1M8BA

Solution structure of the c state of turkey ovomucoid at ph 2.5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKDACTLEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Ovomucoid
publication title Two conformational states of Turkey ovomucoid third domain at low pH: three-dimensional structures, internal dynamics, and interconversion kinetics and thermodynamics.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1m8bA00
1LR8A 1OVOA 1HJAI 1SGQI 2NU4I 1SGYI 1SGEI 1BMOA 3B4VC 1CT2I 2ARPF 1FYBA 5JHWC 1OMUA 2NU1I 1SGNI 1M8CA 1R0RI 1UUCA 1TBRR 1Y1CA 1HPTA 1CT4I 1OMTA 2LEOA 2N17A 4GI3C 2JXDA 1TBQR 2OVOA 4SGBI 3QTLD 2P6AC 3SGBI 1BUSA 4OVOA 2XRCA 1CGII 1CT0I 3SGQI 1HDLA 2KCXA 1CSOI 2GKTI 1UVGA 1TIHA 1PJUA 1Z7KB 2JYYA 1DS3I 2WCYA 2GKVA 1TGSI 3OVOA 3SEKC 2NU3I 1IW4A 2SGQI 1SGRI 2GKRI 2V53A 1CHOI 1M8BA 2SGPI 1NUBA 1TURA 2SGFI 2B0UC 1SGPI 3HH2C 5DAEA 2M5XA 1CE3A 2N71A 2JZMA 1UVFA 1Y1BA 4HGUA 1YTPA 2N52A 1MT1A 1TUSA 2KMPA 2KMRA 2BUSA 2QQDA 2F3CI 2SGDI 1LR9A 2NU0I 2KMQA 1N13A 1PCEA 1SGDI 1OYVI 2KMOA 1AN1I 1IY6A 1IY5A 1PPFI 2ERWA 1KMAA 1DS2I 1H0ZA 1YU6C 1LR7A 2QQCA 3TJQA 2SGEI 1CGJI 2NU2I
chains in the Genus database with same CATH superfamily
1LR8A 1OVOA 2CWGA 3UGIA 5CCLA 1HJAI 1SGQI 3OXGA 3TO9A 2NU4I 1SGYI 1SGEI 1BMOA 3B4VC 2B8TA 5E3PA 2RIJA 1CT2I 2Y0MA 2ARPF 5EX3A 1WKXA 1FYBA 5JHWC 3KY9A 2K9HA 4L9MA 5FUXA 5FUWA 1OMUA 2NU1I 4A24A 4B6DA 2A20A 1SGNI 1M8CA 1R0RI 1KBEA 1UUCA 2ODDA 2ELIA 1WGCA 1X74A 2ENNA 1TBRR 3QWPA 3UEYA 3QAHA 1XBTA 1Y1CA 3R5BA 1HPTA 2LUYA 2PQ8A 4UXHA 1CT4I 1XA6A 4FKDA 3VE5A 1OMTA 2LEOA 2N17A 4E1PA 7WGAA 4GI3C 2JXDA 1TBQR 2UZ3A 3BJIA 5EX0A 2OVOA 2CWFA 4SGBI 1K7UA 3QTLD 2ORWA 2P6AC 5E3RA 3SGBI 4MPIA 1BUSA 5FUYA 3FSYA 4OVOA 2XRCA 1CGII 1CT0I 3SGQI 1V1HA 1HDLA 2KCXA 2WGCA 5HQ8A 2CWHA 1CSOI 3TO7A 3TOBA 2GKTI 3GOXA 1UVGA 2V1CC 3UGLA 1TIHA 1PJUA 1Z7KB 2JYYA 4E1RA 1DS3I 3UFFA 2GIVA 2X3TA 1XX6A 2WCYA 1HEVA 2GKVA 2QQ0A 1TGSI 2DB6A 5FUVA 3OVOA 3SEKC 3CXLA 1ULKA 4AMLA 2NU3I 5CCMA 1IW4A 1ULMA 2E73A 2V1CA 1VDDA 1NXUA 2LB7A 1SGRI 