2J9RA

Thymidine kinase from b. anthracis in complex with dt.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
195
structure length
178
Chain Sequence
SHMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPTKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDINE KINASE
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus anthracis
total genus 44
structure length 178
sequence length 195
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2j9rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j9rA01
3BB3A 2QQEA 2Q3FA 4WXPA 3SEAA 1F6BA 4C30A 5CK5A 1LFDB 1IOZA 4LDJA 5KSZA 4URXR 2J0VA 4ZCIA 1G3UA 3U2QA 1KI6B 2FNAA 2IYVA 2OLJA 4P3YA 1OH8A 5IK2A 1E0SA 2OZEA 3SJBA 2BBTA 1SHKA 5C4GB 1FOEB 4DLXA 4TT3A 2GTPA 5FOVA 2GVZC 2EWVA 4ACBA 3HJNA 2DR3A 4JLBA 2NO0A 3SOPA 3EAQA 4TLEA 1WBBA 1UBFA 1GRNA 1KK2A 2KJQA 5C18A 1E0JA 1E4YA 3MG9A 4R2IA 2P2LA 1E98A 4Q4HB 2KB0A 2W6IA 3GEIA 2ATXA 4HI0E 2ZE8A 2O8BA 2ZS9A 3VNVA 2QE7A 2V7QD 3WHLA 2V4ZA 1NRJB 121PA 3QF4A 2WAXA 4JVNA 2CVFA 5B58C 1Z5ZA 3AGQA 3BH0A 5C46F 3VQTA 1XPRA 3K8YA 1KNXA 1Z3IX 2CK3A 2HXYA 3K09C 3C5HA 3P4XA 4GMDA 4OL0A 2IYWA 4WW0A 4DDUA 5JHGB 5K8UA 2JLYA 4B6FA 3PUVA 2PMKA 4ZCLA 3TUJC 4NYMQ 3CNLA 4QJ4A 1Q21A 1YZNA 2W6JD 2F1HA 4FMCF 1QHSA 4EJSA 2AFHE 1YR9A 1BH2A 5KYKA 4Y0VA 4JLKA 4C0LA 3QEOA 1GKUB 2FGKA 4NHOA 3A1WA 3T5DA 3U7EB 4EFLA 2IUTA 4RCZA 1N0WA 3AVOA 1R0ZA 3RRZA 2O8BB 2Q6TA 4RD3A 1G6HA 2GAOA 1P6XA 1KI3A 1IAQA 3QF4B 4EFNA 1CP2A 2OESA 2ZRAA 1AJEA 3GLFA 2NZ8A 4HDQB 3WNCA 1ZNXA 3TSWA 5B64A 2BCJQ 3D3QA 5CITA 4C0BA 1ZINA 2H7VA 4DRZA 4II7A 1EFRA 2ECKA 4NZYA 4L8GA 1HE1C 3SJZA 4EJSB 1E1RD 1IQPA 4PSVA 1KGDA 4B33A 2D74A 2W00A 5J40A 4DB4A 4JBWA 4O2RA 4BEBA 4KFTA 1TQ6A 5G3ZA 2D7DA 1TX4B 5BXQC 2OG2A 1I4LD 1IN4A 5LBIA 2FNFX 1MO4A 1Q12A 1TUIA 3OEHA 5KTYA 3NEJA 4BFSA 5TB5A 3BS4A 4B34A 2EVWX 2VEDA 4TTRA 3DOFA 4FIDA 2J41A 2HCJB 2IYTA 3EC2A 3MUFA 2J46A 4I1VA 1E69A 3GLFB 4YMVA 5HKKD 4ZIRA 2XB2A 4IDOA 4KSCA 2C8VA 3RS2A 1YJ5A 1WDTA 1DPFA 2HF8A 1Q20A 1NSFA 1G5TA 1B0UA 2ZVPX 1YZUA 2GJKA 5DHAA 2O8EA 1XTQA 2PEZA 1OIXA 2G0TA 5AWFC 4E09A 4GFDA 3HU3A 1MO6A 2CMKA 2DCUA 2AX4A 3U3JA 3W34A 1A7JA 1KK3A 1NVUQ 1HH4A 3KQHA 2ZYVX 4BWYA 3UGDA 4LJ6A 1OFIA 5CJ2A 3N2EA 4MYCA 3TIFA 5KNBA 2FFAA 2OO7A 2BMEA 2CVHA 2ZREA 2CHQA 3JVVA 4LYAA 4YXWA 3PQCA 3WP0A 4KITB 1E2NA 4GT1A 4DUGA 3NBYC 5EP4A 4ZIRB 1MT0A 2VLIA 3DMNA 2RCNA 3FYHA 1Y3AA 1ZBDA 4A9AA 4ZCMA 5UKDA 4X8LA 3AV0B 3BFXA 1V43A 3KFVA 3L0PA 2REOA 3UK6A 2QMUA 2OFXA 1G16A 1W0JD 4F91B 4YMTA 3A8TA 3OF5A 4TMTA 2GJAA 3U5ZB 2O8EB 4JT4A 1W5SA 1DELA 3LXXA 1G3IA 1UPTA 1KOFA 1GG2A 2KI5A 3X2SA 3ZZUA 1T4GA 4Z51A 1E1QD 4TWZA 2XZOA 1JR3E 3PR1A 3VMFA 2ODEA 3B2EA 2NO9A 2HXSA 4M1WA 1CTQA 4YQFA 4MGZR 3OEEA 4XVRA 1N2CE 1ZUIA 4GP6A 4UNRA 2D06A 1F2UA 3E70C 4KODA 5KPDA 1UEJA 3D7MA 1GZSA 4A6XA 3CF2A 5CYOA 1ONBA 1MV5A 2WWIA 1Z0KA 1NVXQ 1KK1A 3HDTA 4Q7LA 3T12A 1HA3A 4RY2A 4RFSA 4AD8A 3H4MA 2MMGA 1KMQA 1II8A 4D4LA 1U0HC 4D0GA 5KSYA 1PLLA 3G5UA 2JCSA 1X8LA 2IW3A 2QMOA 3FHCB 1TEXA 3FTQA 4LBVA 4LJ4A 1NN1A 3GJ4A 1W4RA 2JLUA 4JJKA 3EPKA 4JSTA 4U00A 3GEEA 4OHZA 3NVAA 4UJ3A 1R0YA 5TV2A 2GRJA 3T06B 3QXCA 1COWD 1NBME 3NEYA 1WA5A 2WVJA 1F2UB 3PJRA 3UG7A 2NO1A 1L4UA 1SHZA 1ZW6A 1ZC4A 2FEOA 2WSSA 3LNCA 3TJZA 1WCV1 2HLDA 2ZROA 3ZQ6A 2GDJA 4Q21A 3CWQA 2CHVA 3BGWA 3ICQB 2YJTD 3FFBA 4GZLA 4W5JA 3X1YA 4QXAA 4FD2A 2NQ2C 2VHQA 1U99A 4RFSB 4QHTA 1II8B 3PEUA 4URZR 1E2PA 4XTCS 4AKEA 3CW2A 1E99A 2VP5A 3LVRE 5G3YA 2ZPTX 521PA 2VSXA 3IIJA 4RD0A 1QHNA 3GMTA 1NG9A 5EE9A 3SQXA 1JAHA 3EX7C 3CRVA 3K70D 4R2HA 5J4YA 4HB2A 2IS4A 2FEMA 1W48A 4UXHA 1XTKA 4RZUA 4B2LA 4Q9HA 2DFLA 4IVPA 3TBKA 1UDXA 2Z4SA 3MFYA 4JVSB 4PQYA 3UG6A 3ZIAA 5IRCD 3ICEA 2W58A 2WOJA 3BIFA 1JPNA 2CLDX 2ZVQX 3LH5A 1CF4A 3VR3A 1G6OA 3BRWD 2QSZA 2GJ9A 3NWJA 3RSOA 4BFWA 4QGGA 2QENA 5EXSA 5G41A 3TR0A 4HAWA 5EP2A 3PUYA 3WHKA 4UXIA 2ZR0A 3ZZTA 3PXGA 4Q1BA 3D8BA 5SZJA 4O3MA 1CEEA 3SJCA 2JLWA 5GVRA 4QKQA 3FOZA 3B82A 5FPTA 2NGRA 3I8XA 5TARA 2WTUA 1HUQA 3P20A 3TKLA 4BFZA 5BN4A 4QBIA 3Q7PA 1OB2A 1XA6A 5H68A 5FR1A 3GFOA 2WKRA 1XB2A 4OQLA 4D4JA 1VG1A 2LKDA 3M1IA 4FN5A 4Q9JA 2H57A 4CGZA 4W7SA 4GDFA 4DSTA 1YZGA 2J7PD 1NJFA 1GUAA 5E7JA 2ZM5A 2HYIC 5AJYA 1KY3A 1E3MA 2PL3A 1ESMA 1F5NA 3MSXA 3OESA 3SYNA 1N6OA 4L4UA 1G9XA 3PITA 4QL3A 2FH5B 3A1SA 3DKVA 1KI9A 1AZTA 3HPQA 4M1KA 2ZI4A 1FMJA 2ZJ8A 4HAUA 2A5GA 3KB2A 4C9BA 4CVNA 5JFGA 2XB4A 4MKFA 4GI7A 3U7HB 1BMFA 5GJBA 1YR7A 2R6FA 3RC8A 4DSOA 3BJIA 2YWFA 1HT2E 2IEZA 1X86B 1S4QA 2WIBA 4B3XA 4ZI3A 1ZP6A 2UZIR 4LJAA 4LY6A 1AKEA 3UANA 3GLGE 1KI8A 2V7QA 2Q9CA 2WMNB 2JAQA 2GA8A 5CIQA 3V4FA 1Z83A 4K8OA 4DDWA 2BCGY 5FUVA 4MKIA 4P33A 2PZFA 4URWR 4OJKA 3ASYA 3ZQJA 2GF0A 3TVTA 3LV8A 3EPJA 1ANKA 3GJ6A 4GNKA 2ZRPA 1KBFA 3DKPA 4DEYA 1XEFA 2PT5A 1GL7A 1OPXA 4LHVA 1JI0A 4DKXA 4JLOA 1JJ7A 5FI0B 4A8JC 2A5FA 4KI0A 3TSZA 1N6KA 2ELIA 3BERA 2OUKA 4CEJA 2RGNC 1WF3A 4A0HA 4RFVA 3HYRA 1VYTA 2CNWD 3THXA 2ZRDA 1G3QA 1N5IA 1VIYA 5CJPA 2ZYUX 1L8QA 2HF9A 2QAJA 3W6OA 1FFHA 1GNQA 3BXZA 1E79A 3KUCA 5JMTA 2WV9A 5D3QA 1OYWA 4QOSA 4FWIB 2P5TB 1DAGA 2C95A 2WZQA 4HLUC 4LYJA 