2LB7A

Hevein-type antifungal peptide with a unique 10-cysteine motif
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antimicrobial peptide 1a
publication title Solution structure of a defense peptide from wheat with a 10-cysteine motif.
pubmed doi rcsb
source organism Triticum kiharae
molecule tags Antimicrobial protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2lb7A00
2DKVA 1K7TA 2CWGA 1WKXA 2WGCA 1ULNA 1Q9BA 1P9GA 1HEVA 4AMLA 1ULKA 1P9ZA 4MPIA 2LB7A 7WGAA 1K7VA 1WGTA 2X52A 2UVOA 4WP4A 2X3TA 1UHAA 1K7UA 1WGCA 1ULMA 9WGAA
chains in the Genus database with same CATH superfamily
1S20A 1PCEA 3D00A 2JXDA 3TO6A 3E59A 2JW6A 1CGII 1K7TA 1TIHA 1MT1A 1U5KA 1WKXA 3UEYA 4DNCA 3B4VC 1CSOI 1CT0I 3SGBI 1ULNA 2B8TA 1Q9BA 2KMPA 3QAHA 2RC4A 2NU3I 4UXIA 2KMQA 1CT2I 3BJIA 2JZMA 5FUXA 1FYBA 3HH2C 1FARA 2E5RA 1FAQA 1HJAI 1XBTA 2NU2I 1XA6A 1TBQR 5HQ8A 1K7VA 1PTRA 2A20A 1KMAA 1OMUA 3VE5A 2Y0MA 2P6AC 2N52A 1M8BA 2V1CC 1WGTA 5J8FA 2ARPF 3GOXA 2GKVA 1NUBA 1PPFI 2E73A 2J9RA 2NU0I 2ORWA 2ROWA 2UVOA 2WCYA 1V1IA 3FSYA 1K7UA 1ULMA 1CGJI 1OMTA 2GIVA 3KY9A 1XX6A 5FUVA 2M5XA 4A24A 2ERWA 4HGUA 3TO9A 1IY5A 2QQEA 2WGCA 1VDDA 5JHWC 1SGQI 2SGFI 1MJBA 1MJ9A 5EX0A 2FNFX 5HI7A 2N17A 2KCXA 1OYVI 1FY7A 1CT4I 3UGIA 5E3PA 1BUSA 1TBOA 5E3RA 1CE3A 1LR7A 2CWHA 3R5BA 2ENZA 3CXLA 4SGBI 3UOEA 2SGDI 2GKRI 1N13A 5E3QA 2DIPA 1YTPA 1LR9A 2N71A 2NU1I 2X3TA 3R5DA 1DS3I 1SGYI 2OVOA 3UFFA 4FKDA 2V1CA 2LEOA 1SGPI 2KMOA 2RIJA 1TBNA 1Y1CA 1KBEA 3PDNA 1AN1I 4WP4A 3TOBA 3UGDA 2DKVA 3R5AA 2CJSC 4B6DA 3R5CA 3QWPA 2K9HA 2CWGA 2ELIA 1NXUA 1UUCA 2KMRA 2PQ8A 2QQCA 3OVOA 3OXGA 4UXHA 1KBFA 2YUUA 2QQDA 1PJUA 1Z2IA 3UGLA 5CCMA 3VDUA 5CCLA 4E1PA 1P9GA 1X4SA 2W0TA 1HEVA 4JCVE 2JYYA 4L9MA 5DAEA 2QQ0A 1WTJA 3TOAA 1W4RA 1ULKA 2SGQI 3FC3A 1P9ZA 1X74A 2L7XA 4MPIA 1MJAA 2GKTI 1SGEI 2SGPI 2V53A 2UZ3A 3SEKC 3RU0A 2QPOA 1H0ZA 1BMOA 3QTLD 2YQPA 1UVGA 2BUSA 2OU2A 1HDLA 1Y8FA 2OZUA 3OL0A 2WVJA 2B0UC 3FSXA 1UHAA 1CHOI 2SGEI 1UVFA 3OXFA 9WGAA 2F3CI 1R0RI 5FUWA 5FUYA 2NU4I 2VRWB 1SGNI 2N1AB 1YU6C 2ENNA 2OD1A 2ORVA 4OVOA 2L8EA 3TJQA 1DS2I 1RFHA 2ODDA 1IY6A 2CWFA 5J8CA 1TURA 1HPTA 1TGSI 4UXJA 3SGQI 1M8CA 4AMLA 1TUSA 3UEJA 2GVIA 1SGRI 1IW4A 1PTQA 4GI3C 1LR8A 1OVOA 1V1HA 3TO7A 2LB7A 5EX3A 7WGAA 1TOTA 2J87A 3VDPA 4E1RA 2DB6A 2XRCA 2JA1A 1Y1BA 1TBRR 2X52A 3MEKA 2LUYA 1W3SA 1R79A 3E2IA 3OXLA 1SGDI 1WGCA 1Z7KB
chains in the Genus database with same CATH topology
2DKVA 1K7TA 2CWGA 1WKXA 2WGCA 1ULNA 1Q9BA 1P9GA 1HEVA 4AMLA 1ULKA 1P9ZA 4MPIA 2LB7A 7WGAA 1K7VA 1WGTA 2X52A 2UVOA 4WP4A 2X3TA 1UHAA 1K7UA 1WGCA 1ULMA 9WGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKV A;  1K7T A;  2CWG A;  1WKX A;  2WGC A;  1ULN A;  1Q9B A;  1P9G A;  1HEV A;  4AML A;  1ULK A;  1P9Z A;  4MPI A;  2LB7 A;  7WGA A;  1K7V A;  1WGT A;  2X52 A;  2UVO A;  4WP4 A;  2X3T A;  1UHA A;  1K7U A;  1WGC A;  1ULM A;  9WGA A; 
#chains in the Genus database with same CATH topology
