1M8BA

Solution structure of the c state of turkey ovomucoid at ph 2.5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKDACTLEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ovomucoid
publication title Two conformational states of Turkey ovomucoid third domain at low pH: three-dimensional structures, internal dynamics, and interconversion kinetics and thermodynamics.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1m8bA00
1TUSA 2SGDI 5DAEA 2KMOA 2GKRI 1IY5A 1LR9A 1SGRI 1YTPA 2ERWA 2B0UC 2XRCA 1TBQR 1OMTA 1IY6A 2NU4I 2N71A 1Y1CA 2N17A 1SGQI 1DS2I 3B4VC 2KMPA 1H0ZA 2GKTI 2NU0I 1UUCA 4HGUA 3SGQI 1SGEI 2NU2I 2SGEI 2GKVA 1OMUA 3OVOA 1N13A 1UVFA 2KMRA 2WCYA 1SGYI 2N52A 2V53A 1DS3I 1PJUA 2BUSA 1CT2I 3QTLD 1CGII 3SGBI 1NUBA 1M8CA 1Y1BA 1HJAI 1CGJI 1CT4I 2NU1I 2M5XA 2QQDA 1M8BA 5JHWC 1IW4A 1KMAA 4OVOA 1PPFI 1SGPI 2LEOA 1OYVI 2ARPF 1AN1I 2F3CI 1CHOI 1TIHA 1CE3A 1HPTA 2P6AC 1Z7KB 2SGQI 1OVOA 2JZMA 1CT0I 1TBRR 1BUSA 1SGDI 2JXDA 4GI3C 2KCXA 1PCEA 1CSOI 1R0RI 1HDLA 3HH2C 2NU3I 1FYBA 2OVOA 1YU6C 1BMOA 2SGFI 2JYYA 1TGSI 2KMQA 1SGNI 1LR8A 1TURA 1UVGA 4SGBI 1MT1A 3SEKC 2QQCA 1LR7A 2SGPI 3TJQA
chains in the Genus database with same CATH superfamily
1P9ZA 1TUSA 2SGDI 2YQPA 2LB7A 4JCVE 4MPIA 5DAEA 2J9RA 2ODDA 2ORVA 2KMOA 5E3QA 2GKRI 1IY5A 1LR9A 2DKVA 3UGLA 2ENZA 4E1PA 1SGRI 1YTPA 2ROWA 5E3PA 2ERWA 1RFHA 2X3TA 2B0UC 2XRCA 1TBQR 1KBEA 2LUYA 3D00A 1OMTA 1U5KA 3E2IA 3MEKA 3UFFA 5CCLA 1IY6A 2NU4I 3FSXA 3TOAA 2N71A 1Y1CA 2N17A 2YUUA 3GOXA 1SGQI 1DS2I 3B4VC 2KMPA 5HI7A 2DIPA 1WTJA 2ELIA 3PDNA 2FNFX 1H0ZA 5FUYA 2VRWB 1Y8FA 1ULMA 2L7XA 5FUVA 2GKTI 2NU0I 3UOEA 5HQ8A 1UUCA 1WGTA 3BJIA 4HGUA 2DB6A 2OZUA 1SGEI 2UVOA 3SGQI 1XX6A 2NU2I 2SGEI 1R79A 7WGAA 1ULKA 2GKVA 1OMUA 3RU0A 1K7TA 3OVOA 1N13A 4B6DA 1MJ9A 1UHAA 4UXJA 2CWFA 1KBFA 5EX3A 1PTRA 1UVFA 1TBOA 3UGDA 2KMRA 2WCYA 1SGYI 2N52A 3OXGA 2QQ0A 2V53A 1DS3I 1PJUA 1ULNA 1XA6A 2BUSA 3KY9A 2N1AB 3VDPA 2GVIA 1K7VA 1CT2I 2UZ3A 3R5AA 1PTQA 3QTLD 1CGII 5J8FA 3SGBI 1NUBA 1M8CA 1Y1BA 1HJAI 2CWGA 1CGJI 2E73A 5FUWA 