3VHXA 3F5FA 4FI3C 1G5RA 1DEKA 2NZJA 1ZUNB 3FPAA 1UADA 2O8CA 1IN8A 4GOXA 2JLVA 2WPDA 4C0SA 2RKOA 2RGEA 5J4HA 3TE6A 2G77B 2OLKA 2EWWA 1XDBA 2WSMA 4A0RA 4FMBB 2OM2A 5DYGA 3R7WA 2OV2A 3RS7A 3LW8A 2PX3A 3AF0A 3GLHE 3RRYA 4CEJB 5CLQA 3R9XA 2A2ZA 4XD7D 1Z28A 5H70A 2GVIA 4LBYA 4BASA 3THXB 2WMOB 2YVUA 4TZ6A 4HUQA 1W46A 1J90A 2HCBA 3L8ZA 4Q9KA 4ZKEA 4D6PA 1KTVA 1IY2A 2QY9A 5J5CA 2UZ3A 4MKGA 3W6PA 3ADCA 4V02A 4V0LA 4IXMA 3REFA 4ERNA 2BMJA 2O0JA 4B47A 2O8CB 4KVGA 1GIAA 2FWRA 4L15A 2F55A 2P6RA 4CF7A 1Y63A 4LWZA 2ODWA 4Q1AA 3UFFA 1KK0A 3SZRA 3RRNA 2A78A 3V4RA 3LO5A 3QE0A 3VKGA 1E94E 3MJHA 3ZVRA 4LJ5A 4ZDWA 4PQFA 1SVLA 2D2FA 3KJIA 5EE5B 3QKRA 3R7WB 3GLIA 5A5GA 4ZV4A 2CDNA 1T5LA 2B8TA 1VCOA 4G01B 5CB6A 5FBRB 2VO1A 2XXAA 3FKSA 1XX6A 4HUQB 5J47A 2PT7A 4HB3A 3Q5EA 1S9DA 1N6NA 1ZMXA 4I81A 3RS0A 3OZXA 1VYVA 4MGIR 1OXSC 2H17A 5E4FA 4ZDIA 2QTVB 4LI0A 1KAOA 1ZRHA 2VL7A 4PZZA 4M0LA 1SZPA 3CH5A 3WNBA 3KQKA 3LD9A 4B6DA 3ASZA 1Z6TA 5E95A 1E2FA 1CLUA 1P61B 1LF5A 1SXJE 2NOAA 2WWGA 2ZYTX 3U3RA 4BFUA 1VCMA 2ZRJA 2VA8A 2GCOA 1W0JA 2WJGA 3GLIB 3QKRB 1R7RA 4HEJA 1JALA 2OSBA 2DB6A 2ZE7A 5FTMA 2FX3A 1PZNA 4QBHA 2J59A 2JJ2A 2X77A 3F8TA 2CXXA 1E1QA 4P4SA 2GHIA 1ZJ6A 4A2WA 1GWNA 3GEHA 2N1BA 2XXAB 4V0MA 1XJCA 4DBLC 2AWNA 3U44A 5ANRB 3KFXA 5GADl 4GP7A 3TW4A 1NMYA 1IXRC 4JMPA 1JXMA 4TQAA 2W0SA 4EPRA 1VCNA 3LDAA 3BH7A 2ZJOA 2CL7X 3DVLA 1UKVY 3VAAA 5LPNA 1E2QA 2IHBA 1A82A 3P1JA 4Q66C 3VTKA 2ZJ5A 3MWYW 4V03A 2I1VB 1FUKA 1TAGA 3A4NA 2F1IA 3MRSA 4P4TA 3THYA 2GCOB 4EUNA 3K70C 1OH5A 1YKSA 3QKSA 3DDCA 1P3JA 3NDBB 2W2TA 1WE2A 1IHUA 3V00A 4PQRA 2RB4A 4D80A 3RNLA 1HYQA 4P4SB 3CWZA 3P26A 5DI3A 5L3RA 2FGJA 1ZIOA 2R6DA 2AK3A 3MMPA 5C2JB 1RFLA 1COWA 3U44B 4G5OA 3SR0A 4JLNA 3H86A 4HB4A 3O8BA 1PLKA 2FPMA 2QP4A 2QUZA 2ZRNA 4TYNA 3CXLA 1YU9A 2WJIA 1DVRA 1JQJC 4B75A 3B9QA 3GFTA 4PC3A 3R20A 2GZDA 3AQ4A 5J4VA 3AF4A 3GJ8A 1NVVR 4PPFA 5LD2B 1NN3A 4E07A 1A4RA 2G1KA 3UEYA 2JA1A 3THYB 4IHQA 1UBCA 5DSZA 3QKSB 2IL1A 3UMFA 5JEEA 3RWOA 2XTZA 4BZPA 1VHTA 1KI7A 3U3KA 1SKYB 3EXAA 4FWTA 1CR1A 2DWQA 5AK0A 4DDTA 4S2EA 2PZGA 5DI3B 3TW8B 3T1QA 2AK2A 5H8WA 3QI2A 3D31A 4DJTA 4DLRA 4Q9LA 3A58B 3OIUA 4ACAA 1AKYA 2R44A 2EYUA 1PVOA 2B7CA 4C0HA 2XNDA 3GJ7A 1RRPA 2C04A 4MYTA 1GM5A 3ADKA 4D81A 5JJIA 3W6NA 5KDOA 4NDZA 2KBEA 4KV9A 5KO2A 2BDTA 4JT2A 1R79A 1RC8A 5L3SA 1QZXA 1YHNA 2A7QA 4C4PA 1T8TA 2ZAOA 3AP1A 4DXAA 1TU3A 2RGAA 2B7BA 4RD1A 1KO1A 4GOJA 3GJ0A 2E9SA 3B1VA 1R8QA 2YWHA 1OXTA 4MA4A 3GPLA 1JEDA 2JGNA 1U8ZA 4B3BA 5CK4A 2BWJA 5HE8A 3CO5A 4G3XA 5GVSA 1J2JA 3SFVA 3U60B 5CB8A 3LRPA 1D6JA 1N25A 1X1RA 1P2VA 1BS1A 1GNRA 1R5NA 2CLCX 2IC5A 2EFEB 5DH9A 1U8AA 3LBIA 4Q4LA 5EP1A 3TUIC 2O8FA 1E2EA 1NI3A 4CEIA 5KOYA 4NL4H 3QXSA 4A2QA 2OAP1 3AGPA 1C9KA 1EFTA 3HR7A 3IPXA 1DO0A 3RS4A 1EX6A 4R98A 4D26A 3IIKA 5AUNB 5L3SB 2J45A 4ASUA 4BEJA 1NG1A 1S96A 5FPSA 2YOFA 4CT4B 1US8A 5CM9C 3RHFA 1OXUA 4HLQB 4B73A 2LCFA 2F9LA 4NTZA 2GEDA 4P0TA 5TMPA 2GXUA 1P5ZB 1Z8FA 2VHTA 3T35A 4P4UA 1P72A 4KBGA 5FPYA 1E2DA 2IYLD 4DLSA 4AI6A 5GJWC 2O52A 3KQNA 4ZKDA 1YE8A 5HCNA 1VPLA 4H1UA 1HQCA 3B60A 4Q18A 1W36B 1OKKA 1TUEA 3EZ2A 1G3MA 1W4AA 3CNNA 1EGAA 5IF9A 4V0ME 3ZDQA 4F7WA 1QHGA 1CRQA 4EKDA 2O8FB 2ODNA 1LS1A 5E7IA 3T15A 4CEIB 3SS8A 3SDZA 2OXRA 2HJVA 2OT3B 1OYYA 3IEUA 4Q7MB 3K0FA 3VKHA 3U61B 1EESA 1QDEA 1UAAA 1Z0FA 3EC1A 2FA9A 3W9YA 1OH6A 1US8B 2IYZA 4DLYA 1E2HA 3FE2A 1NLYA 4IDHA 5HCIA 4ARZA 4Z1MA 4LV5B 1AA9A 3WYGA 4UXJA 1X8KA 1U98A 1C4OA 5JSZA 2F3RA 4QGFA 4QRHA 3X1ZA 1OF1A 5HZKA 4JBXA 1GOTA 3Q8XB 4PPGA 2BBOA 2CBZA 1O87A 1J8YF 4LJ9A 1W0KA 1ZD9A 2HDNB 2Z4RA 5L8VA 3L82B 3NTUA 3GJ3A 4TL7A 1YZKA 1YQTA 4OKSA 4PHGA 3KUDA 3A36A 4ABYA 1XRJA 2XOKA 1VYUA 4C0JA 2Y8EA 3QKTA 3S1AA 4V0OA 4UQOA 4AK9A 5H1YA 1ESNA 3HWSA 4C0QC 3K0FB 4IDNA 1GNPA 1AGRA 2YWGA 5FOSA 1K6MA 4JYCA 4A2PA 4BFTA 1JECA 4TTPA 3K0SA 2Z5FA 4U5XA 5EXTA 2ZR7A 3ADDA 3KL4A 4Q02A 4RZ3A 4ARZB 5J4LA 2GETA 1N5JA 2ZSAA 2BC9A 1TF7A 2V3CC 2FF7A 1AZSC 5JSZB 1PTQA 2YYZA 1K8RA 2GCPA 3KTAA 2C9OA 5F98A 5DGXA 1KSJA 4A1FA 2VRWA 3BC1A 2V54A 2GF9A 3AVQA 5EZ6B 3Q72A 4Y0AA 1E9CA 4JKYA 4A92A 3X1WA 3MD0A 3T61A 3D6TB 2ENNA 2D62A 3OE7D 3LW7A 4FINA 3AEZA 3N5CA 4UJ5A 3S1AB 1VG0B 2W2VA 3JZMA 3B78A 2XTNA 1H8HA 1KKLA 3K09A 2IXFA 3PG5A 3MJRA 2GXSA 4L9SA 4E03A 2OCBA 2FE4A 1G3RA 2ZI3A 1XCPA 2OILA 2JJ8A 3J81k 3SHWA 1GKYA 2G1JA 1ZNZA 1LV7A 3NDPA 1XXHA 221PA 4WZBE 3CPJB 4JL8A 4P32A 1NMXA 1PUJA 4AG6A 2ENZA 2ANCA 3KTAB 2GBLC 1Z0AA 4PPNA 4RKEA 2VRWB 2MSCB 2G83A 1H65A 1RZ3A 5DYIA 1EWQA 6Q21A 2JJ1D 4QM7A 4AY2A 3AKDA 3GQBA 1AGPA 1DAEA 3AF3A 1Z06A 1XNJA 1A2BA 3DO6A 3KQUA 4URYR 4FKDA 4RD2A 4X8HA 5E7MA 4D4KA 3K0CC 3DOEA 3KJHA 1EWRA 1Q3HA 4BQSA 2PLFA 3V9PA 2J9RA 1G4AE 4LHWA 4WOPA 4WIAA 4B74A 4B44A 2R2AA 3GJ5A 4DCUA 1UBEA 4JVLA 5DLQC 4PO1A 1XXHB 1T5IA 3F0TA 2IK8A 2PLRA 2HEIA 2JLRA 2XX3A 4BLQA 5FL3A 3WMEA 1XMVA 5AUQA 4RD6A 1G291 3IDQA 5LB4A 3WNDA 1N6IA 1QG4A 3IHLA 2FV8A 1E6CA 2ZI6A 3QEJA 3BK7A 1XD8A 2X19A 1IY0A 1IN5A 3LLMA 1NLZA 1ZD8A 1LNZA 1U0JA 4GPTA 2JIZD 4PANA 3ETLA 4DHEA 2AHOA 1JJVA 4BE7B 3EIHA 1DAKA 2AR7A 2DPXA 5G40A 1WXQA 3SFZA 1NIJA 4BUJA 