A 4TMVA 3LVQE 4V0ME 1YRAA 1FNNA 1OB2A 5JJLA 4BQSA 1CXZA 3WBJA 2WJIA 2O8EA 1EG7A 2OCBA 4JBYA 4HB0A 3AVWA 3HPQA 3EARA 3NH9A 4W9MC 1ZM7A 2DFNA 4P33A 5DSZA 4AKEA 2ZRHA 3BIFA 4NE2A 1J99A 2G77B 2W58A 3CNNA 3GLGA 2A2ZA 3SNHA 2PX3A 4A2QA 3A58B 1FQJA 3KKMA 5LB2A 3FPAA 3B1ZA 1K6MA 1RJ9B 2J59A 4HZUB 5AUPB 4C0LA 3THWB 5IT5A 4ERNA 5EP3A 4AY2A 2ROWA 2RGXA 4W5HA 5TARA 3L8YA 1AS3A 5D3MA 4B33A 1TF5A 5DN6D 1LS1A 3NWJA 4XD7A 1E2NA 4WBSA 1XZQA 4CYMA 2YWFA 4WA7A 2GWHA 1HT2E 2WOOA 4N0EA 2GCOB 1E6CA 1RRPA 5H70A 4DCTA 4B73A 4L15A 3B1WA 1F2TA 2EQBA 3KKOA 3QKRA 3OEED 1X1SA 3QXHA 3ZGXA 1BMFA 4MGKR 4Q66C 1UKVY 4B6EA 2ZYWX 1XD2A 2DPXA 1HYQA 4XSGA 5AUOB 1R7RA 2V55B 3TSOA 4BE7B 4ABYA 4DEXA 1L4UA 5H68A 3QVVA 2LCFA 3BAFA 5H1YA 4KXFB 4G01B 3T1VA 1JAHA 4D0LB 4EPTA 4TMZA 3M6AA 2IUUA 2QGNA 1W47A 4P4UA 1IXSB 2OBMA 2RGNA 4IHQA 1HEIA 3HP1A 3D7MA 4PZYA 1XPRA 1EK0A 1NMXA 2R6FA 5CM9C 3SU8A 4C0JA 1ZP6A 3NC0C 1QBKC 2ZR9A 3I3SR 3N2EA 1MRSA 1DG3A 1AM4D 2GK7A 3B13B 4A8JB 3REGA 3UKDA 4M1SA 4NPHA 1EFUA 1S4QA 4V0MA 3PXGA 1IY1A 1UEIA 2JLRA 4YDSA 1W4CA 3OE7A 2BKEA 2I4IA 2FH5B 3FFBA 3QQ5A 4PC6A 4CT5A 1GKIA 3HYRA 3VNVA 1OH7A 3I1FA 1SXJA 2HT1A 2HCJB 1E9BA 2CHVA 1KTVA 4PC7A 2PL3A 5JFGA 1GNQA 2HUPA 2IF2A 2AWNA 1P73A 2R6DA 2JAQA 1N5KA 3F5FA 5FPHA 4HAYA 3TH5A 3O47A 1NLYA 3PVSA 1OH6A 3AVOA 4YXWA 3ZQ6A 3ZQJA 1Q3TA 1SULA 2YWHA 1OIWA 3C5CA 2WKRA 2QBYB 2BCJQ 1T5IA 3KB1A 2FGKA 2H16A 1FMJA 4AG5A 1G19A 3HDTA 4RD1A 2XZLA 5HTKA 2E1RA 2KWIA 4M8NE 1YHNA 3PEYA 3VTKA
chains in the Genus database with same CATH superfamily
5G0TA 1DUVG 2Y1KA 3MJDA 5KX5B 3VKGA 3CBGA 5EE3A 5IM4A 1O54A 1JHAA 1EM8B 2C3OA 4G1UC 4N54A 1P0PA 3W4KA 1EWTA 4L73A 1YB7A 4C01A 4I19A 1FJHA 4WECA 4B7UA 1KEEA 4HR7A 1XQXA 5B2FA 1ETUA 2YHUA 1EVEA 2YINC 1USWA 1W85A 1G3IA 1GNSA 3TBHA 3G9XA 3SC2A 3MYYA 4IQGA 4YCSA 1OI7A 4L16A 5HKKA 1OI4A 1N6KA 4JLAA 5EIBC 4RQBA 4ZRNA 5BNFA 1AK9A 3CY6A 4O2LA 3U4GA 2ZJAA 4S3MA 1ML4A 3IL2A 3CTPA 4YRMA 3O4HA 5C8YA 4I4LA 4NDNE 2BEKA 4QDTA 3C3AA 3S4YA 4AJ2A 4EG4A 1JJFA 1KJWA 1TUEA 5EZQA 3R20A 3HO6A 3BWVA 4M99A 4NOMA 2XHEA 2V6JA 1WOMA 4QICA 1P6QA 1M8GA 1XSEA 5ALDA 3P0HA 3I9FA 1LK0A 5IEBA 4H7PA 2P9BA 3BJEA 1QGOA 2Y1LA 2CXXA 1QWSA 4I1OA 1R27A 1EINA 1BKYA 3LK7A 3RWOA 1OD6A 1PEAA 1M0EA 2CV2A 1V37A 4BNIA 2L18A 2SHKA 5EYPA 3DZGA 2FWBA 5JAZA 1UJ5A 1MAAA 3GFQA 2WTNA 1M5RA 1OU4A 2YW9A 4FD3A 1KDTA 1HE1C 1TPYA 4R0NA 