4DNCA 2CJSC 3R5BA 1CT4I 1TBNA 2NU1I 2ENNA 2L8EA 2GIVA 2M5XA 2JA1A 3TO6A 3VE5A 2QQDA 2PQ8A 4WP4A 1M8BA 3TO9A 5JHWC 2CWHA 1V1IA 1IW4A 3OXLA 4UXHA 1HEVA 1KMAA 1XBTA 1WKXA 2ORWA 1PPFI 1Z2IA 1SGPI 4OVOA 2LEOA 1OYVI 3FC3A 2ARPF 1AN1I 2F3CI 4L9MA 1CHOI 1FARA 1FAQA 3OL0A 9WGAA 1TIHA 5E3RA 1HPTA 2P6AC 1Z7KB 3OXFA 3UEYA 2SGQI 1CE3A 1P9GA 5CCMA 1FY7A 1OVOA 2JZMA 1CT0I 1NXUA 1TBRR 2WGCA 1SGDI 2W0TA 5EX0A 2JXDA 2WVJA 1BUSA 3UEJA 4GI3C 3TO7A 1PCEA 2KCXA 2V1CA 2RC4A 2QQEA 3E59A 3CXLA 1CSOI 1R0RI 1VDDA 1HDLA 1W4RA 3HH2C 1WGCA 2B8TA 2NU3I 2OD1A 5FUXA 3R5CA 1FYBA 1X4SA 1W3SA 3VDUA 4AMLA 2E5RA 2OVOA 4FKDA 4A24A 3FSYA 1YU6C 1X74A 1BMOA 1TOTA 5J8CA 2SGFI 2JYYA 2V1CC 1MJAA 1TGSI 2KMQA 3UGIA 1MJBA 1SGNI 2X52A 1LR8A 2Y0MA 1S20A 1TURA 3TOBA 2J87A 1K7UA 1UVGA 2JW6A 4UXIA 4SGBI 1V1HA 3QWPA 2RIJA 3QAHA 2K9HA 4E1RA 1MT1A 2A20A 2OU2A 2QPOA 3SEKC 2QQCA 1LR7A 2SGPI 3R5DA 3TJQA 1Q9BA
chains in the Genus database with same CATH topology
1TUSA 2SGDI 2YQPA 4JCVE 5DAEA 2J9RA 2ODDA 2ORVA 2KMOA 2GKRI 1IY5A 1LR9A 3UGLA 2ENZA 4E1PA 1SGRI 1YTPA 2ROWA 2ERWA 1RFHA 2B0UC 2XRCA 1TBQR 1KBEA 2LUYA 3D00A 1OMTA 1U5KA 3E2IA 3MEKA 3UFFA 5CCLA 1IY6A 2NU4I 2N71A 1Y1CA 2N17A 2YUUA 3GOXA 1SGQI 1DS2I 3B4VC 2KMPA 5HI7A 2DIPA 2ELIA 3PDNA 2FNFX 1H0ZA 5FUYA 2VRWB 1Y8FA 5FUVA 2L7XA 2GKTI 2NU0I 5HQ8A 1UUCA 3BJIA 4HGUA 2DB6A 3SGQI 1SGEI 1XX6A 2NU2I 2SGEI 1R79A 2GKVA 1OMUA 3RU0A 3OVOA 4B6DA 1N13A 4UXJA 1KBFA 5EX3A 1PTRA 1UVFA 1TBOA 3UGDA 2KMRA 2WCYA 1SGYI 2N52A 3OXGA 2QQ0A 2V53A 1DS3I 1PJUA 2BUSA 1XA6A 3KY9A 2N1AB 3VDPA 2GVIA 1CT2I 2UZ3A 1PTQA 3QTLD 1CGII 3SGBI 1NUBA 1M8CA 1Y1BA 1HJAI 5FUWA 1CGJI 2E73A 2CJSC 1CT4I 1TBNA 2NU1I 2ENNA 2L8EA 2M5XA 2JA1A 3VE5A 2QQDA 1M8BA 5JHWC 1V1IA 1IW4A 3OXLA 4UXHA 1KMAA 1XBTA 4OVOA 2ORWA 1PPFI 1SGPI 2LEOA 1OYVI 3FC3A 2ARPF 1AN1I 2F3CI 4L9MA 1CHOI 1FARA 1FAQA 3OL0A 1TIHA 1CE3A 1HPTA 2P6AC 1Z7KB 3OXFA 3UEYA 2SGQI 5CCMA 1OVOA 2JZMA 1CT0I 1TBRR 5EX0A 1BUSA 1SGDI 2W0TA 2JXDA 2WVJA 3UEJA 4GI3C 1PCEA 2KCXA 2V1CA 2QQEA 3E59A 3CXLA 1CSOI 1R0RI 1VDDA 1HDLA 1W4RA 3HH2C 2B8TA 