1TBOA

Nmr structure of a protein kinase c-g phorbol-binding domain, 30 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords PROTEIN KINASE C, GAMMA TYPE
publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
total genus 8
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tboA00
2ENNA 2ORVA 1XA6A 2E73A 1R79A 3UGIA 3BJIA 3E2IA 1W4RA 1PTQA 4UXIA 5FUVA 4B6DA 2WVJA 1XX6A 2J87A 3KY9A 1PTRA 4L9MA 2VRWB 3UEYA 4UXJA 3UGDA 1FARA 1XBTA 2GVIA 2YUUA 2QQ0A 3UGLA 2ELIA 4UXHA 5FUXA 3UEJA 3CXLA 2ROWA 2B8TA 2ORWA 1KBFA 2FNFX 2DB6A 1Y8FA 2QQEA 2UZ3A 4FKDA 1RFHA 3UFFA 2ENZA 2J9RA 2JA1A 5FUWA 5FUYA 1KBEA 1TBNA 2QPOA 1FAQA 1TBOA
chains in the Genus database with same CATH superfamily
1P9ZA 2ENNA 2ORVA 1ULKA 1XA6A 3OXFA 1OMTA 1TUSA 1CT4I 5DAEA 2SGEI 1TBQR 2V1CA 3QTLD 3QWPA 1X74A 1XX6A 1OVOA 2PQ8A 2WVJA 3FSYA 4AMLA 2SGDI 3SGQI 4E1RA 1MJBA 1H0ZA 1XBTA 2GVIA 1SGDI 1FYBA 5JHWC 1Z7KB 1MT1A 1UUCA 2XRCA 4GI3C 2QQ0A 3D00A 1K7VA 3UEJA 1UVGA 1V1HA 2L7XA 3UGLA 1SGYI 2E5RA 1KMAA 2GIVA 1SGRI 2ROWA 2M5XA 2SGQI 1OYVI 1Z2IA 2ORWA 1M8CA 2YQPA 2FNFX 2DB6A 1Y8FA 3OL0A 2RC4A 1IY5A 2N1AB 5J8FA 1K7TA 2LB7A 3B4VC 5FUWA 7WGAA 2A20A 1HPTA 3MEKA 3TOAA 4WP4A 2B0UC 2W0TA 1K7UA 1CSOI 2QQCA 2X3TA 1NUBA 2X52A 4HGUA 2SGPI 3E2IA 1PTQA 2KMOA 3OXLA 4UXIA 1AN1I 1N13A 2CJSC 2K9HA 4L9MA 2NU0I 5CCLA 1TGSI 3SEKC 1OMUA 5EX0A 1YTPA 4A24A 2GKVA 5E3QA 2V1CC 2KMRA 2N17A 1TBRR 4UXHA 2KMPA 1CT2I 1YU6C 1PPFI 2SGFI 1DS2I 2V53A 2B8TA 2L8EA 4JCVE 1IY6A 2NU2I 2QQEA 4FKDA 4MPIA 4DNCA 2ODDA 2CWGA 2P6AC 2QQDA 3TO6A 1PJUA 5CCMA 1CHOI 2JXDA 1BMOA 1MJ9A 2CWHA 3VE5A 2QPOA 1HJAI 1WGCA 3HH2C 5HI7A 1PCEA 3RU0A 1TOTA 2Y0MA 1R79A 3UGIA 3BJIA 2ERWA 5FUVA 3R5DA 2OZUA 4B6DA 1LR9A 1TIHA 3UOEA 2GKTI 3KY9A 1PTRA 3E59A 4UXJA 1SGEI 1FARA 1M8BA 1SGQI 1UVFA 2RIJA 2YUUA 1WGTA 1SGNI 2LUYA 2DKVA 3CXLA 2BUSA 5J8CA 3GOXA 2DIPA 1KBFA 1SGPI 1HDLA 1ULMA 2UZ3A 1U5KA 3R5BA 2NU4I 1NXUA 3R5AA 3TO9A 2GKRI 1Y1BA 3PDNA 2NU3I 1VDDA 3TO7A 2KMQA 3OXGA 2OD1A 3QAHA 2LEOA 5EX3A 2ARPF 1KBEA 1TURA 3OVOA 1Y1CA 1MJAA 2E73A 1W3SA 1BUSA 1W4RA 1WTJA 2KCXA 1WKXA 1IW4A 4E1PA 2J87A 3UEYA 3R5CA 2VRWB 3VDPA 1CT0I 3UGDA 1V1IA 2F3CI 5E3RA 2WGCA 4OVOA 1R0RI 1ULNA 2ELIA 5FUXA 1HEVA 2JYYA 1FY7A 4SGBI 3TJQA 2JZMA 2UVOA 1Q9BA 1CGJI 3FSXA 1X4SA 2N71A 1LR8A 2NU1I 3FC3A 2WCYA 1CGII 3TOBA 1LR7A 1RFHA 2ENZA 2J9RA 1UHAA 3UFFA 5HQ8A 2JA1A 1P9GA 5FUYA 2N52A 9WGAA 2CWFA 3SGBI 1DS3I 2OVOA 1TBNA 1S20A 5E3PA 3VDUA 2OU2A 2JW6A 1FAQA 1TBOA 1CE3A