3W3ZB 1OHHA 5FTKA 3GD7A 4N0EA 4PX9A 5HPYB 1HTWA 2WICA 2XSZD 1ZUHA 2QGZA 1Q1EA 1NVWQ 3C16C 3CRRA 1KBEA 4MDEA 3UGLA 3AVUA 1QVAA 4LBWA 1ZM9A 5KNCA 2GCNA 3QIAA 4M9ZA 1E9AA 5BW8A 1NF3A 5K8IA 3R8FA 2IF0A 4ESVA 5DI9A 2GILA 2Q21A 1TU4A 1G4UR 3DZ8A 2O0HA 2P65A 1D9XA 4FCTA 1S2MA 3LX8A 1EFHA 4URVR 1T8UA 2X1VA 2DFKB 3BAFA 2I3BA 3IO5A 3PEYA 1H8ED 5BQ5A 2Z0MA 3SNHA 2GVDC 1G20E 1S1CA 3CUEF 4ZDKA 1RW4A 1Q3TA 1XCMA 3C5CA 1WP9A 1QHYA 2B92A 4PC1A 1F48A 1KI2A 2Q9BA 2I4IA 4JZKA 1KSGA 5FH9A 1N6PA 2KE5A 2FU5C 4NCIA 3K53A 2BJVA 2Z6VA 1AQUA 3L0IB 1G1MA 1D5CA 1IM2A 2GK6A 3EZFA 5L3QA 2QRZA 5JS7A 5JRJA 2UVQA 4Q19A 1U2RA 4XSHA 4IFBA 4BZXA 1ZCAA 3OFND 2ZTSA 3W5IA 4BRWA 1U9IC 2DHRA 1F2TA 4XTRA 3GLFE 1ZU4A 3C4JA 4JLJA 4Q00A 1G41A 1KJZA 1TNDA 1UFQA 4H1VA 3NHBA 4JIMA 2V6IA 1P7CA 4KLZA 3QVUA 3QY0A 4LJ8A 4PAOA 3ZH9B 4HYYA 1W47A 2QPTA 1TBOA 5SZIA 1IN6A 2J7KA 4Q4JA 4HDOB 4CW7A 3AB3A 3BFKA 2DY1A 2A9KA 4OQFA 4OI4A 4QHYA 3OAAA 2RGCA 4GSYA 1OH7A 5L3QB 1VHLA 1S3SA 2EFDB 4MUBA 5ELXA 4YC7A 4QBGB 3FWYA 4M1SA 3RSLA 4BLPA 1XFAA 4KFSA 3CBQA 1XJQA 2K5UA 2OHFA 1F2TB 3CB4A 3Q85A 4US1R 4Z8XA 4BZQA 5JRZA 3LA6A 1SVIA 2IYXA 2A5YB 4FMCB 5FPKA 4D82A 2XJ9A 5FOWA 3NIBA 3FVQA 2JEOA 1E9SA 1II0A 4MRPA 4OK3A 1CBUA 5HR5A 4DSNA 3NBFA 1VTKA 3MCAA 1E0AA 2DWPA 3TAUA 1SXJC 2XGJA 4Q4JB 2BMDA 3IHWA 2Q3MA 5JLJA 3NBXX 2WWFA 3BB1A 5KSOA 1WQ1R 3MGCA 1FAQA 1E9EA 3K9HA 2YWEA 3M0EA 3HR8A 4WVFA 2J87A 1A1VA 4KYIB 1LTQA 4P31A 4Q1DA 3NXSA 3VR2A 2RH5A 2EQBA 4JLPA 1QHIA 2KBFA 2ZRGA 4RJLA 4B3FX 4ESHA 1SGWA 2FG5A 3GJXC 3ADBA 2P3SA 2DWOA 2CL0X 3KX2A 1LVGA 1EK0A 4A82A 2FDCA 2ZUDA 3RDPA 1T0JB 4KHZA 1QHXA 3I1FA 4KAXA 3R8CA 2J0SA 2VP6A 4DIDA 1Q1ZA 2ZJAA 1KJWA 3KQLA 3EWAA 1YR8A 2ORWA 1X6VA 2VF7A 4OJQA 5FBLB 1AS2A 1MH1A 2GK7A 2NO7A 4ITRC 2W0MA 1IJEA 2QN6A 3K1JA 1OIWA 2CE2X 2D7CA 2ORVA 1TTTA 1RKBA 3P4YA 1GRRA 2YOGA 4LRWA 2RAPA 3A1VA 4DLWA 2WJHA 2ZQ5A 5CDFA 2V1XA 3RWMB 1ZVQA 2PBRA 3K9NA 2EFCB 4TYPA 1YZTA 2ZEJA 1KO5A 1II9A 2VHCA 4QFMA 4I99A 3DMDA 4KO8A 4MRNA 2Q3HA 4OBEA 5AJVB 4OHYA 3W8RA 1E2IA 2R9VA 2NPIA 4DLZA 2QMEA 3K0EA 1Z07A 4NU0A 1CRPA 1XD9A 4GBMA 2G6BA 4C7OA 5JCZA 3RS3A 1CULC 4YMWA 1Z6YA 2W6JA 3RANA 4AURA 2IT1A 5L3VA 3FHTA 1W4BA 2BBWA 3SYLA 1GILA 3PV0A 4L16A 1D2EA 3CZQA 1T9HA 2BMFA 4M1TA 3QXXA 3THWA 3KZ1E 1HY3A 2ZE5A 3OHMA 4M53A 4CRWB 3I72A 1RYFA 3QBTA 4TT3D 2VYFA 2C98A 3FHOA 1JR3D 1R4AA 1GAJA 4PHTA 2PH1A 4F4CA 1KSFX 1AS3A 4QBFA 5M04A 3K9GA 1RIFA 4HAYA 1R10A 2IYUA 4E22A 4R71A 1G8YA 1M7GA 5KDLA 4POAA 2F43A 3TLXA 1EX7A 2RGXA 2QE7D 2AXPA 3CX6A 1P2TA 4C7OB 4C2UA 3AKCA 2O5VA 3P32A 5K8TA 5FFMA 3CM0A 4LJYA 4NP6A 4BRUA 2ZRHA 4DZZA 4M2LA 2CK3D 1KNQA 1E1RA 3UKDA 5K8LA 3A4MA 4PTLA 3QXHA 2FPKA 4LHYA 3THWB 2BV3A 2NPFA 1G7RA 4A8JA 1UDWA 1J8MF 2WWWA 2OFWA 3M4YA 2H92A 2HYDA 3B13B 2C78A 2D4HA 2R6GA 3HP1A 1EXMA 4JYBA 4PAMA 3PIRA 2ZRBA 2FMXA 2RGNA 3VKWA 4DIEA 3E1SA 1AS0A 2IUSA 1NBMD 3CONA 3WMGA 3EA0A 3LBNA 3X1XA 2YNMA 2VHUA 2F43B 5HKKA 3R9WA 4HLUA 4DCNA 2QRNA 1CR4A 1YRAA 1ZM7A 5EUQB 2O8DA 2GJ8A 1P9NA 3PCRB 2ZYWX 1SKQA 1JEEA 4KU4A 4IOKA 4O2LA 1JAIA 3R9IA 4IOLA 3KXIA 5KUTA 1EFRD 4A8JB 4CIDA 1GL9B 1XEWY 4DEXA 1FUUA 3UEJA 3A4LA 1P73A 4WA7A 1TBNA 1VDZA 2ZRLA 4KFRA 3FKQA 1RPZA 4B76A 4B2IA 1Q44A 1KO4A 1IXZA 1XEWX 1WRBA 1CKEA 5EUMA 5C4MA 5DNYB 1WB9A 1G21E 3OEHD 1HEIA 4F4IA 4IJMA 1S8FA 1XZPA 4TLCA 2ROWA 3PUXA 2BM0A 3VX4A 3B6EA 2ONJA 4TMVA 2QROA 4LV6A 2QA5A 2ZI5A 2WJYA 4US0R 5F2EA 4OQNA 2O8DB 2CJWA 2ZSBA 2ZITA 4XVQA 5TDHA 2NTYC 4JLDA 2NMVA 3NH9A 4Z54A 2HJGA 2QP9X 4IXNA 5KHOC 2IXGA 1AQYA 3DEFA 5EE0A 4B3GA 3B1YA 3ND8A 3Q5DA 2JLXA 3U7GA 2UKDA 4NBSA 4TL9A 3KKMA 1EFUA 2XAUA 5CLLA 1RJ9A 2RGDA 1HURA 1JXOA 1KO7A 5JI2E 3GFPA 4QNMA 3QPVA 1HV8A 1CXZA 2ZSDA 4YMSA 3AVVA 2FJUA 3KJEA 4PR0A 4XH9B 4YDSA 1G7SA 4B35A 2J3EA 1J70A 2WJVA 3CRMA 2IWHA 3CR8A 4YXWD 1H8EA 1KIMA 2P5SA 4DUGD 3VR6A 1UF9A 2MSEB 3WRYC 2CEAA 2IHYA 2CJWB 5FL7D 3UPUA 1D2NA 4B3CA 1G64A 2JLQA 3PUWA 5E3HA 5JJLA 4NYIQ 2A5JA 4PZLA 1BYIA 3QENA 3KXKA 1E9RA 1A2KC 3I73A 2MMCA 1RJ9B 1DG3A 1KHTA 4DC9A 4OQXA 5FR2A 2F1JA 3TRFA 1VG8A 4MRSA 1Z08A 3OEED 4WBSA 3WBKA 3ZGXA 2ZANA 1OJLA 3U6KA 3GP8A 1A5TA 4US2R 3L43A 4JLVA 5DIFA 2PJZA 2QAGC 4XSGA 1I2MA 3EA5A 3SE0A 3SYKA 3IQWA 4CZ2A 1Z47A 2FZLA 1MO5A 4A15A 1I4TD 1XU4A 1BOFA 1PJRA 2HV8A 1UKYA 3O8DA 1Y8FA 1JB1A 3MWKA 4FMDF 4IVQA 1LF0A 3THOA 1N6LA 721PA 3NC1C 2NIPA 4DCSA 5AR1A 1CJUC 3AVPA 3FMPB 3L8YA 2VP9A 4LJ7A 4BGDA 621PA 1P2UA 2LKCA 3ZLJA 4MKHA 2ZSEA 3TUZC 4QGAA 2AWOA 4M9SA 1MOZA 5DHFA 1G8GA 1N6RA 2H1LA 1SQ5A 4PSAA 4M21A 2XITA 2XNSA 3KKPA 2ZJBA 1LW7A 4A4DA 2HLDD 3VR5A 1IXSB 4WAUA 1IN7A 1XEXA 4OHWA 1XZQA 1P4SA 4RZ2A 1P60A 3ZS9A 1DG1G 2QP3A 1E96A 3ZVLA 5KU1A 1JNYA 2AXNA 4JSYA 3GLIE 1FZQA 3I3SR 2ODBA 3K70B 3IGFA 2Z43A 1Z6GA 1SULA 3AH8A 1CR2A 1I2DA 3A1TA 3L2OB 2PMDA 3PENA 4EDHA 5J4KA 3H2YA 4TLAA 3VX3A 1XWIA 5DO9A 3RC3A 3CPHA 2KWIA 1X8JA 2VH5R 3G0HA 2F6RA 3EW9A 1UBGA 3EWSA 1T3SA 1M2OB 1Z63A 3TVDA 2J7PA 3UMSA 1JR6A 3B9PA 2CL6X 3C15C 3CF6R 3ZIAD 2IX3A 1NN5A 2QPAA 4HAXA 3C8UA 1Q57A 3QKUA 4IVRA 5CIWA 4B3DA 2QM8A 1XEXB 5AJWA 1MKYA 1ZM2A 4NYJR 5KPJA 2QL6A 2YZ2A 3BH6A 1ZM4A 