2OD1A 2NU3I 5FUXA 1FYBA 1X4SA 1W3SA 3VDUA 2E5RA 2OVOA 4FKDA 4A24A 1YU6C 1X74A 1BMOA 1TOTA 2SGFI 2JYYA 2V1CC 1TGSI 2KMQA 3UGIA 1SGNI 1LR8A 1TURA 2J87A 1UVGA 2JW6A 4UXIA 4SGBI 1V1HA 3QWPA 2K9HA 4E1RA 1MT1A 2A20A 3SEKC 2QPOA 2QQCA 1LR7A 2SGPI 3TJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUS A;  2SGD I;  5DAE A;  2KMO A;  2GKR I;  1IY5 A;  1LR9 A;  1SGR I;  1YTP A;  2ERW A;  2B0U C;  2XRC A;  1TBQ R;  1OMT A;  1IY6 A;  2NU4 I;  2N71 A;  1Y1C A;  2N17 A;  1SGQ I;  1DS2 I;  3B4V C;  2KMP A;  1H0Z A;  2GKT I;  2NU0 I;  1UUC A;  4HGU A;  3SGQ I;  1SGE I;  2NU2 I;  2SGE I;  2GKV A;  1OMU A;  3OVO A;  1N13 A;  1UVF A;  2KMR A;  2WCY A;  1SGY I;  2N52 A;  2V53 A;  1DS3 I;  1PJU A;  2BUS A;  1CT2 I;  3QTL D;  1CGI I;  3SGB I;  1NUB A;  1M8C A;  1Y1B A;  1HJA I;  1CGJ I;  1CT4 I;  2NU1 I;  2M5X A;  2QQD A;  1M8B A;  5JHW C;  1IW4 A;  1KMA A;  4OVO A;  1PPF I;  1SGP I;  2LEO A;  1OYV I;  2ARP F;  1AN1 I;  2F3C I;  1CHO I;  1TIH A;  1CE3 A;  1HPT A;  2P6A C;  1Z7K B;  2SGQ I;  1OVO A;  2JZM A;  1CT0 I;  1TBR R;  1BUS A;  1SGD I;  2JXD A;  4GI3 C;  2KCX A;  1PCE A;  1CSO I;  1R0R I;  1HDL A;  3HH2 C;  2NU3 I;  1FYB A;  2OVO A;  1YU6 C;  1BMO A;  2SGF I;  2JYY A;  1TGS I;  2KMQ A;  1SGN I;  1LR8 A;  1TUR A;  1UVG A;  4SGB I;  1MT1 A;  3SEK C;  2QQC A;  1LR7 A;  2SGP I;  3TJQ A; 
#chains in the Genus database with same CATH topology
 1P9Z A;  1TUS A;  2SGD I;  2YQP A;  2LB7 A;  4JCV E;  4MPI A;  5DAE A;  2J9R A;  2ODD A;  2ORV A;  2KMO A;  5E3Q A;  2GKR I;  1IY5 A;  1LR9 A;  2DKV A;  3UGL A;  2ENZ A;  4E1P A;  1SGR I;  1YTP A;  2ROW A;  5E3P A;  2ERW A;  1RFH A;  2X3T A;  2B0U C;  2XRC A;  1TBQ R;  1KBE A;  2LUY A;  3D00 A;  1OMT A;  1U5K A;  3E2I A;  3MEK A;  3UFF A;  5CCL A;  1IY6 A;  2NU4 I;  3FSX A;  3TOA A;  2N71 A;  1Y1C A;  2N17 A;  2YUU A;  3GOX A;  1SGQ I;  1DS2 I;  3B4V C;  2KMP A;  5HI7 A;  2DIP A;  1WTJ A;  2ELI A;  3PDN A;  2FNF X;  1H0Z A;  5FUY A;  2VRW B;  1Y8F A;  1ULM A;  2L7X A;  5FUV A;  2GKT I;  2NU0 I;  3UOE A;  5HQ8 