chains in the Genus database with same CATH topology
2ENNA 2ORVA 1XA6A 3OXFA 1OMTA 1TUSA 1CT4I 5DAEA 2SGEI 1TBQR 2V1CA 3QTLD 3QWPA 1X74A 1XX6A 1OVOA 2WVJA 2SGDI 3SGQI 4E1RA 1H0ZA 1XBTA 2GVIA 1SGDI 1FYBA 5JHWC 1Z7KB 1MT1A 1UUCA 2XRCA 4GI3C 2QQ0A 3D00A 3UGLA 3UEJA 1UVGA 1V1HA 2L7XA 1SGYI 2E5RA 1KMAA 2SGQI 1SGRI 2ROWA 2M5XA 1OYVI 2ORWA 1M8CA 2YQPA 2FNFX 2DB6A 1Y8FA 3OL0A 1IY5A 2N1AB 3B4VC 5FUWA 2A20A 1HPTA 3MEKA 2B0UC 2W0TA 1CSOI 2QQCA 1NUBA 4HGUA 2SGPI 3E2IA 1PTQA 2KMOA 3OXLA 4UXIA 1AN1I 1N13A 2CJSC 2K9HA 4L9MA 2NU0I 5CCLA 1TGSI 3SEKC 1OMUA 5EX0A 1YTPA 4A24A 2GKVA 2V1CC 2KMRA 2N17A 1TBRR 4UXHA 2KMPA 1CT2I 1YU6C 1PPFI 2SGFI 1DS2I 2V53A 2B8TA 2L8EA 4JCVE 1IY6A 2NU2I 2QQEA 4FKDA 2ODDA 2P6AC 2QQDA 1PJUA 5CCMA 1CHOI 2JXDA 1BMOA 3VE5A 2QPOA 1HJAI 3HH2C 5HI7A 1PCEA 3RU0A 1TOTA 1R79A 3UGIA 3BJIA 2ERWA 5FUVA 4B6DA 1LR9A 1TIHA 2GKTI 3KY9A 1PTRA 3E59A 4UXJA 1SGEI 1FARA 1M8BA 1SGQI 1UVFA 2YUUA 1SGNI 2LUYA 3CXLA 2BUSA 3GOXA 2DIPA 1KBFA 1SGPI 1HDLA 2UZ3A 1U5KA 2NU4I 2GKRI 1Y1BA 3PDNA 2NU3I 1VDDA 2KMQA 3OXGA 2OD1A 2LEOA 5EX3A 2ARPF 1KBEA 1TURA 3OVOA 1Y1CA 2E73A 1W3SA 1BUSA 1W4RA 2KCXA 1IW4A 4E1PA 2J87A 3UEYA 2VRWB 3VDPA 1CT0I 3UGDA 1V1IA 2F3CI 4OVOA 1R0RI 2ELIA 5FUXA 2JYYA 4SGBI 3TJQA 2JZMA 1CGJI 1X4SA 2N71A 1LR8A 2NU1I 3FC3A 2WCYA 1CGII 1LR7A 1RFHA 2ENZA 2J9RA 3UFFA 5HQ8A 2JA1A 5FUYA 2N52A 3SGBI 1DS3I 2OVOA 1TBNA 3VDUA 1FAQA 2JW6A 1TBOA 1CE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENN A;  2ORV A;  1XA6 A;  2E73 A;  1R79 A;  3UGI A;  3BJI A;  3E2I A;  1W4R A;  1PTQ A;  4UXI A;  5FUV A;  4B6D A;  2WVJ A;  1XX6 A;  2J87 A;  3KY9 A;  1PTR A;  4L9M A;  2VRW B;  3UEY A;  4UXJ A;  3UGD A;  1FAR A;  1XBT A;  2GVI A;  2YUU A;  2QQ0 A;  3UGL A;  2ELI A;  4UXH A;  5FUX A;  3UEJ A;  3CXL A;  2ROW A;  2B8T A;  2ORW A;  1KBF A;  2FNF X;  2DB6 A;  1Y8F A;  2QQE A;  2UZ3 A;  4FKD A;  1RFH A;  3UFF A;  2ENZ A;  2J9R A;  2JA1 A;  5FUW A;  5FUY A;  1KBE A;  1TBN A;  2QPO A;  1FAQ A;  1TBO A; 
#chains in the Genus database with same CATH topology