3NBZC 1NL3A 2OCYC 2JATA 1ETUA 1SVOA 3AKEA 4HAZA 4PHHA 3M6AA 1KAGA 2FFQA 4IOJA 1Z0DA 4KCGA 2NG1A 4L9WA 2QGNA 2QM7A 2ZRKA 1P9RA 1W49A 1RYHA 1OLOA 2KSQA 2X2FA 5EZ5A 4G5QA 1DADA 2HT6A 4HAVA 4LCBA 5EP3A 3KKNA 2WIAA 4A6PA 4EPVA 1Q1QA 1VCIA 5DN6D 1AM4D 4M1MA 2QMHA 1W2GA 1OT3A 1OV4A 1J7KA 1V5WA 1P9WA 4IFEA 4QJ3A 5FTJA 2N42A 2OBLA 1Z22A 1T91A 3W5JA 3I5XA 4ILEA 3W90A 2ZI9A 1SXJD 4DCTA 3L0SA 1DARA 4EJSC 1GFIA 3NG1A 1E9DA 1SKYE 3T1OA 2G9NA 2C77A 4WZAE 1S3GA 2CNWA 4DB2A 4RD4A 4N3NA 1Z6AA 1G7TA 4F38A 1RRFA 2ONKA 1JR3A 4I1OA 1BMFD 3KKQA 3FMOB 1R2QA 4TYYA 1E0KA 1M8PA 4KFUA 3QG1A 2PEYA 4MQBA 4TN1A 3QBVA 1SVWA 4IOMA 5A4JA 3DHWC 2C99A 3FDIA 5EXXA 2Q9AA 4K81B 4WZ6A 3QOFA 4D25A 4NYMR 4DLUA 1TQDA 3WYAA 1KKMA 3DZDA 3EASA 4ZPXA 3UIEA 2GNOA 4W5HA 1ZNWA 2BIFA 2E1RA 3PFIA 3KJGA 3KKOA 5SZHB 2EFHB 1GSIA 2E87A 1UJ2A 2Q0HA 3RAPR 5FBWB 3H1TA 3QF7A 2ATVA 3SU8A 4AC9A 1QRAA 2GAAA 3W3AA 3TGPA 4LK2A 4XD7A 1U0LA 3UATA 4IEEA 1T3LA 3RS5A 4O25A 3VFDA 4LC0A 2EYQA 3QSYA 3OIWA 2ERXA 4ZI2A 2GZAA 3TQCA 1Q0UA 4DDVA 4IKEA 4W5WA 4XVUA 2QI9C 3I61A 2YC2C 1OXVA 4NCHA 5FPHA 4CDGA 4D0NA 5BN5A 1NBMA 3CH4B 4V0NA 2FPLA 3CR7A 1G5PA 2ZUBA 3B85A 1Z0IA 2VSOA 2C9YA 4BPBA 4C0KA 2AN9A 1E79D 5IDVA 2P67A 1TF2A 4QG7A 1DE0A 4EIWA 4M9XA 2C5LA 1AK2A 3EG5A 3B1XA 3H84A 4JKIA 4AWXA 4FCWA 3Q3JB 1Q22A 3AUYA 4LX0A 3U4QA 4KJZA 4MYHA 2IYRA 3EARA 3CLVA 2OBMA 3RLFA 2WPDD 1ZAKA 1E2GA 2YHSA 5BYJA 1R8SA 4Q48A 2WM9B 4Q1FA 4EFMA 3CX7A 1DAFA 4JS0A 4TSFD 2FFBA 4LZZA 3CZPA 1VKJA 4GRAA 5IHPA 4V0KA 4N1AA 4HLCA 1S9HA 2GEUA 1GITA 1M7BA 1XTJA 5F9FA 4C2TA 1DS6A 3PUZA 5BN3A 4BLRA 2C03A 5D3MA 5JCPA 1KY2A 1N0VC 2IWRA 4URUR 5FUXA 3ZD7A 5FUYA 1ZCBA 4AKIA 5B2ZA 3IILA 5SZKB 3SQWA 4FMDB 1OE0A 4MITA 1KI4A 3U4QB 5AJXA 3LBHA 1T0HB 4MYUA 1XD2A 1GP2A 3VHLB 5JZVA 2OAQ1 1D9ZA 2FN4A 2P0EA 3ECCA 4YLGA 4Q4AA 1ZNYA 4XWKA 1ZYUA 3CKLA 1FQKA 4NCKA 2IS6A 4XIGS 2GBLA 4N0DA 4Q7JB 4XWOA 5GJCA 5KNDA 1ODFA 4QNRA 4PC7A 2J5XA 4Q9IA 3O8RA 3O47A 4W9MC 2ASEA 4BFYA 5FUWA 3Q9LA 3FKSD 2VTKA 2W83A 5D3MB 1KZ7B 2D2EA 3IBGA 4DVGA 2QEQA 1OSNA 3E5HA 1ELOA 1OXXK 3K0CA 3VU9A 1NSTA 1FMLA 1NY5A 3AP2A 3Q7QA 4JL6A 1Q1BA 1VG9B 2YINC 3CIOA 2GEVA 5TVKA 1TMKA 2QTFA 1XD2B 3FMIA 5FL7A 1FP7A 3OIYA 4LGMA 5CYPA 1R6BX 3EZ7A 3UWKA 4Q4AB 1RVDA 1G17A 2YOHA 1HE8B 1LB1B 1YVDA 4NONA 1J99A 2ZU6A 5TY0A 2R65A 2XZPA 3JZAA 1LS6A 1NJGA 3OIVA 2AKAB 1HQYE 1OFUX 2JJ2D 5CM8B 5DISB 2FSHA 3G82C 4ON9A 5GJVC 4G5GA 4Q03A 2QPOA 4UNQA 1FW6A 4AG5A 4X8MA 4RCYA 3I8SA 4HDCA 2QZ4A 3MAAC 3GLGA 2J1LA 4BLOA 1G19A 3RRMA 4EPTA 3VU9B 5C1BA 1M6NA 1BO6A 1S1MA 4HUTA 2ZSFA 2EU8A 3SI7A 2VF8A 3AF2A 1QBKC 4I4LA 4DSUA 1IONA 3EZ9A 1FTNA 1RE0A 3KB1A 4ZDJA 8OHMA 2GESA 1KMHA 3AVXA 4EQ6A 4L9MA 4KVAA 3IEVA 3WMFA 1FNMA 1E9BA 1MO3A 2GKSA 3LY5A 4TTQA 1M7HA 1NMZA 2JDID 4X8OA 4PZYA 1YRBA 4OK6A 2BKUA 2OCPA 4LHZA 4DLTA 1OIVA 5FOTA 2ORIA 4PPQA 1YR6A 1N6HA 5KDDA 2BEKA 2VIIA 3GLGB 4EPXA 2B8WA 2G88A 3FGNA 2CLSA 1W4CA 4M22A 1E2JA 1OFHA 2AD1A 2BHRA 1BYUA 4LBZA 3H0KA 4B71A 1CJMA 1XXHE 3FB4A 4GZMA 4PO9A 4JVMA 3WY9A 3X1DA 4AYTA 1KMHB 1TPZA 4EQ6B 3VR1A 2V55B 4NKRA 4B6EA 4PAQA 4KXFB 2BM1A 3GLHA 4LYHA 4AIIA 1CJVC 1E2KA 2FOLA 4EPWA 421PA 2DBYA 1UEIA 4IW3B 2E73A 1G18A 2B6HA 2OBNA 3BORA 4K46A 3EZ6A 4RVCA 3QXJA 1U9IA 4CYMA 3E2IA 2CHGA 2QBYA 1GVNB 1R5OA 3K0AA 2WKPA 2DFNA 2XNDD 3UGIA 1NKSA 1RRCA 2FSFA 2D3WA 3I92A 5KSPA 4H9GA 1WMSA 2IS2A 1N0UA 3BBPA 3B1WA 2YC4C 2DYKA 5HTKA 2ZIAA 4TQUS 3HU1A 3WBJA 1NKTA 5JWRA 1GRQA 2L0XA 1CU1A 2ZRFA 2B21A 1M74A 1W2HA 1XF9A 2H5EA 2HT1A 4Z8YA 1UM8A 3NHAA 2V8OA 4QJ5A 3U7FB 3AF1A 3C41J 1AIPA 3GLHB 3SBEA 4NE2A 4PO8A 3SN6A 4AKHA 3BJIC 4TZ0A 3KY9A 3ZYCA 2BVNA 3NC0C 2CCGA 2FZ4A 1SVSA 2ANBA 4FCVA 2FSGA 3TMKA 1KYIA 1O3YA 5TXGA 4B43A 4YDHB 3A37A 1W36D 2AKYA 4NCNA 4XJXA 2QBYB 2REBA 1VIAA 3K0AB 1N3BA 4UNPA 1CJTC 2F1RA 1M1YE 2WBLC 4OHXA 5DN6A 3SBDA 2DB3A 2IBMA 2A3RA 3I4LA 5JI3E 3GCGA 5FI1B 3FFAA 4Q1CA 1FP6A 1FQJA 2BKEA 3B8HA 4R7ZA 2VP2A 4WXRA 2WWYA 2IYQA 2OCAA 3CNOA 4TMZA 4ASUD 4S35A 4U7DA 3I5YA 4G1UC 2G3YA 1SXJA 1C1YA 4GL2A 2LWIA 3BB4A 3LQQA 3U6BA 3ZJYA 3HPRA 2X8AA 4B2PA 3CF0A 4L5BA 3ZVNA 4TMKA 4BECA 1G7CA 1ZU5A 4G5RA 3QPWA 1WBDA 2QORA 3PVSA 1NLFA 3T1VA 3LQRA 3ND9A 4LYFA 3LVQE 1OKKD 1G8PA 1ZD1A 4YONB 3KXLA 5AUOB 2RGBA 4MUAA 3RVBA 3P27A 3C7KA 3LAWA 3PEWA 1KZGB 1CS4C 2QT1A 4BFVA 5IK2D 4A36A 1E9FA 1U81A 5HZHA 3IKJA 1LY1A 4TLBA 3I32A 3T1TA 3I62A 4XOIA 2MSDB 1XMJA 1EG7A 2YKGA 1P2SA 3QJYA 4M1YA 4UKDA 3NH6A 5JBQA 2REXB 4OK5A 1SXJB 2AD5A 2C9CA 3WP1B 1OFTA 4Q47A 1GTVA 4YMUA 4NPHA 2PCJA 1VMAA 4B32A 4HLDA 4Z1MD 3TNFA 1RFHA 3DM9B 5FTNA 1TQ2A 2PCLA 3TK1A 2GXAA 5FBVB 2W6ID 2C96A 4QM6A 4NH0A 2QT0A 4HSEA 1TF5A 4JJZA 3WXMA 1I4DD 4DCVA 1DTSA 3OE7A 1W0KD 3TH5A 1MR3F 1FTSA 4CEHA 1E4VA 1PTRA 1AN0A 1QG2A 1B23P 4PSKA 4RZXA 2IUUA 1EFCA 1OB5A 1OW3B 2XOKD 3CPEA 2F3TA 3IUYA 2WKQA 3LFUA 4JL5A 2P6NA 4DLVA 2ZXUA 2ZE6A 4FW9A 5JECA 3BE4A 1JQLB 3C14C 4LSGA 2VSFA 2BOVA 1GDDA 1NIPA 2F7SA 5F3WB 1XTRA 2IA5A 2ZR9A 5P21A 4RSGA 4PC2A 4GOKA 3AVWA 1Z2CA 3F3YA 4LOAA 1F3OA 3DL0A 4OQMA 2ZJZA 3T5GA 2JJ1A 1KJYA 2ERYA 4TSFA 2IYYA 1S0UA 3ZD6A 4U02A 3REGA 4TLDA 3PEVA 2R6CA 