A;  1UUC A;  1WGT A;  3BJI A;  4HGU A;  2DB6 A;  2OZU A;  1SGE I;  2UVO A;  3SGQ I;  1XX6 A;  2NU2 I;  2SGE I;  1R79 A;  7WGA A;  1ULK A;  2GKV A;  1OMU A;  3RU0 A;  1K7T A;  3OVO A;  1N13 A;  4B6D A;  1MJ9 A;  1UHA A;  4UXJ A;  2CWF A;  1KBF A;  5EX3 A;  1PTR A;  1UVF A;  1TBO A;  3UGD A;  2KMR A;  2WCY A;  1SGY I;  2N52 A;  3OXG A;  2QQ0 A;  2V53 A;  1DS3 I;  1PJU A;  1ULN A;  1XA6 A;  2BUS A;  3KY9 A;  2N1A B;  3VDP A;  2GVI A;  1K7V A;  1CT2 I;  2UZ3 A;  3R5A A;  1PTQ A;  3QTL D;  1CGI I;  5J8F A;  3SGB I;  1NUB A;  1M8C A;  1Y1B A;  1HJA I;  2CWG A;  1CGJ I;  2E73 A;  5FUW A;  4DNC A;  2CJS C;  3R5B A;  1CT4 I;  1TBN A;  2NU1 I;  2ENN A;  2L8E A;  2GIV A;  2M5X A;  2JA1 A;  3TO6 A;  3VE5 A;  2QQD A;  2PQ8 A;  4WP4 A;  1M8B A;  3TO9 A;  5JHW C;  2CWH A;  1V1I A;  1IW4 A;  3OXL A;  4UXH A;  1HEV A;  1KMA A;  1XBT A;  1WKX A;  2ORW A;  1PPF I;  1Z2I A;  1SGP I;  4OVO A;  2LEO A;  1OYV I;  3FC3 A;  2ARP F;  1AN1 I;  2F3C I;  4L9M A;  1CHO I;  1FAR A;  1FAQ A;  3OL0 A;  9WGA A;  1TIH A;  5E3R A;  1HPT A;  2P6A C;  1Z7K B;  3OXF A;  3UEY A;  2SGQ I;  1CE3 A;  1P9G A;  5CCM A;  1FY7 A;  1OVO A;  2JZM A;  1CT0 I;  1NXU A;  1TBR R;  2WGC A;  1SGD I;  2W0T A;  5EX0 A;  2JXD A;  2WVJ A;  1BUS A;  3UEJ A;  4GI3 C;  3TO7 A;  1PCE A;  2KCX A;  2V1C A;  2RC4 A;  2QQE A;  3E59 A;  3CXL A;  1CSO I;  1R0R I;  1VDD A;  1HDL A;  1W4R A;  3HH2 C;  1WGC A;  2B8T A;  2NU3 I;  2OD1 A;  5FUX A;  3R5C A;  1FYB A;  1X4S A;  1W3S A;  3VDU A;  4AML A;  2E5R A;  2OVO A;  4FKD A;  4A24 A;  3FSY A;  1YU6 C;  1X74 A;  1BMO A;  1TOT A;  5J8C A;  2SGF I;  2JYY A;  2V1C C;  1MJA A;  1TGS I;  2KMQ A;  3UGI A;  1MJB A;  1SGN I;  2X52 A;  1LR8 A;  2Y0M A;  1S20 A;  1TUR A;  3TOB A;  2J87 A;  1K7U A;  1UVG A;  2JW6 A;  4UXI A;  4SGB I;  1V1H A;  3QWP A;  2RIJ A;  3QAH A;  2K9H A;  4E1R A;  1MT1 A;  2A20 A;  2OU2 A;  2QPO A;  3SEK C;  2QQC A;  1LR7 A;  2SGP I;  3R5D A;  3TJQ A;  1Q9B A; 
#chains in the Genus database with same CATH homology