 1P9Z A;  2ENN A;  2ORV A;  1ULK A;  1XA6 A;  3OXF A;  1OMT A;  1TUS A;  1CT4 I;  5DAE A;  2SGE I;  1TBQ R;  2V1C A;  3QTL D;  3QWP A;  1X74 A;  1XX6 A;  1OVO A;  2PQ8 A;  2WVJ A;  3FSY A;  4AML A;  2SGD I;  3SGQ I;  4E1R A;  1MJB A;  1H0Z A;  1XBT A;  2GVI A;  1SGD I;  1FYB A;  5JHW C;  1Z7K B;  1MT1 A;  1UUC A;  2XRC A;  4GI3 C;  2QQ0 A;  3D00 A;  1K7V A;  3UEJ A;  1UVG A;  1V1H A;  2L7X A;  3UGL A;  1SGY I;  2E5R A;  1KMA A;  2GIV A;  1SGR I;  2ROW A;  2M5X A;  2SGQ I;  1OYV I;  1Z2I A;  2ORW A;  1M8C A;  2YQP A;  2FNF X;  2DB6 A;  1Y8F A;  3OL0 A;  2RC4 A;  1IY5 A;  2N1A B;  5J8F A;  1K7T A;  2LB7 A;  3B4V C;  5FUW A;  7WGA A;  2A20 A;  1HPT A;  3MEK A;  3TOA A;  4WP4 A;  2B0U C;  2W0T A;  1K7U A;  1CSO I;  2QQC A;  2X3T A;  1NUB A;  2X52 A;  4HGU A;  2SGP I;  3E2I A;  1PTQ A;  2KMO A;  3OXL A;  4UXI A;  1AN1 I;  1N13 A;  2CJS C;  2K9H A;  4L9M A;  2NU0 I;  5CCL A;  1TGS I;  3SEK C;  1OMU A;  5EX0 A;  1YTP A;  4A24 A;  2GKV A;  5E3Q A;  2V1C C;  2KMR A;  2N17 A;  1TBR R;  4UXH A;  2KMP A;  1CT2 I;  1YU6 C;  1PPF I;  2SGF I;  1DS2 I;  2V53 A;  2B8T A;  2L8E A;  4JCV E;  1IY6 A;  2NU2 I;  2QQE A;  4FKD A;  4MPI A;  4DNC A;  2ODD A;  2CWG A;  2P6A C;  2QQD A;  3TO6 A;  1PJU A;  5CCM A;  1CHO I;  2JXD A;  1BMO A;  1MJ9 A;  2CWH A;  3VE5 A;  2QPO A;  1HJA I;  1WGC A;  3HH2 C;  5HI7 A;  1PCE A;  3RU0 A;  1TOT A;  2Y0M A;  1R79 A;  3UGI A;  3BJI A;  2ERW A;  5FUV A;  3R5D A;  2OZU A;  4B6D A;  1LR9 A;  1TIH A;  3UOE A;  2GKT I;  3KY9 A;  1PTR A;  3E59 A;  4UXJ A;  1SGE I;  1FAR A;  1M8B A;  1SGQ I;  1UVF A;  2RIJ A;  2YUU A;  1WGT A;  1SGN I;  2LUY A;  2DKV A;  3CXL A;  2BUS A;  5J8C A;  3GOX A;  2DIP A;  1KBF A;  1SGP I;  1HDL A;  1ULM A;  2UZ3 A;  1U5K A;  3R5B A;  2NU4 I;  1NXU A;  3R5A A;  3TO9 A;  2GKR I;  1Y1B A;  3PDN A;  2NU3 I;  1VDD A;  3TO7 A;  2KMQ A;  3OXG A;  2OD1 A;  3QAH A;  2LEO A;  5EX3 A;  2ARP F;  1KBE A;  1TUR A;  3OVO A;  1Y1C A;  1MJA A;  2E73 A;  1W3S A;  1BUS A;  1W4R A;  1WTJ A;  2KCX A;  1WKX A;  1IW4 A;  4E1P A;  2J87 A;  3UEY A;  3R5C A;  2VRW B;  3VDP A;  1CT0 I;  3UGD A;  1V1I A;  2F3C I;  5E3R A;  2WGC A;  4OVO A;  1R0R I;  1ULN A;  2ELI A;  5FUX A;  1HEV A;  2JYY A;  1FY7 A;  4SGB I;  3TJQ A;  2JZM A;  2UVO A;  1Q9B A;  1CGJ I;  3FSX A;  1X4S A;  2N71 A;  1LR8 A;  2NU1 I;  3FC3 A;  2WCY A;  1CGI I;  3TOB A;  1LR7 A;  1RFH A;  2ENZ A;  2J9R A;  1UHA A;  3UFF A;  5HQ8 A;  2JA1 A;  1P9G A;  5FUY A;  2N52 A;  9WGA A;  2CWF A;  3SGB I;  1DS3 I;  2OVO A;  1TBN A;  1S20 A;  5E3P A;  3VDU A;  2OU2 A;  2JW6 A;  1FAQ A;  1TBO A;  1CE3 A; 