3A1UA 3WRXC 2OXCA 4TYWA 2BJWA 1E32A 3B5JA 2ZAMA 3LX5A 4MRRA 4CEHB 1RRGA 1X3SA 3UWOA 3ZZ0A 2YUUA 1XTIA 4RKFA 2ZRMA 1FARA 2N46A 4Q01A 2V1UA 1FNNA 1JPJA 3L0OA 2IXEA 2QQ0A 4G0NA 4J0QA 3RABA 3TSOA 2ZETA 1H8HD 1T6NA 4TYQA 2OE2A 2XEXA 5FOXA 2VP4A 3CX8A 3IIMA 3QQ5A 5EJEA 3EIQA 4ZO4A 2NO6A 1D2MA 2H18A 3W8NA 2X2EA 2GJSA 3B1ZA 2J0QA 1KSHA 1XCGB 1Z29A 5AUPB 2G0NA 2QSYA 5JJKA 1G8FA 4B48A 4QC2A 1XPOA 1D8TA 1TEVA 2YV5A 3ONWA 3QG5A 3IBYA 4D4MA 1W7AA 4JBYA 1E2MA 4PHFA 2CE7A 1DAHA 2JIZA 4LPSA 2GXQA 2ZS7A 2A30A 1NP6A 1KO8A 2OEPA 4F93B 2JLZA 4MRVA 2OFOA 5EE1A 1N5LA 2PX0A 3N2IA 4Q7KA 3BFVA 4CT5A 2WWXA 1GKIA 1IBRA 1CR0A 1R0XA 2CCKA 2XSZA 2VHJA 4Q1EA 2R6AA 5LD2C 2AFIE 4OI0A 4IRUB 2R62A 3SHFA 3MLEA 3BWDD 3DM5A 1TL7C 1IY1A 821PA 2F9MA 1SVKA 2V9PA 2ZJYA 5DE3A 1M34E 2PJRA 4QGHA 5CDFE 2IEYA 3UXMA 2QG6A 3K9LA 2WAYA 3ZS8A 2ZRIA 3FMFA 1L4YA 4JLMA 4LHXA 4NCJA 2EFGA 4M8NE 3B7GA 1KDPA 2BBSA 1KDRA 4D0LB 1U90A 2SHKA 4A0GA 4A0FA 4C0AC 3ZVMA 1XP8A 1Z0JA 1IJFA 3N70A 3KDSE 2QNRA 4MGYR 4C3ZA 4PC6A 3DPUA 1MRNA 1DAIA 2GWHA 1XTSA 1FPMA 2HUPA 3SJAA 2WWHA 2H16A 4TQ9A 2CCJA 4NYIR 2PZEA 4OI2A 4EAQA 5FTLA 3EPLA 1OHHD 1ZC3A 3MWLA 2BEJA 1Z6XA 4KBFA 1T3HA 2RGGA 3AP3A 4M4SA 3U3OA 2Z83A 4TL8A 3AUXA 2WHXA 1DO2A 4PXAA 2TMKA 2WOOA 2H8KA 3T34A 3IQXA 4UNSA 1XMIA 4DWJA 4E5UA 3OFNA 2QTHA 3WYFA 3IO3A 2XJ4A 3CRW1 4LC1A 1DAMA 3IPYA 2V6JA 3O8CA 2JDIA 4KSBA 1W44A 3AVTA 2EW1A 1L7VC 2XTMA 4EPYA 1HT1E 5JWOA 2IS1A 4TL6A 4LUCA 1NNEA 3HU2A 4R9UC 1PLJA 4O0MA 3BD9A 3AM1A 2VPPA 1P62B 1VECA 2FFHA 4IEIA 1W5TA 1UKEA 4KYUA 1NVVQ 3UMRA 4F4JA 1SVMA 5JWHA 1PV4A 2RHDA 4IDPA 4TMWA 5AJZA 4AYXA 1K5GA 1W1WA 1P75A 4KLNA 2AL7A 2FSIA 2GZHA 1MRSA 1UKZA 1FL9A 1F60A 1TQ4A 3SC3A 5LDDC 1G8HA 2JASA 4IDQA 1Z2AA 4BLSA 3VR4A 4PFSA 5JS8A 1W36C 1CJKC 4LV8B 1QHHA 4HB0A 2WSSD 1ZIPA 4JLAA 3TR5A 3U3MA 3QPUA 1TADA 1QVRA 1R0WA 1KI1A 1ZM3A 5EXPA 4FXPA 4AKGA 4UNNA 2VP0A 1QF9A 3HYTA 3JVUA 4G5SA 4OI1A 4DT1A 2ZS8A 1NY6A 2QAGA 3LLUA 3QVVA 2R8RA 4OHVA 1XJ0A 3EPHA 4AYWA 3LXRA 3MWJA 2ZJ2A 1U8YA 2ZRCA 3QNUA 1BIFA 5EE3A 1MABA 5BWMA 3RYTC 1FX0A 5FOUA 5LB2A 2ZUCA 2RHMA 1K5DA 1E2LA 5G53C 4HATA 2XZLA 1BKDR 4Q5IA 4M1OA 1XPUA 1KDOA 1X1SA 1U94A 2ZI7A 4HZUA 5EQTA 3TQFA 4D2IA 3AVYA 3OAAD 4OYHA 2W2XA 2JLSA 5HE9A 1XMSA 1QHHB 2J0UA 5A0FA 1GL6A 3LWNA 4QHSA 4I1SA 1NN0A 2DFTA 4LPKA 1N5KA 5JHHB 4MGKR 5JEDA 2IF2A 4DT1B 1KI6A 4XWAA 2QAGB 3CRQA 5IT5A 1DBSA 3TAHA 1JBKA 3EIEA 2O0KA 3VNUA 4I1UA 3QUSA 2P6UA 1R5BA 2C2HA 2ZU0C 5B30A 2A5DA 4NMMA 4HZIA 1KDTA 1CIPA 5B57C 1PUIA 5FBQB 1MABB 1YZQA 2IYSA 3AKYA 2VQSA 5BYKA 2QU8A 1FX0B 4MDFA 2VBCA 4NYJQ 3A6PC 1DOAA 4MH0R 4TMXA 1XBTA 2RMKA 4GMXA 4BFXA 3BOSA 5F9HA 4F92B 1L2TA 2I1QA 4HZUB 4BLTA 1YZLA 4M9QA 3NKVA 4Q4HA 2WJJA 2J0UB
chains in the Genus database with same CATH superfamily
3BB3A 5EIHA 4KR0A 2CDCA 3MWEA 4DGQA 3GZ4A 4XIIA 3DBLA 2RE8A 1HFWA 1K9SA 5E9WA 3HDJA 1WW8A 3OWHA 3SVZA 1TPYA 1G3UA 1MA0A 2C92A 5E6SA 2ZVDA 4P3YA 2XECA 4QDUA 1CETA 2FDRA 3RTGA 1SR8A 2O1XA 2LW7A 3GJYA 4MR9B 1E0SA 1E59A 3GHYA 3E53A 5DB4A 5BO5A 4AUMA 4C88A 3PFHA 2G04A 4OP3A 1Y5MA 3T3HA 4GYYA 1DGQA 5FWNA 4FHZA 5KMGA 2Q62A 2BLLA 3C3CA 4MQMA 3AESA 3D00A 3GAMA 2GTPA 1ISGA 2CUNA 3HN6A 3P52A 1GNSA 4M8LA 1GRCA 2GVZC 2I80A 4PVCA 1F4PA 2H3EA 3BD7A 1BDIA 1VLLA 2J6BA 5B53A 1FFCA 2D5LA 3SOPA 3D8TA 4TLEA 1U3VA 5EEGA 1UBFA 4HDSB 3SNKA 1A8PA 5ALEA 2YMMA 3PC6A 4HQLA 4JI1B 2W6IA 3GEIA 4BO8A 2FEWB 2ABWA 1TOAA 4BVKA 1J8VA 2ZE8A 2Z6UA 5E3QA 2PYDA 3SXPA 3A6GA 3L4BC 2O8BA 2QE7A 2JG3A 4P92A 3RUFA 1EQ2A 3R3XA 5CX4A 1TGVA 1W88B 121PA 3OOHA 4G0MA 3ORHA 1CDDA 4JVNA 4PINA 3RB8A 3C6YA 5B58C 2DHEA 2QLJA 2RAUA 1Y9JA 2XH8A 1HEVA 3VQTA 5C46F 5ENZA 1W29A 2P9FA 1SGRI 3ZDCA 3K09C 3C5HA 3P4XA 1PPFI 2Q1YA 2IYWA 5FWXB 3IP6A 3OOJA 5AOCA 3V4PB 5K8UA 4KR7A 3NP7A 1J06A 1E3LA 4H7HA 4HGNA 3DAFA 1G20A 4BVBA 4EP1A 2JBAA 2W6JD 4JLWA 4GGOA 4PS0A 3GO4A 1TO6A 4XWKA 4LVOA 1YR9A 3HRHA 1M5UA 1JIQA 1U1FA 4F21A 1B1CA 1SBQA 5GY7A 4Y0VA 1BZYA 2MSKA 4JLKA 4ZVMA 5CGQB 3RYFA 5F52A 1FYDA 3L7LA 4ZYYA 3K2IA 3F5SA 1WCYA 3T5DA 2IUTA 1XDDA 1KYYA 1N0WA 1NM5A 2H59A 3ESZA 3FLBA 1L1FA 4GU5A 2BFBA 5BQ3A 4RD3A 3Q6MA 4L08A 1SEVA 1P6XA 3TOVA 1RWVA 4MW7A 3RHSA 1OI3A 5IKOA 1N8TA 1YC5A 4EFNA 4EOGA 3LNTA 2OESA 4JASB 4DV0B 4G1BA 3H5OA 3PT5A 5CB4F 1UBTS 5AKLA 4OKNA 5LQAA 1JYEA 5AVOA 3RF7A 4CM4B 2XUHA 5CITA 2ZB8A 2HM7A 2A6PA 4QRIA 1SCUB 1ZINA 2HQBA 4UQPA 2NV0A 1CZOA 5FDFA 2X22A 5DEOA 2UUBB 2DKVA 2ECKA 3OFVA 1HE1C 2JGRA 1N2HA 3KKZA 3O84A 4UDYX 3ROFA 1IQPA 5L95A 3QA3E 1NZDA 3VM6A 5DZSA 3DTVB 3TMYA 5BMVF 3FMVA 3TB6A 5J40A 5HWSA 1MJFA 1L8OA 4JBWA 2PS9A 4IG9A 4KFTA 3BREA 1QHEA 1N1EA 4O2RA 2AB0A 4WXYB 5DNWA 5G3ZA 1P2DA 2I6TA 3PHCA 5BXQC 3RARA 2JK1A 1I4LD 1Y81A 3EQ7A 4HG2A 5EHNA 5LBIA 3TX2A 1QE5A 1Q12A 4XGNA 1FNBA 4K6OA 1UMCB 3IA7A 1GYRA 5KNLA 4ER0A 2UYCA 3L8FA 1YIAA 2DJ5A 4KQKA 5FA8A 2EIHA 2EVWX 2VEDA 5TB5A 3W9UA 4YLYA 2OHOA 3HACA 4FIDA 3B51X 4GQBA 3AHEA 2HCJB 3OXGA 2B98A 1HFJA 4I1VA 4K88A 4KK4A 1SGDI 1U0EA 4M9RA 3DKRA 1S89A 4PY2A 1IZYA 2NSLA 5TQ0A 4BO4A 4MWGA 4GEGA 4YMVA 1N5OX 1QFSA 4ZIRA 4Y1GA 4IDOA 3CLKA 5MN4A 1IXYA 2C8VA 2DZDA 1X80B 