3VKWA 3E22B 1V7QA 4MB6A 1EXWA 1FFXA 2O7QA 3OF3A 1EWQA 4INOA 3I64A 5ALHA 4B8YA 1W2GA 3LQQA 3OZCA 3IP9A 2FZ4A 3F90A 2I03A 3FLAA 2AYZA 1WKBA 4IJKA 4CPDA 4BCDA 3CXRA 1GSHA 3BD7A 2Y1CA 1DIGA 2EG9A 3IAS6 5HW0A 2FPWA 1ZUIA 3P9PA 5D6NA 4E4YA 1QE0A 2H4FA 2H5EA 2G9QA 1I4EB 4KLNA 4RKYA 4Y2TA 3WL5A 2OD9A 3W4IA 4AZWA 3NTQA 4ENSA 1JF8A 3D7KA 2C2KA 3P4YA 1MRZA 5KQRA 3L6UA 2VDMB 1Q20A 5IJZA 4A0SA 1EVIA 4KX5A 4HEHA 3RSCA 3FFAA 1M8FA 4G9EA 2C57A 2GD6A 3R9XA 3DEIA 4ZQEA 4GDFA 4RD4A 2Y27A 4BO3A 4E6EA 1QQ5A 1US8B 2DCMA 2P4HX 1ZGZA 2O4CA 3DV0B 3PU6A 1WGCA 1GA6A 4GKAA 5DXJA 1ACLA 3GH1A 3N6VA 3ZDBA 1EHIA 3DAFA 4GKKB 3IE0A 3UGLA 1AO3A 3KZKA 4GZLA 4QBHA 2ZWIA 1A76A 3LF2A 4GE3A 4DQUA 1GN9A 1LX7A 3PFCA 4G67A 4JGGA 4RABA 3CJRA 4I3GA 4C0QC 3PCTA 4PX2A 4HYEA 5FTMA 4RTSA 4FHEA 4OXNA 4IEFB 5EMNA 2W2LD 2WVJA 2QW0X 2AXEA 4V24A 4AJ1A 5B7NA 3WA7A 4HS4A 3DVAA 4H7DA 4TKMA 1QE5A 2QRKA 3DDSA 3U7QA 4B4KA 3BRWA 4P5EA 1NN3A 3HFRA 3QELA 1AN9A 1MJBA 7WGAA 2V98A 4PTZA 1FLVA 5EIFA 4ZGWA 5A04A 2VYVA 3GBVA 2OUKA 2XNSA 1YQQA 1QRAA 2C95A 3K2BA 5DYGA 5CA1A 3NBFA 1OIXA 2IYRA 3RRYA 1MORA 2DXIA 2CMFA 2EJTA 2IYLD 2K87A 4XFDA 4IQFA 4OFBA 4B2IA 4LFCB 3AETA 3UV6A 5DGXA 3AH8A 1N5RA 2P1ZA 2Q5LA 2KCXA 2BFEB 2AMJA 2XE4A 5HZHA 2BKLA 2GKTI 3H87A 1JHXA 3GT7A 4Q37A 4AY4A 5DPMA 5JNWA 4OIMA 2VQEB 1E6MA 1NRWA 2I33A 5KYUB 2AXPA 1BDIA 5J23A 4ODIA 2PLRA 1D4ZA 1QP8A 2FPOA 3FCCA 1BA2A 4A9AA 2UXDB 1SC4A 1Z7EA 5A6VA 1XZGA 2QSJA 3SX4A 3L3BA 3QE9Y 4YROA 4U00A 5KSZA 1D6SA 3E7FA 2FOIA 3GYBA 3PUVA 5AO9A 3W8RA 4ZHSA 3FMGA 1Q57A 3FE2A 4RHUA 4EB3A 3O73A 3B4VC 2C5LA 3QLEA 3KUCA 1M1NB 3CNHA 3EWNA 1XKLA 2OHOA 5E6UA 2ZBDA 1CFZA 4F6CA 2F1JA 3QWBA 4MEBA 1JFTA 1NR5A 2XGOA 4X1YB 1AF7A 3H8VA 2CNLA 1TC2A 2KE5A 4PQRA 1H2BA 3WGLA 4BLSA 5JD5A 1OLSA 3I2HA 5AHWA 4X91A 4HVLA 2C88A 3K5IA 4Q9LA 1UXJA 2QUKA 1S3FA 2IX9A 1NMYA 2JFOA 5EE9A 4BV8A 2YRXA 4A3SA 1ZN7A 3ZE7A 5JS7A 2AOWA 1H05A 2XUJA 1KF0A 4OXIA 5H7XA 3R7DA 1O5OA 2XDAA 2ODTX 2A0UA 4D8UA 4JIGA 2KBEA 1EE2A 4OOFA 2KS6A 1GUBA 2GJ9A 3GJ8A 1QBGA 2VKQA 2XCIA 2ZRJA 3KS9A 4WN9B 3K09C 1TEZA 1OILA 3H3JA 221PA 4J0CA 2CL0X 3D6NB 4BP8A 1BOOA 1J2EA 3KXPA 3RASA 5JISA 4MPDA 3DLBA 1WAMA 3MTEA 4MYHA 1IWOA 3QA3E 1KY5A 2BHTA 3ED5A 4JLMA 5CB4F 1FLDA 5FV4A 2QN9A 5H4GA 4OLAA 5AJZA 1QS0A 1E2HA 1O0BA 2ECKA 3ETDA 5J4YA 1GPBA 2BR4A 2H7XA 2JZNA 3KT0A 3QBDA 4W4TA 5JG7A 1T43A 1MX1A 2OEPA 3E18A 3ORYA 