2SGQI 2GKRI 2V53A 3UEJA 2ORVA 2N1AB 1CHOI 4UXIA 2YUUA 1M8BA 3R5CA 3D00A 2SGPI 1NUBA 2OD1A 2VRWB 1TURA 2SGFI 1WGTA 1UHAA 1SGPI 2B0UC 2DIPA 3FSXA 3HH2C 1PTQA 1PTRA 1W3SA 3E59A 5DAEA 2JW6A 1R79A 2M5XA 1K7VA 1FARA 3E2IA 3VDPA 1CE3A 2N71A 9WGAA 2JZMA 2X52A 1TBOA 2L8EA 3OL0A 3UGDA 1Z2IA 1FY7A 1UVFA 1Y1BA 3R5AA 1Y8FA 4HGUA 1S20A 1YTPA 4UXJA 5E3QA 2N52A 2L7XA 1ULNA 2QPOA 2UVOA 1MJ9A 1RFHA 1Q9BA 3TOAA 1MT1A 2J87A 4WP4A 1TOTA 1K7TA 3RU0A 3FC3A 5J8FA 1TUSA 2KMPA 2KMRA 2BUSA 2QQDA 4JCVE 2F3CI 2SGDI 1MJAA 2YQPA 1P9ZA 1V1IA 2GVIA 1WTJA 3PDNA 2JA1A 1LR9A 2NU0I 3TO6A 2ENZA 2KMQA 2J9RA 3VDUA 2OU2A 1X4SA 3UOEA 1P9GA 1N13A 5HI7A 1PCEA 2DKVA 2RC4A 2QQEA 3R5DA 2E5RA 1SGDI 1U5KA 3MEKA 1FAQA 2OZUA 2W0TA 1OYVI 1TBNA 2FNFX 2KMOA 1KBFA 2ROWA 1AN1I 3OXFA 3OXLA 4DNCA 1MJBA 5J8CA 1IY5A 1IY6A 2WVJA 1PPFI 2ERWA 1KMAA 1DS2I 1W4RA 1YU6C 1LR7A 2CJSC 2QQCA 2SGEI 3TJQA 1H0ZA 1CGJI 2NU2I
chains in the Genus database with same CATH topology
1LR8A 1OVOA 3UGIA 5CCLA 1HJAI 1SGQI 3OXGA 2NU4I 1SGYI 1SGEI 1BMOA 3B4VC 2B8TA 1CT2I 2ARPF 5EX3A 1FYBA 5JHWC 3KY9A 2K9HA 4L9MA 5FUXA 5FUWA 1OMUA 2NU1I 4A24A 4B6DA 2A20A 1SGNI 1M8CA 1R0RI 1KBEA 1UUCA 2ODDA 2ELIA 1X74A 3QWPA 2ENNA 1TBRR 3UEYA 1XBTA 1Y1CA 1HPTA 2LUYA 4UXHA 1KBFA 1CT4I 1XA6A 4FKDA 3VE5A 1OMTA 2LEOA 2N17A 4E1PA 4GI3C 2JXDA 1TBQR 2UZ3A 3BJIA 5EX0A 2OVOA 4SGBI 3QTLD 2ORWA 2P6AC 3SGBI 1BUSA 5FUYA 4OVOA 2XRCA 1CGII 1CT0I 3SGQI 1V1HA 1HDLA 2KCXA 5HQ8A 1CSOI 2GKTI 3GOXA 1UVGA 2V1CC 3UGLA 1TIHA 1PJUA 1Z7KB 2JYYA 4E1RA 1DS3I 3UFFA 1XX6A 2WCYA 2GKVA 2QQ0A 1TGSI 2DB6A 5FUVA 3OVOA 3SEKC 3CXLA 2NU3I 5CCMA 1IW4A 2E73A 2V1CA 1VDDA 2SGQI 1SGRI 3UEJA 2GKRI 2V53A 2ORVA 2N1AB 1CHOI 4UXIA 2YUUA 1M8BA 3D00A 2SGPI 1NUBA 2OD1A 2VRWB 1TURA 2SGFI 2B0UC 1SGPI 2DIPA 3HH2C 1PTQA 1PTRA 1W3SA 3E59A 5DAEA 2JW6A 1R79A 2M5XA 1FARA 3E2IA 3VDPA 1CE3A 2N71A 2JZMA 1TBOA 2L8EA 3OL0A 3UGDA 1UVFA 1Y1BA 1Y8FA 4HGUA 1YTPA 4UXJA 2N52A 2L7XA 2QPOA 1RFHA 1MT1A 2J87A 1TOTA 3FC3A 3RU0A 1TUSA 2KMPA 2KMRA 2BUSA 2QQDA 4JCVE 2F3CI 2SGDI 2YQPA 2GVIA 1V1IA 3PDNA 2JA1A 1LR9A 