3H2KA 3OBIA 5M3BA 3RKUA 4BGUA 2D59A 5IJ0B 5AI6A 2HF8A 1Q20A 5ERXA 1JDTA 3CVWA 2GVNA 1A5BB 1ZGBA 3ME5A 3SMVA 2ZVPX 1Y33E 1YZUA 2GJKA 4MQUA 3UCFA 2BFDA 1DLJA 1XTQA 2PEZA 4ZOCA 3TS1A 8LDHA 4HN9A 1A9PA 5IZCC 1E18A 3DC7A 3B1FA 3PEFA 5DM60 1FTGA 2R00A 3IURA 3PC8C 4QBKA 2XBLA 4HGZA 3W34A 3WK9A 5HNKA 3AUUA 1A7JA 4LTDA 1EX1A 3AKZA 2KM1A 5AIBA 1NPDA 1HH4A 1NVUQ 1FXWA 1S20A 4JX8A 3TTVA 1JBEA 3WIDA 5COBA 4C0XA 3UGDA 1OFIA 5L6LB 1L5HB 4MYCA 2ZSUA 2ZREA 3JVVA 4OUDB 3ZLVA 3QWPA 1P1BA 1HG1A 2CFTA 2VPIA 3IQFA 4G2NA 5LZ9A 4DUGA 5AW4A 2AKEA 1XNGA 1MT0A 3JQRA 1XO1A 3DMNA 8ATCA 3T1HB 1DAPA 1Y6JA 4PZPA 1PWHA 3D6HA 3TO5A 3UH1A 3DO5A 2BTOA 1V43A 1VL0A 1G8KA 3D0KA 1G16A 4F2HA 4PW0A 1JIUA 1XZJA 3JQBC 2CLHB 3UA4A 1V3TA 2GJAA 3DLTA 4YMTA 2WSYB 2FPPA 2P9YA 3BILA 5IDWA 1DELA 2C3OA 2V4UA 4IJUA 1UPTA 1WOMA 4RA9A 1K4MA 1YL5A 3ZU4A 5AVVA 4TWZA 3EFOA 3QXGA 2XZOA 5TVGA 4BB5A 3VMFA 3B2EA 2O3QA 2NO9A 2GZ2A 2OVFA 2PO5A 2Q9UA 3QJGA 3QLVC 4YUWA 3DE4X 7ABPA 1TJYA 4UNRA 4TV8B 1V95A 5IXJA 3DGFC 1IL0A 5ALOA 5KPDA 4LOJA 3IOYA 4N54A 1GZSA 3K8ZA 3CF2A 1HQKA 3JYQA 3L6EA 4UBLA 1Z0KA 1J9ZA 3KSRA 1RCUA 4BQRA 1UC8A 3HDTA 2G9QA 2C7GA 3INTA 2VAVA 4V1CB 4RFSA 3KOZA 3SZGA 4AD8A 2MMGA 2VVTA 5KSYA 3G5UA 3EGWA 1ILWA 2EJCA 1Z33A 5CVVA 3T3EA 2QMOA 1X74A 3UW3A 4DCJA 2FVXA 1H9CA 3MS2A 2KHZA 5GQSA 1TVEA 2FSPA 3ABIA 3GROA 4C06A 4C4OA 2NZ2A 4JJKA 4J07A 4LZPA 3A2NA 4U00A 1G8MA 2ZTUA 1FCJA 2DSNA 4HXGA 3NVAA 4K5QA 2FKAA 1YL6A 3T06B 3KWFA 1WSDA 4PAGA 2W6ZA 3OWXA 1ULNA 4K0KB 1IHXA 3LUDA 4BMOB 1NVKA 4F5YA 3E9ZA 4MI6A 2NO1A 1L4UA 3TJZA 1ZW6A 4YP5A 5CYFA 2WSSA 4CUJA 2AUNA 4IV5A 4MDHA 2ZROA 3GPIA 3GRUA 3L0YA 1JTFA 1ESCA 5FHQA 2X4LA 2FWIA 3M4NA 4ZFNA 3X1YA 3INYA 4A3SA 4QXAA 4C08A 5HSGA 4FD2A 2NQ2C 3G5AA 3FZEA 2AQ8A 4QUHA 1CG6A 1CB0A 1II8B 3FVVA 1DXHA 1XHLA 2Z3WA 2VP5A 5BQPA 4HMQA 3LBFA 3QUBA 4I9FA 1J0DA 2DAPA 4PLFA 2CFIA 3FB1A 3HCBA 3IIJA 1QHNA 1BWSA 4UE3S 3OQIA 2J3MA 1NG9A 4QRDA 3P2YA 4ZYLA 1YMUA 4GI3C 4N9QA 1K6EA 2FTKE 3EX7C 4R2HA 4CM6A 2OV1A 5KKAA 4F6RA 1W48A 3DS8A 1UOOA 4GI1A 1K98A 2YMPA 2CXOA 4UXHA 4RZUA 4B2LA 3X1JA 3WJ7A 4IVPA 2JRCA 1NU6A 1U2DC 3UG6A 3BIFA 2Y05A 3DOJA 4CMBA 5D51S 4EO4A 1LEHA 2CLDX 2ZVQX 4K6GA 4MA5A 1EDEA 1X0VA 3VR3A 1OX6A 4OHUA 4BFWA 1JFFA 3BWXA 2EW2A 1RJFA 1ZK1A 4P93A 3WQRA 4LY0A 1N9ZA 2PKRA 4G0ZA 1PFKA 1QX3A 4WASA 1N34B 1EYZA 4QOIA 4PS1A 4REOA 5EMMA 3G7NA 4EW1A 4DMMA 4IDFA 3D8BA 4ZYWA 2W6PA 5G0TA 4U7HA 1Q1GA 3DBRB 4QKQA 3FOZA 3DOUA 2NGRA 1GYPA 1P1KA 4B3TB 3I8XA 2Z9DA 1Y6RA 1TZJA 1P6UA 1SU4A 4G97A 1CT4I 1RR6A 2C5BA 2NXEA 4AJPA 2KMPA 1XA6A 2HRZA 4U8HA 4BATA 2FPWA 5GINE 1NJ6A 3O74A 3SCZA 4IICA 4DV5B 4TUYB 1OI4A 1T2CA 4OQLA 1R88A 4D4JA 4Z1OA 1BVHA 4ZD6A 5D8DA 3M1IA 4FN5A 4DR3B 1WMEA 2I4NA 3QA9A 4GDFA 2LIPA 4LFAB 1C50A 1N92A 2Z9CA 3ANXA 5E7JA 3OMXA 5AJYA 4C6RA 2ZIXA 3VZPA 4PE5B 4MEBA 4ZMSA 1IQ0A 2Z2ZA 2NXCA 3NUGA 4L4UA 3VZQA 4QFDA 4MVCA 3WYDA 3ZHCA 4B17A 4ER5A 1Y1PA 3M6VA 2FH5B 1Z2EA 4S04A 3H13A 1WIWA 3O7WA 1A9RA 1AZTA 2QT9A 4DMCA 1WV0A 4B9AA 1UWVA 1FVHA 4NESA 4XUEA 2ZJ8A 1ZQ1A 4IWNA 4HAUA 2A5GA 4BV8A 1KOJA 4C9BA 4CVNA 1PDWA 4GI7A 5ADHA 3R75A 1BMFA 5L7YA 1ULHA 3TLCA 3ZDBA 4QXRA 4A0QA 4F3KA 4D4IA 1U3DA 1YR7A 3HJGA 3P9QA 2PT6A 1YOVA 2C5HA 3LKVA 4DSOA 3R5XA 5M5BA 2X9NA 1HT2E 1UDRA 2IEZA 5LJIA 2WIBA 1PKXA 1ZN2A 1P4JA 1ZMRA 4LY6A 1AKEA 5B7GA 3GLGE 1KI8A 2V7GA 3DP9A 3UC9A 3WLFA 4FDAA 4HL6A 5CPBA 1G21B 1FSFA 2R11A 4KR2A 3NTXA 2OFFA 2D0DA 3VPBA 1ZUNA 3V6MA 3UKJA 1YJCA 2IPOA 2N75A 4URWR 3ZQJA 3M82A 3LV8A 1S8NA 3OZGA 4H4CA 3ONNA 2M32A 4MIOA 4N03A 1DDGA 1U1DA 3E35A 3FUUA 1XEFA 3KKLA 5K3FB 3VHQA 1JWLA 2WFZA 4OIMA 1OXKB 1Q14A 1X1QA 5KYTA 4LHVA 3S2UA 5JCOC 4C07A 4JLOA 1JJ7A 1LPOA 3H99A 3VISA 4A8JC 1KVTA 1N6KA 3RVKA 1BEZA 1RAIA 1KEWA 1RADA 1Y98A 1XRNA 1LI4A 1NNLA 1OR8A 3K5PA 3RTDA 4UTNA 4AP6A 5M2QA 5JATA 1NP3A 4I4TA 1YIOA 4M7PA 4IGKA 2IPAB 3COJA 4JT9A 1QX4A 1X7GA 4KX5A 2PH3A 4YAOA 2CZCA 1FFHA 1DBVO 1SUEA 4QZVA 5CDYA 1E79A 2OMKA 4XI9A 3RBZA 4Z4EA 5JMTA 3EZGA 2WV9A 4HDMA 3GIWA 4QOSA 4ER6A 4P2BA 1V2GA 1Z62A 4HLUC 3VHXA 4FI3C 1G2QA 3U13A 2NZJA 3LGSA 3I2HA 1Q7GA 3U4DA 1IN8A 4WJLA 1IB6A 1I4OA 1SZDA 3RJTA 1V6CA 1Z8DA 3RYIB 2J85A 3IUPA 2I2DA 3D54D 3OI7A 1TRKA 2A9OA 4D9KA 2C58A 2XUZA 1RI1A 5A1JA 4U2EA 2DH6A 3ZGYA 1YFKA 3CV3A 4EK9A 2PQ0A 5TEWA 4ZP1A 3R7WA 4F9EA 2OV2A 3RS7A 3HM2A 4OL9A 3GLHE 2RK6A 4KAFA 1RXUA 2ON6A 1X2BA 1Z28A 3Q2IA 2GVIA 1E0DA 1Y1RA 1ULZA 2WMOB 2TS1A 1LQ2A 4P08A 2HO5A 4EMUA 4DV4B 5C8YB 4HUQA 2R5WA 3R6LA 1FX1A 1OYOA 4NENB 1KTVA 4GI5A 4ZQFA 2AG6A 1Q1AA 4NY1A 4OMFG 3D3EA 4GPZA 4V02A 1O97D 2HFKA 4V0LA 3REFA 1BXZA 2O0JA 4B47A 1JH8A 4KVGA 1ZZGA 1GIAA 1W0CA 2Y6UA 4L15A 4O4LB 1W5EA 2LRHA 3AEXA 1PG2A 2VCHA 3Q9SA 3SZRA 5FBKA 3V4RA 3CLSD 3QE0A 3WTBA 1ZCZA 1D1PA 3VKGA 1UQRA 3RFTA 1QBGA 5G4KA 4ZDWA 4B85A 1AB6A 4PQFA 1SVLA 4TMYA 2VDWB 4ZOEA 3QKRA 5EE5B 4D9FA 4DJ5X 5A5GA 3LZ6A 3DDOA 1QV9A 4G4GA 2J30A 3M5PA 2CDNA 4DMKA 3A32A 2H7CA 2WYVA 1H4TA 3LDFA 4CFSA 5LLDA 1KFCB 1GUBA 1JA1A 5J8CA 1SPBS 1KMNA 2BMAA 1XX6A 3JAKB 4MUKA 4PX3A 4KPYA 2XXAA 1Y6ZA 1QRDA 4LGYA 5J47A 3KBOA 3JARA 1S9DA 1AO3A 2O2XA 2PWYA 4LVUA 