4HYTA 4PZLA 2B1GA 3PLRA 3G3EA 3K1YA 3REQB 4RYLA 2IU0A 3TTVA 3ZBUA 2H5IA 3FMPB 1FTWA 3G5LA 1OYOA 1N0VC 4CODB 4JUAA 3KT3A 4PAOA 2I2BA 4WD3A 4ZPXA 1R3UA 4OM8A 4J49A 2M9MA 4G5XA 3W7VA 1U4NA 4EPXA 1NL3A 4GM0A 4P7BA 5J5CA 1ISPA 2F3RA 2M6KA 3OCJA 5IDWA 4U5QA 1P2VA 2PTGA 1WOYA 2X1HA 1JYEA 3PEUA 2PNJA 3DZJA 3E0QA 4RZSA 1PLJA 1TKRA 3OVOA 3ZXUB 3PKJA 4GZMA 1FYXA 2O8NA 3CINA 4P36A 1GRVA 5E6UB 4EB0A 4ZJPA 3HVJA 5KC9A 1NQ5A 2X5NA 4CIDA 3IAAA 3KOUA 3RW9A 1U2TA 2I4NA 1Z5WA 2NNWB 4FT4A 4IJ6A 2FZVA 4JUBA 5TMDA 3V1KA 1LH0A 4DN6A 1YMUA 2VAPA 3EHDA 4BATA 3WLKX 1YRQA 2GPYA 2OHJA 4KWTA 4RIFA 4A0FA 3K0SA 2VQ3A 2H17A 3GY0A 2GKVA 1ESEA 1UF9A 2IYZA 1V1RA 4FHFA 4QQ8A 1EWRA 5TR9A 2FKNA 1ECBA 2ZROA 3PC8C 3RS7A 4OHKA 4GOND 5BSKA 5KTMA 4IW3B 5TMPA 1TM3E 1Q21A 4P86A 1OFGA 3DNMA 1WB4A 2HNBA 1LLFA 3C8DA 1S2IA 2IEAA 3TINA 3H1GA 2OV2A 2G8LA 3NGMA 1RHKA 4WERA 3FCUB 3CNBA 1PS8A 4II3A 4EJSC 2FX2A 1SPBS 4JI6B 3WYCA 4CUKA 4FGSA 4TLAA 4CMIB 3GQVA 1XJQA 2ON6A 4IUBS 4YNBA 2OFPA 4ZYTA 4OK6A 1CFJA 2H9IA 2P9EA 1M3SA 1ZKMA 3LXXA 4JEMA 4X00A 5I6DA 4IY1A 3GWZA 4I1PA 4UQPA 2VZ8A 1BXKA 1FPMA 3P9SA 1NKVA 1Z5OA 1QGZA 2WSSA 4GMGA 4IH9A 9LDTA 4CI9A 5B58T 1DXHA 1WULS 4S1VA 4J16C 3NHFA 3VTFA 2WMYA 1GEEA 4ZVMA 2JFYA 3QELB 3U3DA 1I24A 4TLDA 2QQDA 5DHAA 4Z4IA 3R3HA 4YB8A 4MPTA 2GK4A 4ZYWA 2O57A 3HEMA 4LF5B 1TM5E 5KNDA 1BNCA 1OIVA 2HUNA 4QJ5A 3ZDFA 3ICQB 4LXHA 3B3FA 4YFYA 1TJPB 3KR9A 4RV4A 4B75A 2NU8B 3EIFA 1FUKA 5TLSA 3VUFA 1V43A 2W2KB 4I9NA 3TAUA 1X74A 1P2DA 1H5NA 3VSDA 3COSA 1Q2UA 4P81A 3O4RA 2C4KA 1HKUA 1QZZA 3OM0A 5ENZA 2X0DA 3EPKA 4O3MA 2IYWA 3E84A 4BUZA 4RHTA 2B82A 1UBEA 3ZZTA 4DM4A 1I6KA 1A8PA 2W9XA 1QDUA 1I9GA 2XTAA 3BGIA 3C5WP 4HK4A 4YRCA 3FOBA 3RJ5A 3RVSA 1XP5A 4B6FA 5EWMB 2G5GX 3CT6A 2RBGA 4W9RA 2SKDA 1EXMA 4KYIB 4LKRA 3WK4A 1ZSYA 1NV9A 5CLIA 1CUDA 4WP4A 4FIDA 1NRXA 1YJBA 1DUIA 3BSFA 2VR1A 4O4IA 1KKLA 2B1IA 4ON9A 3AWIA 2O8FB 3W77A 1Q0TA 3G2KA 3SDBA 3R3JA 2WABA 1R37A 1U63A 3W3AD 1ZIXA 4RIGA 1UVGA 2XDYA 5EKSA 2XITA 3L9WA 5E1MA 5BN5B 4B6JA 2ZSHA 4BQEA 2Q5IA 2SGFI 4HUQA 5ICMA 1UZNA 3RIYA 5SZJA 3GL9A 2OLEA 3E9NA 5DYNA 4R3NA 1YTLA 3QQPA 1GTMA 3IDFA 1FFXB 3HL0A 1CUAA 1Q0SA 2ODDA 2B35A 2DG2A 2GXUA 1UPBA 3SYTA 5I9IA 5EYPB 3NOQA 2D1FA 4CMAA 1JIVA 3B5IA 4EBFA 1N1EA 3ZU6A 4C1NA 1I2AA 2EBWA 1PN3A 4GVXA 3ZWCA 4AJKA 1BROA 4XJTA 1UAGA 4RJJA 2K5UA 4YK7A 1I7SB 4LOHA 4AMGA 5JJBA 3EAGA 1GZSA 