2NU0I 2ENZA 2KMQA 2J9RA 3VDUA 1X4SA 1N13A 5HI7A 1PCEA 2QQEA 2E5RA 1SGDI 1U5KA 3MEKA 1FAQA 2W0TA 1OYVI 1TBNA 2FNFX 2KMOA 2ROWA 1AN1I 3OXFA 3OXLA 1IY6A 1IY5A 2WVJA 1PPFI 2ERWA 1KMAA 1DS2I 1W4RA 1YU6C 1LR7A 2CJSC 2QQCA 2SGEI 3TJQA 1H0ZA 1CGJI 2NU2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LR8 A;  1OVO A;  1HJA I;  1SGQ I;  2NU4 I;  1SGY I;  1SGE I;  1BMO A;  3B4V C;  1CT2 I;  2ARP F;  1FYB A;  5JHW C;  1OMU A;  2NU1 I;  1SGN I;  1M8C A;  1R0R I;  1UUC A;  1TBR R;  1Y1C A;  1HPT A;  1CT4 I;  1OMT A;  2LEO A;  2N17 A;  4GI3 C;  2JXD A;  1TBQ R;  2OVO A;  4SGB I;  3QTL D;  2P6A C;  3SGB I;  1BUS A;  4OVO A;  2XRC A;  1CGI I;  1CT0 I;  3SGQ I;  1HDL A;  2KCX A;  1CSO I;  2GKT I;  1UVG A;  1TIH A;  1PJU A;  1Z7K B;  2JYY A;  1DS3 I;  2WCY A;  2GKV A;  1TGS I;  3OVO A;  3SEK C;  2NU3 I;  1IW4 A;  2SGQ I;  1SGR I;  2GKR I;  2V53 A;  1CHO I;  1M8B A;  2SGP I;  1NUB A;  1TUR A;  2SGF I;  2B0U C;  1SGP I;  3HH2 C;  5DAE A;  2M5X A;  1CE3 A;  2N71 A;  2JZM A;  1UVF A;  1Y1B A;  4HGU A;  1YTP A;  2N52 A;  1MT1 A;  1TUS A;  2KMP A;  2KMR A;  2BUS A;  2QQD A;  2F3C I;  2SGD I;  1LR9 A;  2NU0 I;  2KMQ A;  1N13 A;  1PCE A;  1SGD I;  1OYV I;  2KMO A;  1AN1 I;  1IY6 A;  1IY5 A;  1PPF I;  2ERW A;  1KMA A;  1DS2 I;  1H0Z A;  1YU6 C;  1LR7 A;  2QQC A;  3TJQ A;  2SGE I;  1CGJ I;  2NU2 I; 
#chains in the Genus database with same CATH topology
 1LR8 A;  1OVO A;  2CWG A;  3UGI A;  5CCL A;  1HJA I;  1SGQ I;  3OXG A;  3TO9 A;  2NU4 I;  1SGY I;  1SGE I;  1BMO A;  3B4V C;  2B8T A;  5E3P A;  2RIJ A;  1CT2 I;  2Y0M A;  2ARP F;  5EX3 A;  1WKX A;  1FYB A;  5JHW C;  3KY9 A;  2K9H A;  4L9M A;  5FUX A;  5FUW A;  1OMU A;  2NU1 I;  4A24 A;  4B6D A;  2A20 A;  1SGN I;  1M8C A;  1R0R I;  1KBE A;  1UUC A;  2ODD A;  2ELI A;  1WGC A;  1X74 A;  2ENN A;  1TBR R;  3QWP A;  3UEY A;  3QAH A;  1XBT A;  1Y1C A;  3R5B A;  1HPT A;  2LUY A;  2PQ8 A;  4UXH A;  1CT4 I;  1XA6 A;  4FKD A;  3VE5 A;  1OMT A;  2LEO A;  2N17 A;  4E1P A;  7WGA A;  4GI3 C;  2JXD A;  1TBQ R;  2UZ3 A;  3BJI