5DXFA 4EHKA 1NT2A 1BXRB 2NVOA 4I81A 3OZXA 3JTMA 3BMCB 1LSUA 1TKCA 2Q0SA 4FFMA 2NUPB 4ILKA 3NKFA 1XZDA 1YK0A 3GFSA 4HDNA 1WB6A 3NEAA 4MK4A 5LWHA 1TVMA 2J5BA 1WHSA 2G82A 2VL7A 3ZGOA 3K92A 3KQKA 4P1ZA 4EKIA 4B6DA 3ZXXA 4ISBA 5AQEA 3JAMA 3AXTA 3IOEA 3LGAA 1E2FA 2PPVA 4OBBA 1P61B 5CXSA 5KI6A 2NOAA 5JNSA 4YRDA 2GM5A 4BFUA 4LNAA 2D1YA 4RIHA 3TLKA 4I1PA 1PQWA 3TNLA 1ZOPA 2RHTA 1VMEA 2ORED 4HEJA 1QIHA 4GAEA 2DB6A 1D2CA 4NZMA 5DTMA 4CFYA 4HNGA 5FTMA 1Q9BA 3VKVA 4R3NA 2V9CA 4M87A 5CA0B 1PQPA 1E1QA 1PJBA 2GHIA 4A2WA 1GWNA 2Z5LA 4IMPA 4RH0A 3HB7A 1X9IA 4MPTA 3CEHA 4QTXA 5IWAB 1HL7A 4EUFA 4N5LA 1QKIA 3K2EA 1UAGA 2IHVA 3KWLA 2J48A 2X15A 3H1GA 2Z57A 3EXEB 1JTEA 2FN7A 1WABA 3TXXA 3S2EA 5JDCA 1ZGJA 1KXZA 2ZJOA 5LPNA 3CN9A 3R0IA 4EG7A 4EW3A 4BLWA 5CDTA 3W4KA 2XE7A 4Q66C 1A82A 3TJMA 3UJCA 3VTKA 1GAEO 4UZEA 4MWCA 5C1IA 1PNTA 1DHRA 4FE4A 4YJFB 1L5LA 2CHUA 4K6CA 4X7BA 5CRIA 3D7SA 2PLNA 3NAMA 2VG8A 3MRSA 4RMHA 5KAPA 3THYA 4EUNA 2XR1A 4JI8B 5DM0A 4X3PA 3DDCA 1PK8A 2XY4A 3D64A 4I2NA 2Q4DA 2O7SA 4RSHA 3IDZA 5IP5A 3M4ZA 5BSMA 3WJ1A 4RVUA 2A59A 4IBOA 2FZGA 2V97A 1GPWB 4P4SB 4NFLA 4GE3A 3UJ7A 2G6TA 2R6DA 5BW5A 2HA0A 4UVEA 1I80A 2AK3A 3ZQ4A 4GYJA 4MV0A 4AZTA 2G80A 1COWA 4J4BA 4B81A 4ZVOA 3SR0A 4HXYA 4JLNA 3H86A 5A4DA 2QAIA 5JZOA 2XLBA 1P8AA 1GFZA 3LGXA 4OFXA 1DEXA 4KQWA 1DVRA 1EWVA 1JQJC 1ZWKA 4J0JA 5IANA 2XMRA 4B8WA 3GFTA 1C2TA 2PX5A 4MIKA 4KUGA 3HGTA 1MAWA 5AI4A 5BT8A 2IH4A 3E4CA 4FTWA 4FVTA 4XPIB 4ENPA 2REQA 3GNSA 1JLLA 1ML4A 1NATA 1A4RA 2PUTA 2JA1A 1QGYA 4WLNA 3DLPX 4NCXA 1VHWA 1UBCA 5DSZA 1DX6A 4IZHA 1ST2A 3RSZA 1XZ8A 1IIRA 1ZD2P 3UWSA 5HZGA 2H11A 3BMXA 3U3KA 4BZPA 3UPUA 3FGZA 2XUJA 3Q7IA 1SKYB 4HJRA 3HKEA 2Z04A 5ERGB 2D1RA 3S40A 2DWQA 4JQOA 2D3TA 4LG1A 3UJ8A 2C84A 3KSBC 4C4AA 4S2EA 4DR2B 5A4KA 4DMUB 4WADA 3O93A 5H8WA 3QI2A 4FYJA 2DIPA 3JZDA 4P86A 3A9UA 1P0MA 3K6SB 1ZXLA 2QTAA 3A58B 1QO0A 4U6SA 1QFZA 2HJRA 2MSWA 4BCCA 1WB4A 2B7CA 4XPZA 3NBMA 1O54A 5ECYA 3S55A 4EB6A 2C04A 5JMWA 4RHTA 1YOBA 1JAYA 3ADKA 3HY4A 5KTRA 2ZJ3A 4RGBA 2X9QA 4NDZA 4QG3A 1XMOB 1UT6A 1NVEA 4JT2A 3K72B 1R79A 2AN1A 2SICE 3KU4A 3R7DA 2FW0A 2JIBA 2XCLA 3OJOA 3FLMA 3OJEA 4N0PA 3QX9A 1YHNA 4FS3A 4OXYA 3CEAA 1JEAA 2RGAA 2PYIA 2R8PA 2DKNA 3GJ0A 3B1VA 4X6UA 2YWHA 5HTOA 2VPYA 1PJ3A 3I6ZA 4X1YB 2QG4A 1IQUA 1BXGA 3CLTD 4IJ6A 4B3BA 4BNYA 4B3SB 1MT3A 1X7YB 3CO5A 3HH8A 1FFGA 3OT1A 3PNVA 3U60B 4PR3A 2VDOB 5LLSA 3PQ8A 1UXOA 3EXHB 3OO1A 3LRPA 3OFJA 1N25A 1X1RA 4CNQA 3SYMA 2GO7A 1P2VA 5KZMB 3FPGA 5EPUA 1VJCA 1GNRA 2CLCX 3PXCX 1CVLA 4TS1A 3ZIUA 3ICPA 1SA0B 3CUYA 4GBED 2B5VA 1U8AA 3HXPA 3LBIA 1OQAA 1LDBA 3QM1A 1DFGA 1E2EA 3DCJA 4ZU6X 4J9VA 4CEIA 4QQNA 4X66B 1DKOA 2BGUA 1HDOA 1AURA 3QXSA 2OAP1 2WHPB 2P4SA 2C83A 2VDNB 3HR7A 4IQ4A 2GO1A 3IPXA 4LWQA 4WKCA 5J2UB 1QIFA 2GBIA 4R98A 3IIKA 4EHAA 5JNTA 3HCRA 1I3OA 1CUFA 2XD4A 3F78A 3KD2A 5ERYA 3GLFB 1DIAA 1QAQA 3KZKA 1S96A 5FPSA 4CT4B 2YOFA 1US8A 4FFNA 4KMRA 1ACJA 5IKPA 1KTIA 5JAHA 3KR2A 5C5CA 1MDBA 3A7EA 2X8JB 4RYDA 4GL4A 2HRBA 4WN9B 5JEDA 1XP5A 2VUUA 1VKRA 3A4IA 1P72A 4MW5A 4LAFA 1L3CA 3FIJA 1LSJA 1P8JA 1FB5A 4P4UA 4TRNA 2JFVA 4UM8B 1KVQA 5TNXA 3ZDEA 1KFBB 3KQNA 2Q46A 1YE8A 3B36A 4O5AA 1F8FA 3ZNOA 1KEKA 1ZI8A 2W8ZA 1W36B 1MAVA 2QXUA 1Y9EA 4HX9A 1TUEA 4DILA 1G3MA 2AOTA 1TA9A 2P6OA 4F7WA 4EY4A 1QHGA 4Y7CA 5FPPA 1XVLA 3TTSA 3P9ZA 2BFWA 1LS1A 2HQRA 2ODNA 5E7IA 1A9OA 1ULKA 3T15A 5AMXA 5TQ2A 2NU7A 3SDZA 3K7EA 1Z16A 2HJVA 2OD7A 1SCDA 5I9BA 3VPHA 1M5RA 3ITEA 3WLHA 3VKHA 1NVDA 1Z45A 3WISA 5LP6A 4N39A 3PICA 3TCNA 3UUFA 2OSVA 4AWBA 4FEAA 3EC1A 2FA9A 5F2NA 5KJCA 2Q5LA 2QD3A 1TXGA 3FE2A 1TMGE 4J90A 1NXSA 1CUDA 5HCIA 1KQNA 4ARZA 4LV5B 1AA9A 5CAEB 1ONSA 4BWFB 1YRWA 5EIEA 1U98A 3GAAA 2C2YA 2DPMA 2X8LA 4FPXA 3SQLA 1OF1A 2YJ4A 3X1ZA 2I2BA 4DZRA 2QW1A 5C32A 2VHEA 3VO9A 1J8YF 3G59A 1ZD9A 1NXTA 5EFOA 3NLLA 1OWPA 5L8VA 5F51A 2R66A 3ZWCA 2DUUA 4J03A 4QAQA 1YZKA 2XQJA 4I2VA 5AKEA 2V7PA 3WGYA 1O97C 1P1RA 2PSHA 4B4DA 1YB2A 2QK4A 2XOKA 1F1BA 2DFPA 2BR4A 1KA9H 2IZOA 4M55A 5IDYA 3T9CA 3HRKA 3MB8A 3WRVA 4GKKB 3OM1A 3NJ4A 3NNSA 1HYGA 4AK9A 5LVAA 2ONYA 1NJ1A 1NR5A 3JQGB 3CVJA 2P9EA 1T9AA 2XUQA 5HMMA 5IXYA 3CLSC 3N7TA 2Y1GA 4JYCA 4OXQA 2OG1A 4GPBA 1QH1A 2AR0A 4A2PA 3ADOA 5KYUB 2Z5FA 3K0SA 3DLHA 4JITA 5B12A 2AMYA 1YCFA 2Q6IA 3EGXB 4GECA 3ADDA 3INGA 1S2OA 2A20A 2GETA 1N5JA 1H2WA 2GD2A 2JCBA 2ZSAA 3BHMA 1TF7A 1RSZA 1PP4A 1VI5A 1K8RA 3UK7A 1T43A 4MAMA 2XUFA 4J2HA 1IHDA 1SU6A 3A6EA 2Q8PA 3FRHA 1KSJA 3H8SA 1OWOA 2ZZKA 3SYTA 2VRWA 3DDWA 3DHNA 2V54A 4MYSA 3G0CA 3U81A 4Y2TA 5EZ6B 3WMXA 4OUKX 3HLKA 4HHEA 4R1PA 3T61A 1CY6A 5K0ZA 2NV2B 2IIBA 4LOIA 3P2MA 2D62A 3OE7D 1A95A 1QTQA 3C3JA 1R3DA 3N5CA 3LDUA 1GU0A 4UJ5A 3S1AB 3K9FC 4IF4A 4QXOA 2NVUB 5LBUA 8ADHA 3KVOA 3A05A 3C1AA 1X7ZB 3B78A 1KKLA 4ZI7F 1RI2A 4ZC8A 3MJRA 4M89A 2VFAA 1WNFA 2GCEA 2FE4A 2OCBA 3MC1A 1J1IA 4QQFA 4KWTA 4YJ3F 1N5DA 4JHXA 4ZRMA 2N9UA 3TINA 1WVGA 1DQYA 1ZNZA 4AN4A 4M1QA 3Q0IA 1PT9A 5FLYA 1EP3B 2X5NA 4M0CA 1JLRA 1QYCA 1OX4B 1R18A 2OHXA 2IOFA 3TLEA 5K8JB 1PUJA 4EI9A 2ANCA 3OC0A 3JWIA 2JEZA 4QODA 4XWTA 5BV0A 5K3AA 3B3QA 3NT5A 1U31A 1H65A 