2QL7A 3B8HA 4L0MA 3QVLA 4M0FA 4QE3A 4H7EA 4YHBA 3CE9A 1NJ2A 3SM3A 2D2EA 1UPTA 3OX3A 4W1RA 3CB4A 1GQFA 1Q7EA 3GB9A 1O96B 2ZJ6A 3O8OA 1W9HA 4KL8S 3I6YA 3RFUA 3UT5A 1YB4A 4JLBA 3OPMA 3LUPA 2YCBA 2ZE6A 4ARZA 4ZOLA 1F3LA 3MTQA 4KXUA 5LWQA 2JLVA 1WL8A 1NVMB 3PIDA 1VG0B 2XTMA 3RSHA 4OK3A 4EEKA 5JMTA 2CYAA 2EGGA 3TO7A 2J5XA 1I7DA 1UP6A 1V39A 2I1QA 1M8CA 3DUFA 3REQA 2PSFA 1T9GR 3W8FA 5FYDA 3QENA 1DX9A 4PR3A 1W85B 3RVLA 2OO5A 3FETA 4L9SA 4FFNA 3I52A 3D3WB 1B6SA 2YFKA 3TLEA 3K6SB 1VPTA 2LXNA 4F6RA 2VP5A 1VFPA 1R0KA 2UZ0A 3RSOA 1I30A 4TLBA 1WMEA 2DPYA 4YLEA 3SFZA 1Z5VA 3KPVA 4R8RA 1E1RD 4XGKA 4WSOA 4Y2GA 3E8SA 3PQCA 4Z7QB 3DMHA 2IXFA 2VNKA 3OE5A 4MKHA 5EINA 1DQZA 3IAUA 1ABFA 1HEVA 2G83A 3DTVA 4R2LA 3DOFA 5ERYA 3TGLA 4Q1DA 1TLTA 4YX9A 3T4UA 5KYNA 3GD5A 1MDBA 3EULA 3HYNA 5HOQA 4M22A 5K0BA 1QHGA 1HR0B 1U5KA 5JHWC 1THMA 1Z7YA 2BVNA 3IAFA 4JP2A 1DC5A 1NT2A 2JD2A 2YXBA 3CIOA 3M6FA 4OLFA 4PO1A 2VDRB 2B2CA 4A0GA 3W6NA 1O9GA 1R79A 3RAGA 4RV5A 1ZD9A 3A6LA 1IW4A 2IY8A 4ZCSA 4A03A 4KG7A 1SFRA 3FOCA 5AKZA 5TPWB 4L85A 1WMDA 3E3LA 4TV9F 1FTNA 4ILEA 2WEKA 4L7VA 3UA3A 1K6IA 3WL4A 4A73A 3B6MA 3G1UA 2JKVA 5CD1A 2G40A 5AHRA 2OCXA 2RH8A 1NT4A 2V9CA 3N8HA 1JQ3A 5B30A 1Z37A 5K09A 2J41A 4TQAA 1FU7A 3ASVA 1U2PA 1W30A 4H7IA 3OO0A 2PBRA 3RHFA 5A0TA 5TGDA 1BKDR 5K8CA 3OCZA 1CLUA 3GCZA 4RL4A 1EM6A 3W7BA 1K3FA 3K9CA 4FJ2A 4L8YA 3VJLA 4DWWA 4WEQA 3G0CA 2WHPA 4FZVA 2AKYA 3HEAA 2GILA 3P32A 5FORA 1RRKA 4PWZA 5A4JA 1XE3A 4FD2A 2RC5A 2V53A 4OHXA 3QY9A 1SK9A 3DZ8A 4G1MB 3IIKA 3DVSX 4BFZA 1WTAA 3QEKA 3RSSA 4RMGA 1R9MA 4GH5A 3X1MA 3EMKA 2CNBA 5F52A 2QMEA 1M6NA 3K9LA 2L69A 1QIJA 4JCCA 1P29A 3IUNA 4UEJA 4F72A 1ZRHA 3K6SA 3KSUA 3V8VA 1UKAA 4AT1A 2FR0A 3L84A 1I2BA 2OP1A 1U2ZA 1AUPA 2EX1A 2O0JA 5BOSB 4BBAA 4R1MA 1Y8AA 3J81k 1OVOA 3IKLA 1L4MA 3FNHA 4WFQA 1HQDA 3FVQA 5EA2A 4KUEA 1VJ0A 1E94E 3KLPX 5AJWA 4F9TA 4D25A 3CPSA 3A1TA 3IMKA 4U39A 3O84A 4PPNA 1CC1S 2PGNA 3KYDA 3TLXA 3LZ6A 1KEWA 1WS6A 2QN3A 3A31A 2E3JA 2ZS7A 1ZGBA 4PO9A 4HKTA 1OZGA 1NYRA 4MICA 1NP3A 3OPYI 3W8EA 1M2FA 1QLHA 3C1TA 4WPGA 1HQYE 5DULA 5FA6A 4OLBA 1F0YA 1EPUA 4I46A 4F6LA 3G7SA 5EQJB 3VU1A 3LGAA 1GCOA 3QMWA 4F0JA 1Q7BA 4JFAA 2F1HA 2AQKA 2QG4A 1Q7CA 4G5FA 3QVJA 1JSLA 1QV9A 4JP8A 1OA0A 821PA 2ZXUA 2WPDD 4X95A 3KG2A 3OZUA 1GZ7A 4HAVA 3IUMA 2A1TR 3UHFA 3EVEA 1KJYA 1L4EA 4ENVA 1SQ5A 3GRAA 1RZRA 2I7DA 2IBMA 2FDRA 3JARA 