A;  5EX0 A;  2OVO A;  2CWF A;  4SGB I;  1K7U A;  3QTL D;  2ORW A;  2P6A C;  5E3R A;  3SGB I;  4MPI A;  1BUS A;  5FUY A;  3FSY A;  4OVO A;  2XRC A;  1CGI I;  1CT0 I;  3SGQ I;  1V1H A;  1HDL A;  2KCX A;  2WGC A;  5HQ8 A;  2CWH A;  1CSO I;  3TO7 A;  3TOB A;  2GKT I;  3GOX A;  1UVG A;  2V1C C;  3UGL A;  1TIH A;  1PJU A;  1Z7K B;  2JYY A;  4E1R A;  1DS3 I;  3UFF A;  2GIV A;  2X3T A;  1XX6 A;  2WCY A;  1HEV A;  2GKV A;  2QQ0 A;  1TGS I;  2DB6 A;  5FUV A;  3OVO A;  3SEK C;  3CXL A;  1ULK A;  4AML A;  2NU3 I;  5CCM A;  1IW4 A;  1ULM A;  2E73 A;  2V1C A;  1VDD A;  1NXU A;  2LB7 A;  1SGR I;  2SGQ I;  2GKR I;  2V53 A;  3UEJ A;  2ORV A;  2N1A B;  1CHO I;  4UXI A;  2YUU A;  1M8B A;  3R5C A;  3D00 A;  2SGP I;  1NUB A;  2OD1 A;  2VRW B;  1TUR A;  2SGF I;  1WGT A;  1UHA A;  1SGP I;  2B0U C;  2DIP A;  3FSX A;  3HH2 C;  1PTQ A;  1PTR A;  1W3S A;  3E59 A;  5DAE A;  2JW6 A;  1R79 A;  2M5X A;  1K7V A;  1FAR A;  3E2I A;  3VDP A;  1CE3 A;  2N71 A;  9WGA A;  2JZM A;  2X52 A;  1TBO A;  2L8E A;  3OL0 A;  3UGD A;  1Z2I A;  1FY7 A;  1UVF A;  1Y1B A;  3R5A A;  1Y8F A;  4HGU A;  1S20 A;  1YTP A;  4UXJ A;  5E3Q A;  2N52 A;  2L7X A;  1ULN A;  2QPO A;  2UVO A;  1MJ9 A;  1RFH A;  1Q9B A;  3TOA A;  1MT1 A;  2J87 A;  4WP4 A;  1TOT A;  1K7T A;  3RU0 A;  3FC3 A;  5J8F A;  1TUS A;  2KMP A;  2KMR A;  2BUS A;  2QQD A;  4JCV E;  2F3C I;  2SGD I;  1MJA A;  2YQP A;  1P9Z A;  1V1I A;  2GVI A;  1WTJ A;  3PDN A;  2JA1 A;  1LR9 A;  2NU0 I;  3TO6 A;  2ENZ A;  2KMQ A;  2J9R A;  3VDU A;  2OU2 A;  1X4S A;  3UOE A;  1P9G A;  1N13 A;  5HI7 A;  1PCE A;  2DKV A;  2RC4 A;  2QQE A;  3R5D A;  2E5R A;  1SGD I;  1U5K A;  3MEK A;  1FAQ A;  2OZU A;  2W0T A;  1OYV I;  1TBN A;  2FNF X;  2KMO A;  1KBF A;  2ROW A;  1AN1 I;  3OXF A;  3OXL A;  4DNC A;  1MJB A;  5J8C A;  1IY5 A;  1IY6 A;  2WVJ A;  1PPF I;  2ERW A;  1KMA A;  1DS2 I;  1W4R A;  1YU6 C;  1LR7 A;  2CJS C;  2QQC A;  2SGE I;  3TJQ A;  1H0Z A;  1CGJ I;  2NU2 I; 
#chains in the Genus database with same CATH homology