2G83A 1E1MA 5DYIA 2PX4A 4QYXA 3SDSA 3EPRA 3SXUA 3TLJA 4AF6A 4H1WA 1W1IA 2XHEA 3GEMA 3LO8A 1SBNE 1AGPA 5A9RA 4GF5A 3CKKA 2QZZA 1XNJA 1XT6A 4CMIA 2VP3A 4MUYA 1JV2B 2BN4A 4RD2A 1LK0A 1D4OA 1E6EA 3DW3X 1Y1QA 3L9WA 4IUDS 5E7MA 4R8LA 4TT8A 4ND3A 4OQZA 3DBOB 4E4YA 2PLFA 1ZJ5A 5TLSA 3SX4A 1CQWA 3WIEA 2CEKA 2I3AA 3CO0S 2R2AA 4FLEA 4KMMA 5CLIA 4DCUA 5LA6B 1UBEA 4FX2A 2RHRA 1XXHB 4PO1A 2OD9A 3MHTA 2PLRA 1M76A 1PWYE 3FTDA 3SJCA 1ST3A 2IOHA 5FL3A 3PWSA 1XMVA 4JBHA 5AUQA 3LP5A 1EJ2A 1G291 3PHHA 1UIMA 2HA2A 5DF1A 2DKOA 1L7XA 4P7BA 1QG4A 3IHLA 1NW6A 1P2BA 1SGYI 1QIJA 2ZI6A 3EMBA 3RIXA 3DR5A 4C7JA 1ID8A 3Q8MA 3IVCA 1IY0A 4P3OA 4DLKA 1LNZA 3P94A 4L4YA 2BP7B 1WULS 4V2UA 2NXNA 3K9CA 2JIZD 4TKUA 1H0HA 2CNLA 4QGSA 1SXGA 1E3TA 2AHOA 2DMRA 4BE7B 2B6NA 4AZ3B 2QN2A 2E4AA 4X61A 5BOVA 4UMEA 5G40A 2PM8A 3GGGA 5JNWA 2OORA 3O1IC 5A3VA 4E2ZA 2W4MA 4DIKA 1QQAA 1I0IA 2E7ZA 4J0HA 4I4CA 2PXHA 1ZUHA 3JWEA 2F48A 2JIDA 3O73A 1HORA 2G4LA 2GJ4A 3WDSA 2XLCA 4ND5A 2KLBA 4RTLA 5CB0A 5IDXA 3UGLA 1OTXA 4ZK6A 5LUAA 2DPLA 3HWRA 4LBWA 1ZM9A 3HO1A 1VHDA 3QIAA 4NOKA 4ROSA 4AJJA 3OLYA 2LIVA 2ZYGA 1HJAI 4QYSA 1WUHS 1T36B 2ISSD 1GZ6A 1L7AA 3W2TA 3R8FA 1VL6A 2PXXA 1AQLA 2GILA 4NARA 4E1BA 2Q21A 2P68A 2B5WA 2FRDA 1JSRA 2P65A 3GX1A 3R7LA 1U3WA 3P2JA 3HEMA 1T8UA 3A26A 2FDXA 4P4LA 3SFTA 2DJIA 2BUSA 4OJTA 3TRKA 1LR9A 2I3BA 2P4QA 2RC6A 5GP1A 4XQGA 4G0UA 3S8YA 1G20E 1I3LA 1S1CA 1DJNA 2K2WA 1HWYA 2PZ8A 2X9GA 4ZDKA 1ZJ4A 3C5CA 3CVVA 1AT1A 1EA5A 4M38A 5KJ1A 2QW8A 5KYYA 2Q6OA 2R4UA 3CLTC 3L7YA 1KI2A 3PUKA 3ZY2A 3NONA 3SHVA 5DNDA 2A8YA 2FU5C 5DRYA 5EHQA 3OA2A 2BJVA 3I9JA 2I4RA 4XYEA 3DLBA 3BD6A 1JS1X 3WGGA 3ZY4A 1CQIA 1IM2A 2GK6A 1YTLA 2QG9A 2YXBA 1WPXA 1Z0SA 3ZW7A 4EVRA 5JS7A 4NQZA 1KS2A 4Q19A 3BWMA 2H07A 2I7TA 3IT1A 4JXZA 1GVHA 2QN8A 3ODPA 1QQ5A 3H4TA 4KQHA 2FWBA 1H5UA 2E18A 2ZTSA 1U9IC 4BRWA 1CUSA 3AILA 4XTRA 4YI5A 3NYWA 5AOVA 4Q00A 4W6ZA 1QORA 4HRYA 4H1VA 2JARA 3OQOA 4ROTA 1ITZA 4B46A 1QPGA 3EUFA 3B9BA 4D8TA 3VVLA 5JVDF 3K1ZA 4LJ8A 4HYYA 4BMNA 2Y66A 4LZAA 1C7RA 2QPTA 1TYZA 3I04A 3JAWB 1EIZA 1D2AA 1HDIA 2J7KA 2NU9A 1TO2E 4HDOB 4NPAA 4Q4JA 3DB2A 5HQ3A 3AUFA 1TTQB 1W52X 1HL3A 4OQFA 3EE6A 3F5MA 1U4OA 3LX4A 5THKA 1TK2A 1MB2A 4ZVKA 1VHLA 2EFDB 4HQRA 1K6IA 1UK8A 3R5HA 5AW2A 3GJSA 1E1CA 1GGKA 1M0SA 5KNCH 4DR7B 1ODSA 1E66A 2GLTA 4MUHA 1XQ6A 3VR4D 1DKPA 4KFSA 4XRRA 3CBQA 1U0OC 3QYAA 4G85A 3CB4A 4KOAA 4US1R 3Q3VA 3ZEIA 1CB7A 2H7XA 3AEQB 2PL9A 1Y4AE 2IYXA 2HDHA 2HX1A 3MJDA 3VYUB 1YJ8A 4MUEA 4ZI7A 1K5PA 4JP3A 1JVSA 1AH2A 3WFZA 3MAJA 3R09A 5M7EA 3NIBA 3W5VA 3FVQA 2JEOA 1AUQA 1E9SA 2NLOA 2OHIA 3A1CA 4OK3A 3EN0A 2PFKA 3OZEA 2IH2A 2Q7XA 5CVJA 1Z4PX 3MTJA 3DLCA 3O75A 3Q1LA 5LP6F 4CQJA 2XGJA 4KH1A 4BX0A 4OQQA 1RJGA 3I09A 2JVJA 2VPWA 5KX5A 4TWBA 2VZEA 5J2TA 3UQZA 4NJOA 1KRXA 1MJ5A 4EBBA 4HN4B 3C7AA 1E9EA 3K9HA 2B35A 2YWEA 3A9WA 4U2FA 2N71A 3R6WA 4NJEA 3QVTA 3BAZA 4KYIB 4P31A 3UHFA 4CV0A 3NXSA 3VR2A 3LQFA 4AMGA 4TPKA 5CB4B 4YP6A 4NXNB 4JLPA 4IDBA 4RTNA 3UV3A 1Y9DA 2YMLA 4RJLA 4B3FX 4W1SA 1P44A 3H4IA 1IE3A 2J08A 1R12A 1F8GA 4U9HS 4BOYA 5HIKA 2YFQA 2N1MA 1LVGA 1EK0A 3KLBA 4I8IA 4L73A 4MVJG 1NE7A 1TJ3A 1RC0A 1QHXA 3I1FA 3R8CA 3I6QA 2FMKA 4RS4A 1M6YA 5EXDA 3E81A 4DM3A 5BMVB 3DYVA 1X6VA 3T9FA 4N5DA 5EHZA 3NATA 3HJCA 5IAJA 1AS2A 1YBMA 2HRCA 2RAFA 3A3NA 4FNOA 5GOZA 4F1JA 2GK7A 1M8GA 1I9GA 3PZBA 4OSOA 2KMOA 1CQZA 1MO2A 2IIPA 3GUUA 1YR1A 2EKDA 2GHTA 2W0MA 5BPHA 4RPJA 3B53X 5AVKA 1YBAA 3WQQA 4D4GA 1NHGA 4A24A 1ZUWA 3WNVA 4BO5A 1GRRA 2YOGA 3A1VA 2YL2A 3ZCQA 4PSUA 2DPGA 5CDFA 1E77A 2V1XA 1GNLA 3JCZA 3DNFA 4F6LA 3GEGA 4ZOLA 1L7PA 1POXA 4GE0A 5CVCA 5JPIA 3DMDA 1KAMA 2PX6A 2ZT6A 4KO8A 3ZE6A 1ADBA 4ISCA 4KRFA 4OHYA 1J1UA 1E2IA 2IQ5A 2R9VA 3EGDB 3ACBA 2VATA 3K0EA 5DW3A 2NMVA 3ETNA 3ETDA 4NU0A 1EZZA 1XZEA 4CMGA 4OU4A 1XD9A 3LIPA 4GBMA 4BNFA 4RTQA 1K3TA 1JU3A 2JGKA 1Z88A 3GT0A 4YPFA 3OUTA 4YMWA 2AEFA 4RPGA 3OZTA 1CUBA 5CUQA 4ERXA 2KMLA 5AW0A 3HTXA 3LOUA 4HMOA 2P2YA 4DCGA 3AUKA 10MHA 4L16A 1PNRA 1T9HA 2BMFA 5IC6A 1NOJA 4BMPB 4Z4GA 3THWA 1F7UA 1HY3A 1BN6A 1SOVA 3LHFA 2GBPA 4Q24A 4CRWB 5LM3A 1GZ7A 1Z0ZA 1I13A 3CX4A 4DJEC 5F23A 5EJ6A 5ITVA 2VYFA 2C98A 4EY5A 4F97A 3C3MA 2KYRA 1NOIA 1QGUB 4OOEA 2VKQA 3OLCX 2PH1A 4NULA 4QOJA 4TWJA 3ESBA 4LRXA 4YV2A 5M04A 1Y8CA 4TXLA 4KW7A 4UCQA 1RIFA 1ZVJA 1R10A 2IYUA 3IT2A 2OAGA 4R3WA 1CUAA 1PGPA 3HA3A 5KDLA 1Q7BA 3BKXA 1E5QA 3QU2A 1G55A 3C85A 3EISA 2YZGA 3R6TA 4GOLD 4POAA 2AVNA 1EX7A 3LQ1A 1MEEA 4LSMA 1C8LA 2AXPA 2EEZA 3KU1A 1HC7A 4QU9A 3SC6A 4PRLA 1QK5A 3P32A 3K1AB 5A4IS 3UOEA 1NJSA 2CBXA 2CFOA 4NP6A 3RVOA 4BRUA 5BN1A 1CSOI 2CK3D 4HNAA 2JD1A 3WZ2A 2Z2YA 5H9WA 5K8LA 2EATA 5JYBA 4PTLA 4EGAA 2YWXA 2FPKA 3BULA 1T4CA 4LHYA 4E2WA 2D7JA 4F11A 5ALPA 2XBMA 2GN1A 2A1TS 1G7RA 1A27A 2WWWA 3NGXA 3LRXA 4IXDA 2HYDA 3B13B 3KK0A 2R6GA 5BV8A 2HIGA 3G68A 4IF6A 3PIRA 5CEFA 1GZ4A 2AC2A 4DV7B 1ZO8A 2GX6A 4DRYA 3DTVD 4DIEA 2MHCA 3CONA 4L0QA 3A9CA 1CE8B 1HETA 1OASA 2G9ZA 3WLQA 4CUZA 5B55A 5IYZF 2VJMA 4ZEXA 2Y9MB 3X1XA 2HK8A 4AQYB 3I6YA 1P29A 2VHUA 2F43B 4UDOA 3VTAA 5HKKA 1J07A 4A5SA 1Z73A 2QRNA 5EJ5A 5JVDA 4WHMA 4AUKA