4R51A 3OQNA 3T3PB 4LQCA 2TMKA 5KPDA 5ALJA 2AK2A 5A1TA 2F9LA 5KHLB 1VPDA 1IPEA 1I3KA 4YAKA 5CG1A 1HPTA 2AJDA 1ZR2A 1OOEA 3LSYA 4MCAA 1WHTB 8OHMA 1E63A 3ZYZA 3U17A 4BNFA 4IIYA 3P0FA 5AK3A 4YP7A 5ITSA 1C1YA 1XZKA 2NO9A 3V2UA 2ODEA 1WHSA 3D43A 4LYHA 3K71B 4JXXA 2BGGA 2DZDA 2PN1A 2CZCA 1MOZA 4FCVA 2ZTUA 3W2HA 4F8YA 4AJPA 3G9ZA 5JJIA 2AZMA 4O4IB 3HXMA 4J4HA 1IN7A 3KHTA 1LPSA 1N1MA 2GN8A 2W6CX 2WKSA 3QMVA 4IG9A 1ZOIA 4TROA 3U9LA 3VGJA 5CB6A 2BSAA 5BMVF 4XLTA 1IQ0A 1C3JA 1K5DA 1Q2XA 2GXQA 2BL4A 2R47A 2YQ4A 3Q10A 4OHUA 5EWJB 3TG8A 2R6GA 3X1XA 3K0KA 3Q0EA 4ZAXA 1MHTA 2PUGA 2I3GA 1AKWA 2VQ6A 4XR9A 3D5TA 1NF8A 2A9OA 2HM7A 3I9NA 4HO1X 4PX3A 2E48A 1Y48E 4RMNA 1N2IA 2INGX 1KIMA 5HEKA 1T3TA 3DSRA 3OD1A 2H2WA 3K4HA 4NDZA 3UJ6A 2WIGA 1RPNA 3BTSA 2IHKA 4QD3A 4RHCA 3UM9A 3ZGVA 1BCRB 1IM8A 4KR9A 4F3CA 1NM5C 2YXLA 4NFHA 3FBWA 1E7YA 1VA4A 1WZUA 1QO9A 2PUWA 3VC7A 3GOHA 4ZT3A 3STHA 2CV1A 4U9HS 2IS2A 5FAXA 1D2MA 1T0HB 2ECFA 2CXNA 3BJIA 1DWPA 4NIMA 1PWEA 3EK2A 1YI8A 2AOTA 3I9V6 1M2VB 4LI0A 5DM70 1ZIOA 4FBMA 3B1VA 3S1LA 1P75A 1DTWA 4YJ2F 2QUAA 3FB4A 3JVIA 3WHLA 1P7WA 1S7CA 1O97D 3QEMB 3MBKA 4GOMD 1IHUA 2R60A 3KVRA 3FOWA 3TD9A 3FIUA 3W9UA 1P2SA 1RJ9A 2N3ZA 3DWFA 3RFXA 2H7VA 3THWA 2CD7A 1JAXA 4BNWA 2VPQA 2V1CC 3FR8A 3PNKA 5KOJB 2ZRQA 4A2CA 4DXDA 5KNCH 3JZIA 3IPYA 5E9JA 5ETJA 5F9MA 3LT5A 2J32A 3W2EA 3WQHA 4MW7A 5C8VA 1WSWA 5DH9A 3I5XA 4U7GA 2JCSA 4PQEA 1E3MA 4IOLA 1DKPA 1GGEA 1ZISA 2Z08A 4JL6A 1RXUA 4FINA 4BZQA 1GTVA 3W5SA 5H9VA 4TT3A 2JFQA 4GGPA 2CSUA 1SD2A 2VRNA 3HBNA 3O2JA 4QXOA 5EJ5A 1MQ8B 2GVZC 1M6WA 1SXIA 1GKLA 3N2KA 4HAXA 1RBYA 2E5RA 4E03A 2H85A 1P8JA 3BXGA 1J07A 1HTWA 5EL0A 3VH1A 3EAQA 4R3UC 3OLWA 2Q99A 2I8AA 1GPLA 4YACA 5JNSA 1UFQA 2P67A 1UFRA 2QLFA 4HJRA 5EIBD 2PFKA 1EB8A 2WF7A 4JC8A 2ZR0A 4BHTA 3GPIA 1JIUA 1RTTA 2QU8A 1UQRA 4G1BA 3RC1A 1DKOA 3I37X 3NWBA 3ONFA 4LOAA 1G21A 1VL5A 1D0SA 4FYYA 1H6AA 3BE4A 4D57A 1KZHA 4DC1A 4OI4A 4F2HA 1TM2A 2Y9MB 4POAA 2CCJA 4CCYA 3NBMA 4M1EA 1ZS9A 2VIIA 5BQ5A 4M6WB 1IQRA 1R00A 1WSDA 3KCNA 2WJHA 4DSAA 1WUYA 5B7QA 1H2RS 1NVEA 1Y34E 4NCXA 1B1CA 2B2NA 4XUCA 1EVYA 1J7KA 2XYVA 5IAGA 3VO9A 1W0JD 1ZJYA 1GG8A 3GDWA 4YAUA 1SGEI 1IY0A 5L6MB 4RDCA 4UUMA 3SBEA 3UMVA 2RBKA 3OUZA 2JLBA 2PZGA 4JD5A 3BC1A 3ET5A 4YMVA 1X70A 3CONA 1EEXB 1Z4PX 2XKAA 4TQUS 1ORVA 1A9TA 1OV6A 1EP3B 2B69A 1TUSA 1C9MA 2XTNA 3CISA 1GHTA 4KGXA 1EYZA 3MVEA 