 1TUS A;  2SGD I;  2YQP A;  4JCV E;  5DAE A;  2J9R A;  2ODD A;  2ORV A;  2KMO A;  2GKR I;  1IY5 A;  1LR9 A;  3UGL A;  2ENZ A;  4E1P A;  1SGR I;  1YTP A;  2ROW A;  2ERW A;  1RFH A;  2B0U C;  2XRC A;  1TBQ R;  1KBE A;  2LUY A;  3D00 A;  1OMT A;  1U5K A;  3E2I A;  3MEK A;  3UFF A;  5CCL A;  1IY6 A;  2NU4 I;  2N71 A;  1Y1C A;  2N17 A;  2YUU A;  3GOX A;  1SGQ I;  1DS2 I;  3B4V C;  2KMP A;  5HI7 A;  2DIP A;  2ELI A;  3PDN A;  2FNF X;  1H0Z A;  5FUY A;  2VRW B;  1Y8F A;  5FUV A;  2L7X A;  2GKT I;  2NU0 I;  5HQ8 A;  1UUC A;  3BJI A;  4HGU A;  2DB6 A;  3SGQ I;  1SGE I;  1XX6 A;  2NU2 I;  2SGE I;  1R79 A;  2GKV A;  1OMU A;  3RU0 A;  3OVO A;  4B6D A;  1N13 A;  4UXJ A;  1KBF A;  5EX3 A;  1PTR A;  1UVF A;  1TBO A;  3UGD A;  2KMR A;  2WCY A;  1SGY I;  2N52 A;  3OXG A;  2QQ0 A;  2V53 A;  1DS3 I;  1PJU A;  2BUS A;  1XA6 A;  3KY9 A;  2N1A B;  3VDP A;  2GVI A;  1CT2 I;  2UZ3 A;  1PTQ A;  3QTL D;  1CGI I;  3SGB I;  1NUB A;  1M8C A;  1Y1B A;  1HJA I;  5FUW A;  1CGJ I;  2E73 A;  2CJS C;  1CT4 I;  1TBN A;  2NU1 I;  2ENN A;  2L8E A;  2M5X A;  2JA1 A;  3VE5 A;  2QQD A;  1M8B A;  5JHW C;  1V1I A;  1IW4 A;  3OXL A;  4UXH A;  1KMA A;  1XBT A;  4OVO A;  2ORW A;  1PPF I;  1SGP I;  2LEO A;  1OYV I;  3FC3 A;  2ARP F;  1AN1 I;  2F3C I;  4L9M A;  1CHO I;  1FAR A;  1FAQ A;  3OL0 A;  1TIH A;  1CE3 A;  1HPT A;  2P6A C;  1Z7K B;  3OXF A;  3UEY A;  2SGQ I;  5CCM A;  1OVO A;  2JZM A;  1CT0 I;  1TBR R;  5EX0 A;  1BUS A;  1SGD I;  2W0T A;  2JXD A;  2WVJ A;  3UEJ A;  4GI3 C;  1PCE A;  2KCX A;  2V1C A;  2QQE A;  3E59 A;  3CXL A;  1CSO I;  1R0R I;  1VDD A;  1HDL A;  1W4R A;  3HH2 C;  2B8T A;  2OD1 A;  2NU3 I;  5FUX A;  1FYB A;  1X4S A;  1W3S A;  3VDU A;  2E5R A;  2OVO A;  4FKD A;  4A24 A;  1YU6 C;  1X74 A;  1BMO A;  1TOT A;  2SGF I;  2JYY A;  2V1C C;  1TGS I;  2KMQ A;  3UGI A;  1SGN I;  1LR8 A;  1TUR A;  2J87 A;  1UVG A;  2JW6 A;  4UXI A;  4SGB I;  1V1H A;  3QWP A;  2K9H A;  4E1R A;  1MT1 A;  2A20 A;  3SEK C;  2QPO A;  2QQC A;  1LR7 A;  2SGP I;  3TJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...