#chains in the Genus database with same CATH homology
 2ENN A;  2ORV A;  1XA6 A;  3OXF A;  1OMT A;  1TUS A;  1CT4 I;  5DAE A;  2SGE I;  1TBQ R;  2V1C A;  3QTL D;  3QWP A;  1X74 A;  1XX6 A;  1OVO A;  2WVJ A;  2SGD I;  3SGQ I;  4E1R A;  1H0Z A;  1XBT A;  2GVI A;  1SGD I;  1FYB A;  5JHW C;  1Z7K B;  1MT1 A;  1UUC A;  2XRC A;  4GI3 C;  2QQ0 A;  3D00 A;  3UGL A;  3UEJ A;  1UVG A;  1V1H A;  2L7X A;  1SGY I;  2E5R A;  1KMA A;  2SGQ I;  1SGR I;  2ROW A;  2M5X A;  1OYV I;  2ORW A;  1M8C A;  2YQP A;  2FNF X;  2DB6 A;  1Y8F A;  3OL0 A;  1IY5 A;  2N1A B;  3B4V C;  5FUW A;  2A20 A;  1HPT A;  3MEK A;  2B0U C;  2W0T A;  1CSO I;  2QQC A;  1NUB A;  4HGU A;  2SGP I;  3E2I A;  1PTQ A;  2KMO A;  3OXL A;  4UXI A;  1AN1 I;  1N13 A;  2CJS C;  2K9H A;  4L9M A;  2NU0 I;  5CCL A;  1TGS I;  3SEK C;  1OMU A;  5EX0 A;  1YTP A;  4A24 A;  2GKV A;  2V1C C;  2KMR A;  2N17 A;  1TBR R;  4UXH A;  2KMP A;  1CT2 I;  1YU6 C;  1PPF I;  2SGF I;  1DS2 I;  2V53 A;  2B8T A;  2L8E A;  4JCV E;  1IY6 A;  2NU2 I;  2QQE A;  4FKD A;  2ODD A;  2P6A C;  2QQD A;  1PJU A;  5CCM A;  1CHO I;  2JXD A;  1BMO A;  3VE5 A;  2QPO A;  1HJA I;  3HH2 C;  5HI7 A;  1PCE A;  3RU0 A;  1TOT A;  1R79 A;  3UGI A;  3BJI A;  2ERW A;  5FUV A;  4B6D A;  1LR9 A;  1TIH A;  2GKT I;  3KY9 A;  1PTR A;  3E59 A;  4UXJ A;  1SGE I;  1FAR A;  1M8B A;  1SGQ I;  1UVF A;  2YUU A;  1SGN I;  2LUY A;  3CXL A;  2BUS A;  3GOX A;  2DIP A;  1KBF A;  1SGP I;  1HDL A;  2UZ3 A;  1U5K A;  2NU4 I;  2GKR I;  1Y1B A;  3PDN A;  2NU3 I;  1VDD A;  2KMQ A;  3OXG A;  2OD1 A;  2LEO A;  5EX3 A;  2ARP F;  1KBE A;  1TUR A;  3OVO A;  1Y1C A;  2E73 A;  1W3S A;  1BUS A;  1W4R A;  2KCX A;  1IW4 A;  4E1P A;  2J87 A;  3UEY A;  2VRW B;  3VDP A;  1CT0 I;  3UGD A;  1V1I A;  2F3C I;  4OVO A;  1R0R I;  2ELI A;  5FUX A;  2JYY A;  4SGB I;  3TJQ A;  2JZM A;  1CGJ I;  1X4S A;  2N71 A;  1LR8 A;  2NU1 I;  3FC3 A;  2WCY A;  1CGI I;  1LR7 A;  1RFH A;  2ENZ A;  2J9R A;  3UFF A;  5HQ8 A;  2JA1 A;  5FUY A;  2N52 A;  3SGB I;  1DS3 I;  2OVO A;  1TBN A;  3VDU A;  1FAQ A;  2JW6 A;  1TBO A;  1CE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...