4JHLA 4QUHA 4YTEA 4RENA 1HT0A 3NVAA 4DY4A 5F76A 3BT7A 3L1JA 3LC2O 2HPZA 1HEUA 4LECA 1PQWA 2WV7A 4HBGA 4YCMA 1U0EA 4BO7A 1Z5ZA 4O08A 2RIRA 1KI6A 3ICCA 4WN9A 3WIOA 4EW2A 5LIPA 4MITA 4LWZA 2ATXA 2YNMA 3A11A 5JARA 1EH5A 1LZKA 1N78A 4YDHB 3EWAA 5ARCA 5JPDA 2X3UA 4F3RA 2ZW9A 2O7SA 4FXPA 4HX9A 3ILHA 4ESEA 1IHYA 1Z5NA 1LTQA 2HFJA 2W6OA 4FGLA 3SQMA 4B81A 2XUKA 3I01M 1T0JB 2FSHA 3HU5A 4W5JA 4BE4A 4DLVA 2MINA 2HXSA 3QKSA 1CR6A 4HQKA 1SCUA 4LHWA 1DIRA 5JPIA 3LT1A 4AROA 5ADHA 1G21B 4WKPA 3SEKC 5BV2P 1K68A 4NJOA 5HRUA 1M73E 1TD9A 4N8SA 3W2GA 3Q5EA 4B5LA 5ESDA 4X94A 1I0IA 3QG1A 2DQSA 4MDYA 2AL7A 1CT0I 2GYYA 3COPA 3P96A 4FYKA 3DJFA 3VMMA 4MVJP 4ANFA 3Q8MA 5IMBA 2ZUFA 1N1GA 1YSCA 2G6BA 4QOSA 1F1BA 4Y1RA 2FUCA 1ULKA 1DEKA 4OHVA 2OFXA 3LDAA 2Z9CA 1G9TA 2D1RA 2WYWA 2KB0A 1L9XA 4GHWA 4KFUA 3CXUA 1DRUA 4OUDB 4MP8A 1IY5A 3TLZA 5LU9A 4O8ZA 2HBZA 2IUTA 1D2GA 4RK5A 4ERXA 3KXIA 2QI9C 3K20A 4QODA 2C7GA 4CHGA 4Q9KA 2JL1A 4D4LA 2WNHA 3WJ7A 2P3SA 2I80A 1BXGA 3AJ8A 1TKBA 2DUUA 2JLAA 2R68A 2WVHA 3UENA 4E88A 2HLDD 3MRXA 1AQJA 3GOXA 3OHMA 4OQNA 4XPIA 2EEPA 4Y6OA 3S5JA 1DKQA 4YT2A 3C14C 4PLFA 1VHLA 3R6LA 1SHKA 3KTDA 4ZALA 1GM5A 1S4MA 3SHFA 1VHJA 2ZYAA 3RBZA 2XLBA 3I73A 3O38A 3R6TA 4XX0B 1RZ3A 3IT3A 3F73A 2DRIA 2WG1A 5LP6B 3X44A 2MR5A 4B6DA 1X9HA 3FLBA 3KAQA 3OY2A 1X1AA 3VOTA 4TKUA 3AIMA 3RUAA 4WHMA 1ZCJA 1BG6A 2VA8A 4KSCA 4ZCLA 2QD4A 3NBQA 2H4XA 4RY2A 1E1MA 1RAFA 2FAXA 4G4GA 4R4JA 2DMRA 3EEIA 3WGZA 2ZYRA 4BDSA 1OHHD 5FV7A 3VJMA 1ORHA 3MTJA 2VF4X 2DQ4A 2G67A 4NJEA 1YQWA 5D51S 5L3ZA 1HE5A 3SS9X 4AMVA 2O50A 2MWMA 2VJAA 4FEAA 5FULA 1ZJZA 1QTIA 4PAMA 4LGYA 4UJ3A 3ROTA 2IZ6A 4TS3A 2X8AA 2AI1A 3KDSE 3V6MA 1EQUA 3OPXA 3WNVA 1TJ3A 1YACA 5AVKA 1JB9A 1U9IC 1Q84A 1JU4A 3EXIA 1K98A 2ZYUX 4QO8A 4US0R 2HU5A 4Q4AA 4XJXA 3TOXA 7MHTA 1DXOA 4WLVA 2QTHA 3A6ZA 4OHWA 3AIOA 1UP4A 4MWOA 2HMWA 4QEKA 1UQTA 5KNLA 5ITWA 2PKRA 3G5AA 3S28A 3K1ZA 2WPNA 1GKYA 1U7TA 3F47A 3KEGA 4EKYA 1XZBA 5EWLB 3DAPA 5FBVB 3ZKAA 2FA9A 1JSXA 1G2QA 5AW6A 2G9UA 5JSYA 2R86A 3R23A 3R7BA 1FRVA 1XUOA 4ILKA 3EXG1 3I9OA 1NLMA 4Y6SA 1R8JA 4IOMA 2VDLB 4KFTA 3WB1A 4OG2A 3OH8A 5E95A 2BISA 2D2FA 3NETA 3AM4A 3UQZA 1PRYA 2JIMA 3BVPA 5B3JA 1MVOA 4DDUA 3LNCA 3LPLA 2XSZD 5JXIA 2YV2A 5JJKA 1NYTA 2V65A 2YN0A 3CZQA 3W8NA 3TQHA 2FXIA 2Q9CA 5SY9A 2RI6A 3MRSA 1YR2A 3T0IA 2PX5A 3AB7A 1UBHS 2YXDA 3VR5A 1WUIS 3VU9B 3AB3A 3DEKA 4AJEA 