 1S20 A;  1PCE A;  3D00 A;  2JXD A;  3TO6 A;  3E59 A;  2JW6 A;  1CGI I;  1K7T A;  1TIH A;  1MT1 A;  1U5K A;  1WKX A;  3UEY A;  4DNC A;  3B4V C;  1CSO I;  1CT0 I;  3SGB I;  1ULN A;  2B8T A;  1Q9B A;  2KMP A;  3QAH A;  2RC4 A;  2NU3 I;  4UXI A;  2KMQ A;  1CT2 I;  3BJI A;  2JZM A;  5FUX A;  1FYB A;  3HH2 C;  1FAR A;  2E5R A;  1FAQ A;  1HJA I;  1XBT A;  2NU2 I;  1XA6 A;  1TBQ R;  5HQ8 A;  1K7V A;  1PTR A;  2A20 A;  1KMA A;  1OMU A;  3VE5 A;  2Y0M A;  2P6A C;  2N52 A;  1M8B A;  2V1C C;  1WGT A;  5J8F A;  2ARP F;  3GOX A;  2GKV A;  1NUB A;  1PPF I;  2E73 A;  2J9R A;  2NU0 I;  2ORW A;  2ROW A;  2UVO A;  2WCY A;  1V1I A;  3FSY A;  1K7U A;  1ULM A;  1CGJ I;  1OMT A;  2GIV A;  3KY9 A;  1XX6 A;  5FUV A;  2M5X A;  4A24 A;  2ERW A;  4HGU A;  3TO9 A;  1IY5 A;  2QQE A;  2WGC A;  1VDD A;  5JHW C;  1SGQ I;  2SGF I;  1MJB A;  1MJ9 A;  5EX0 A;  2FNF X;  5HI7 A;  2N17 A;  2KCX A;  1OYV I;  1FY7 A;  1CT4 I;  3UGI A;  5E3P A;  1BUS A;  1TBO A;  5E3R A;  1CE3 A;  1LR7 A;  2CWH A;  3R5B A;  2ENZ A;  3CXL A;  4SGB I;  3UOE A;  2SGD I;  2GKR I;  1N13 A;  5E3Q A;  2DIP A;  1YTP A;  1LR9 A;  2N71 A;  2NU1 I;  2X3T A;  3R5D A;  1DS3 I;  1SGY I;  2OVO A;  3UFF A;  4FKD A;  2V1C A;  2LEO A;  1SGP I;  2KMO A;  2RIJ A;  1TBN A;  1Y1C A;  1KBE A;  3PDN A;  1AN1 I;  4WP4 A;  3TOB A;  3UGD A;  2DKV A;  3R5A A;  2CJS C;  4B6D A;  3R5C A;  3QWP A;  2K9H A;  2CWG A;  2ELI A;  1NXU A;  1UUC A;  2KMR A;  2PQ8 A;  2QQC A;  3OVO A;  3OXG A;  4UXH A;  1KBF A;  2YUU A;  2QQD A;  1PJU A;  1Z2I A;  3UGL A;  5CCM A;  3VDU A;  5CCL A;  4E1P A;  1P9G A;  1X4S A;  2W0T A;  1HEV A;  4JCV E;  2JYY A;  4L9M A;  5DAE A;  2QQ0 A;  1WTJ A;  3TOA A;  1W4R A;  1ULK A;  2SGQ I;  3FC3 A;  1P9Z A;  1X74 A;  2L7X A;  4MPI A;  1MJA A;  2GKT I;  1SGE I;  2SGP I;  2V53 A;  2UZ3 A;  3SEK C;  3RU0 A;  2QPO A;  1H0Z A;  1BMO A;  3QTL D;  2YQP A;  1UVG A;  2BUS A;  2OU2 A;  1HDL A;  1Y8F A;  2OZU A;  3OL0 A;  2WVJ A;  2B0U C;  3FSX A;  1UHA A;  1CHO I;  2SGE I;  1UVF A;  3OXF A;  9WGA A;  2F3C I;  1R0R I;  5FUW A;  5FUY A;  2NU4 I;  2VRW B;  1SGN I;  2N1A B;  1YU6 C;  2ENN A;  2OD1 A;  2ORV A;  4OVO A;  2L8E A;  3TJQ A;  1DS2 I;  1RFH A;  2ODD A;  1IY6 A;  2CWF A;  5J8C A;  1TUR A;  1HPT A;  1TGS I;  4UXJ A;  3SGQ I;  1M8C A;  4AML A;  1TUS A;  3UEJ A;  2GVI A;  1SGR I;  1IW4 A;  1PTQ A;  4GI3 C;  1LR8 A;  1OVO A;  1V1H A;  3TO7 A;  2LB7 A;  5EX3 A;  7WGA A;  1TOT A;  2J87 A;  3VDP A;  4E1R A;  2DB6 A;  2XRC A;  2JA1 A;  1Y1B A;  1TBR R;  2X52 A;  3MEK A;  2LUY A;  1W3S A;  1R79 A;  3E2I A;  3OXL A;  1SGD I;  1WGC A;  1Z7K B; 
#chains in the Genus database with same CATH homology
 2DKV A;  1K7T A;  2CWG A;  1WKX A;  2WGC A;  1ULN A;  1Q9B A;  1P9G A;  1HEV A;  4AML A;  1ULK A;  1P9Z A;  4MPI A;  2LB7 A;  7WGA A;  1K7V A;  1WGT A;  2X52 A;  2UVO A;  4WP4 A;  2X3T A;  1UHA A;  1K7U A;  1WGC A;  1ULM A;  9WGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...