 1LR8 A;  1OVO A;  3UGI A;  5CCL A;  1HJA I;  1SGQ I;  3OXG A;  2NU4 I;  1SGY I;  1SGE I;  1BMO A;  3B4V C;  2B8T A;  1CT2 I;  2ARP F;  5EX3 A;  1FYB A;  5JHW C;  3KY9 A;  2K9H A;  4L9M A;  5FUX A;  5FUW A;  1OMU A;  2NU1 I;  4A24 A;  4B6D A;  2A20 A;  1SGN I;  1M8C A;  1R0R I;  1KBE A;  1UUC A;  2ODD A;  2ELI A;  1X74 A;  3QWP A;  2ENN A;  1TBR R;  3UEY A;  1XBT A;  1Y1C A;  1HPT A;  2LUY A;  4UXH A;  1KBF A;  1CT4 I;  1XA6 A;  4FKD A;  3VE5 A;  1OMT A;  2LEO A;  2N17 A;  4E1P A;  4GI3 C;  2JXD A;  1TBQ R;  2UZ3 A;  3BJI A;  5EX0 A;  2OVO A;  4SGB I;  3QTL D;  2ORW A;  2P6A C;  3SGB I;  1BUS A;  5FUY A;  4OVO A;  2XRC A;  1CGI I;  1CT0 I;  3SGQ I;  1V1H A;  1HDL A;  2KCX A;  5HQ8 A;  1CSO I;  2GKT I;  3GOX A;  1UVG A;  2V1C C;  3UGL A;  1TIH A;  1PJU A;  1Z7K B;  2JYY A;  4E1R A;  1DS3 I;  3UFF A;  1XX6 A;  2WCY A;  2GKV A;  2QQ0 A;  1TGS I;  2DB6 A;  5FUV A;  3OVO A;  3SEK C;  3CXL A;  2NU3 I;  5CCM A;  1IW4 A;  2E73 A;  2V1C A;  1VDD A;  2SGQ I;  1SGR I;  3UEJ A;  2GKR I;  2V53 A;  2ORV A;  2N1A B;  1CHO I;  4UXI A;  2YUU A;  1M8B A;  3D00 A;  2SGP I;  1NUB A;  2OD1 A;  2VRW B;  1TUR A;  2SGF I;  2B0U C;  1SGP I;  2DIP A;  3HH2 C;  1PTQ A;  1PTR A;  1W3S A;  3E59 A;  5DAE A;  2JW6 A;  1R79 A;  2M5X A;  1FAR A;  3E2I A;  3VDP A;  1CE3 A;  2N71 A;  2JZM A;  1TBO A;  2L8E A;  3OL0 A;  3UGD A;  1UVF A;  1Y1B A;  1Y8F A;  4HGU A;  1YTP A;  4UXJ A;  2N52 A;  2L7X A;  2QPO A;  1RFH A;  1MT1 A;  2J87 A;  1TOT A;  3FC3 A;  3RU0 A;  1TUS A;  2KMP A;  2KMR A;  2BUS A;  2QQD A;  4JCV E;  2F3C I;  2SGD I;  2YQP A;  2GVI A;  1V1I A;  3PDN A;  2JA1 A;  1LR9 A;  2NU0 I;  2ENZ A;  2KMQ A;  2J9R A;  3VDU A;  1X4S A;  1N13 A;  5HI7 A;  1PCE A;  2QQE A;  2E5R A;  1SGD I;  1U5K A;  3MEK A;  1FAQ A;  2W0T A;  1OYV I;  1TBN A;  2FNF X;  2KMO A;  2ROW A;  1AN1 I;  3OXF A;  3OXL A;  1IY6 A;  1IY5 A;  2WVJ A;  1PPF I;  2ERW A;  1KMA A;  1DS2 I;  1W4R A;  1YU6 C;  1LR7 A;  2CJS C;  2QQC A;  2SGE I;  3TJQ A;  1H0Z A;  1CGJ I;  2NU2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...