3RSLA 4EL5A 4D81A 1NLUA 1QH1A 3T4PA 2ZTVA 3JARB 2EOAA 2HIAA 4YR9A 2JDID 3A1DA 2FNFX 1PGOA 4BVLA 4KE7A 2WHXA 3S7ZA 2YKGA 5E7JA 2X41A 3LWDA 1Y33E 3QITA 1X8KA 1Z6TA 1UJMA 2B5VA 2ZJOA 4MV1A 3VR6A 3PUYA 1KQOA 4CM7A 4TUYB 2BYTA 2QYHA 3HDYA 3FSYA 1IBCA 1RYHA 4ZTZB 1L5KA 4YJ3B 4EJMA 1Z2OX 1ZK0A 2C2YA 3G5UA 4V0LA 2AUMA 3AEUB 3ZVNA 1G5PA 2XW6A 4P35A 2QI9F 2XOXA 1ZMXA 4BQQA 1VPVA 1H8ED 2OY0A 5DWQA 2N46A 1UXIA 1VMIA 1XPUA 1XF9A 1LR9A 3IMGA 1QQ7A 2O2JA 3H3XA 1AKRA 2IVZA 5K3EA 4MS1B 1XQVA 3T99A 4JUDX 4AO8A 1G8PA 2A1UA 1OX5A 4RYDA 5C1DA 1TW3A 3GRFA 3CX6A 3AM5A 7ADHA 2I7VA 3OCUA 2C2MA 1X1EA 3EDQA 3NBXX 3DFFA 4IWNA 4QDUA 4RJLA 3D4IA 1UOEA 1WB6A 2FPSA 3A9WA 2GTHA 5FPQA 4F7WA 2J3QA 1XLUA 3Q9LA 2E5LB 3R41A 5BOSA 1I01A 1N75A 1U2DC 1U8CB 3SKXA 2SGEI 3AEQB 3BK1A 1IHDA 4UATA 2CLMB 4OU5A 2ZVDA 4I1IA 2YZKA 4QO7A 1Z07A 3D1VA 1XXHE 3ONNA 4QAQA 4RVNA 3OT4A 4L28A 4RMHA 4XYMA 2B8TA 2RGWA 1O08A 3DGFC 5AKGA 5FT9A 3RKRA 1OF1A 1H2WA 5JEEA 4HMOA 3T5AA 4U2DA 3K53A 5BWOA 2FEXA 1MENA 3QPDA 1Q91A 4R2XA 4WINA 3SNKA 2Z2KA 1DPFA 1UDBA 5DT2A 2TMGA 5IUNC 2WB2A 3NPAA 5LYJF 3D4NA 2FWAA 4XD7D 4PGAA 3CZAA 1VCHA 2CLIB 2DHCA 3LDUA 2RARA 4R01A 4IHKA 4UDYX 2XB2A 2BV3A 3ABQB 2CVOA 2GCNA 4NH4A 5LZ9A 4ZQIA 1GQOA 2HDOA 2XWJI 3A4LA 2KI5A 2I67A 1VYTA 3N3BC 1O94A 2Y66A 1VG1A 2RCYA 1UMCB 4G3XA 4N49A 1XAJA 4MAMA 5ALXA 5B5SA 1X7XB 3EPHA 3AERB 3VPFA 2H9YA 4GP9A 4LSWA 1OTXA 2AFVA 3HYTA 1Y6RA 1X77A 2WU1A 5D7BA 1QF7A 1RWQA 4JYZA 4MR7A 1AHPA 3T15A 1E64A 1KAQA 2AOVA 2JIBA 3O3OB 3UZUA 3ZZ0A 1P5FA 5KQGA 1WMBA 3DWIA 3GLUA 3OFJA 2ANBA 1DT5A 3KJXA 1V1IA 1GXSA 4XE5A 5GP1A 3WDLA 4BUJA 3BIJA 3O74A 1GPAA 2P79A 4OTZA 1Q11A 3NHBA 3EODA 5I9MA 1QF6A 2AJ8A 1FP6A 3MW8A 3EZYA 2LIVA 1TD1A 3LFTA 5E38A 3MC1A 4J9UE 2C5HA 2IE8A 1YDWA 1K4YA 1KH3A 1CRZA 2A6PA 1BFKA 1Z15A 2I6QA 2LVBA 3GYGA 3I9JA 3JVVA 3U44B 1I33A 5D87A 5AKEA 4Q6WA 3DEYX 1G6OA 1KI7A 3HJCA 2ZI4A 3PB3A 3WZMA 4D3YA 2GWRA 3QLVC 3DLCA 3LC0A 2Z5FA 3GXBA 4CQLB 5T8KA 1S0UA 2VTKA 1VJ5A 2JF0A 4UZEA 3GNQA 5IJ9A 1SGWA 4Y7CA 4Y6RA 4DAEA 1R9GA 3ZD6A 3WNCA 4CKZA 1YBFA 3PQ5A 3QEAZ 3A27A 3RU2A 5J4VA 1PLLA 2PMKA 1IN4A 1U3CA 2BCEA 2QRPA 4GZ6A 2IUEA 3V46A 4FWBA 4HQFA 7ABPA 2DBRA 3NCHA 2C5EA 1NP6A 4QOHA 4C6HA 3B1XA 4EUHA 4LRQA 2WF6A 3DXXA 3HUTA 4NVRA 5HG0A 3C3DA 4KSBA 3QWHA 2ZE5A 3G1TA 4RK7A 4NECA 5H82A 4GPD1 2UUCB 1XEAA 1QRTA 4R16A 5CXXA 2O2HA 3PSHA 3B6JA 2GTPA 3GAMA 4LJYA 3LIIA 1QB8A 2IUFA 2WAMA 1Z3CA 2TYSB 4QX6A 5A7GA 2YIVX 5FUYA 2OKCA 3VC3A 1FVFA 4R1SA 1BEUB 1FUUA 4RJKA 3BGOS 5L4SA 1G7CA 2Y0EA 5JMOA 4X63A 4M54A 1A9OA 3GXOA 3LCVB 3M49A 4RE6A 2GSDA 4QGAA 1Y1RA 4EGSA 5HIMA 1LNQA 2YUUA 2ARKA 4AZTA 1UKZA 1V1HA 4WBNF 1JEDA 1CVLA 1U3FA 1YE3A 2B99A 4C4SA 4PLWA 3C8HA 4WFIA 2E4AA 3BFPA 3HB4X 3TRFA 2GXSA 4L0CA 2YYZA 1C1DB 2A58A 4N6NA 2GPTA 4RESA 3L93A 5REQB 3GO4A 2XB6A 4KV9A 5K3SA 3X1JA 3BJIC 1XI2A 1KO4A 1QGDA 2FCRA 1H85A 3DAGA 3M4NA 2QUZA 1E2FA 1MUUA 3LY9A 4FJ0A 4LJKA 4C3ZA 2I3AA 2QENA 4Q3NA 3G0HA 2MSNA 2J8ZA 4I9GA 2JHFA 1Y1SA 4MYRA 4U7JA 5IABA 1K27A 2NTNA 1C30B 1VJDA 5D8DA 4EVSA 4EI7A 3JRXA 3MCAA 5BWLA 4CF7A 2IU6A 3DZCA 4QPDA 5SYAA 2X0FA 4X1IA 4PG4A 2MYPA 2X8JA 2ROQA 1CR1A 4KXVA 4DMKA 4ZQFA 1A7JA 2QP4A 3KEMA 2HFKA 2IY9A 3O4FA 1BW9A 4ZOEA 3RYFA 1ODKA 5J47A 3VJRA 2QLMA 4GZ3A 5IC6A 1KJ9A 1H0KA 1H4SA 3ESBA 5LZ5A 1GRCA 2Q1UA 4JDPA 2JFUA 2WR8A 4QLBA 3VO1A 3BULA 4OGKA 5CVJA 3M4YA 3CVXA 1KOFA 4K9NA 1YAJA 3RC2A 3WYFA 2VRWA 4D44A 2WPDA 4RVDA 2AZ4A 1IBMB 2QEQA 3GCGA 1JFFA 1E8MA 1Y5LA 2EFDB 2ZETA 1JWAB 3D4BA 4DZRA 1C9NA 2VLIA 4RTMA 3BXZA 4GO1A 4ZD6A 3QBEA 2UZ1B 4H35A 3M6UA 4I9FA 1FZQA 2EX0A 4FFLA 5BNZA 4X1OA 1XFDA 1XU4A 3MJVA 2H00A 1G20A 5GONA 2P3OA 1P0MA 1JBEA 3TR5A 4W5QA 4MGIR 1U2EA 3PFIA 1NW6A 2OR3A 3F3KA 5E0OA 1DKNA 2OFFA 5KS2A 1TTTA 3AR7A 4N5HX 3TNFA 4WKCA 1ZQ1A 3ABIA 5IH3A 3V8EA 1Z4OA 3G2PA 4LYDA 4XCXA 4HNUA 4N7BA 3EDYA 4TXLA 1ECCA 1SAYA 2PVPA 4LDZA 4IX1A 1X1DA 4RKWA 5IC5A 4DREA 1XG5A 2QTTA 2YS7A 3OX2A 2C4MA 2FFHA 3QLUA 4WNCA 1RSZA 2X40A 1AK1A 3GEBA 3I2KA 1RWKA 3I9MA 5CCXA 4WACA 3BL5A 3WYBA 3R5DA 3H9CA 2G6TA 1L5MA 3V7FA 3OP4A 2BEUA 4ZK6A 1DTWB 4D8YA 5IVDA 1IQPA 4OUKX 2FRDC 5ALVA 2HQRA 4XH9B 5F1YA 1HT3A 3C1OA 2FNAA 3MXTA 1KYWA 1PJLA 3ROGA 1U1GA 3TLMA 4GXTA 4B35A 2PKQO 4EZBA 3OTGA 3CPEA 2OGWA 3TOZA 1E9VA 2NXEA 2IYFA 5DHSA 2GUWA 2AG0A 2OL4A 1D8TA 4B6QA 1QXSA 2XWPA 3Q85A 3SXPA 2GM3A 3LP8A 4PLCA 3RVDA 4G8CA 4J94A 4F3TA 2EHJA 4K3UA 1OXVA 2GESA 2WWHA 3R0IA 4MOWA 4TLEA 3UH1A 3O2NA 4FFRA 1OLUA 1R8SA 3JR7A 3OQ1A 1BE1A 1D3AA 2QT0A 4IGAA 5A0FA 3THSA 4BQPA 5CXUA 3LK6A 4UXIA 1LPBB 3CG0A 1KI8A 4QYIB 3TLYA 3KTAB 4OLHA 1NQVA 1SM4A 3F2VA 3IILA 3OQIB 4LXTA 3OURA 2AV6A 2UVPB 1KOJA 2C5GA 2ZU6A 2G08A 4RXMA 2KM1A 4BGEA 1NVVQ 1KJZA 4DA9A 1B8PA 1LZLA 1TYDE 2OAGA 2KMQA 4KBFA 3PENA 1HOXA 4D92A 4JOSA 3U48A 1E5DA 5CW1A 5JZVA