2LB7A

Hevein-type antifungal peptide with a unique 10-cysteine motif
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antimicrobial peptide 1a
publication title Solution structure of a defense peptide from wheat with a 10-cysteine motif.
pubmed doi rcsb
source organism Triticum kiharae
molecule tags Antimicrobial protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2lb7A00
2X3TA 2LB7A 1ULMA 4AMLA 2X52A 7WGAA 1WKXA 2CWGA 2DKVA 1Q9BA 1P9GA 1K7TA 9WGAA 1K7UA 1K7VA 4MPIA 1WGTA 1WGCA 1UHAA 1ULNA 1ULKA 1P9ZA 2UVOA 1HEVA 2WGCA 4WP4A
chains in the Genus database with same CATH superfamily
2W0TA 4HGUA 2L7XA 1Z7KB 1S20A 1TGSI 2E5RA 2LUYA 3KY9A 1W4RA 5FUVA 3FC3A 1OMTA 3TJQA 2NU3I 1DS2I 1WKXA 2N52A 1BUSA 1PJUA 1P9GA 1SGPI 2GIVA 1HPTA 1YU6C 2WCYA 2VRWB 2ELIA 2V1CA 2SGEI 2OU2A 2NU1I 3QWPA 5HQ8A 4UXJA 1HDLA 5EX3A 4A24A 1CGII 3OVOA 2K9HA 1NXUA 2ROWA 4DNCA 1UHAA 1ULNA 2V53A 5CCLA 2B8TA 1Z2IA 2DB6A 2JA1A 2QQ0A 1HEVA 1OYVI 1XBTA 1V1IA 4WP4A 1WTJA 2J87A 3R5AA 5J8CA 1SGRI 1SGEI 1V1HA 3SGBI 2LB7A 1ULMA 2Y0MA 2X52A 1FARA 1HJAI 4L9MA 3E59A 1TUSA 1XX6A 1M8BA 2DKVA 2QQDA 3SEKC 5E3QA 5HI7A 2YQPA 3TO9A 1DS3I 1CGJI 1K7UA 4UXHA 3MEKA 1TIHA 1X74A 5J8FA 4E1RA 1WGTA 2ORVA 1MT1A 2E73A 1RFHA 2P6AC 1MJAA 1PCEA 5EX0A 5FUYA 2QPOA 1NUBA 1CSOI 1SGDI 1M8CA 1ULKA 4GI3C 3VDPA 2KCXA 4JCVE 5JHWC 2ENNA 2KMRA 3PDNA 1IY5A 2ODDA 3OXLA 1XA6A 5FUWA 2GKTI 3TO6A 1KMAA 3HH2C 3RU0A 3TOAA 1PPFI 1PTRA 2X3TA 1MJ9A 1N13A 1SGNI 2RC4A 2B0UC 2N1AB 2ORWA 2ARPF 2NU4I 3CXLA 5E3PA 1W3SA 7WGAA 1PTQA 1FYBA 1H0ZA 1UVGA 3VDUA 2NU0I 2LEOA 3QAHA 2CJSC 1Q9BA 3UGDA 3E2IA 1K7TA 1TBQR 2WVJA 3FSYA 4B6DA 2J9RA 2KMQA 2NU2I 1LR8A 1KBEA 1OVOA 4FKDA 3GOXA 2YUUA 1TBNA 2ENZA 3OXGA 4MPIA 3UGIA 1CT0I 3FSXA 1CT4I 1TBOA 2UZ3A 1IW4A 1WGCA 2V1CC 2SGFI 3TOBA 2SGPI 3UGLA 1UVFA 2M5XA 2ERWA 3B4VC 1UUCA 3QTLD 1FY7A 3UEYA 2RIJA 2UVOA 3OXFA 1Y1BA 2N17A 1MJBA 1TBRR 2CWHA 1Y1CA 3R5BA 1R0RI 5DAEA 2WGCA 3SGQI 5FUXA 1U5KA 1CT2I 1AN1I 3OL0A 4UXIA 1CE3A 2L8EA 1SGQI 2JZMA 1LR7A 1VDDA 1YTPA 2CWFA 2DIPA 2FNFX 2JW6A 2JYYA 2OVOA 1TOTA 2XRCA 3BJIA 5E3RA 3TO7A 1TURA 3UEJA 1IY6A 2GVIA 2GKVA 2CWGA 3UOEA 1BMOA 3R5DA 2JXDA 1FAQA 1OMUA 2A20A 2GKRI 2PQ8A 2QQCA 1R79A 9WGAA 4OVOA 4AMLA 1SGYI 1K7VA 2SGQI 2QQEA 3D00A 5CCMA 2KMPA 1LR9A 2N71A 2OD1A 1X4SA 2F3CI 3VE5A 1P9ZA 4E1PA 2BUSA 4SGBI 1KBFA 1CHOI 3UFFA 2KMOA 3R5CA 2OZUA 2SGDI 1Y8FA
chains in the Genus database with same CATH topology
2X3TA 2LB7A 1ULMA 4AMLA 2X52A 7WGAA 1WKXA 2CWGA 2DKVA 1Q9BA 1P9GA 1K7TA 9WGAA 1K7UA 1K7VA 4MPIA 1WGTA 1WGCA 1UHAA 1ULNA 1ULKA 1P9ZA 2UVOA 1HEVA 2WGCA 4WP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3T A;  2LB7 A;  1ULM A;  4AML A;  2X52 A;  7WGA A;  1WKX A;  2CWG A;  2DKV A;  1Q9B A;  1P9G A;  1K7T A;  9WGA A;  1K7U A;  1K7V A;  4MPI A;  1WGT A;  1WGC A;  1UHA A;  1ULN A;  1ULK A;  1P9Z A;  2UVO A;  1HEV A;  2WGC A;  4WP4 A; 
#chains in the Genus database with same CATH topology
 2W0T A;  4HGU A;  2L7X A;  1Z7K B;  1S20 A;  1TGS I;  2E5R A;  2LUY A;  3KY9 A;  1W4R A;  5FUV A;  3FC3 A;  1OMT A;  3TJQ A;  2NU3 I;  1DS2 I;  1WKX A;  2N52 A;  1BUS A;  1PJU A;  1P9G A;  1SGP I;  2GIV A;  1HPT A;  1YU6 C;  2WCY A;  2VRW B;  2ELI A;  2V1C A;  2SGE I;  2OU2 A;  2NU1 I;  3QWP A;  5HQ8 A;  4UXJ A;  1HDL A;  5EX3 A;  4A24 A;  1CGI I;  3OVO A;  2K9H A;  1NXU A;  2ROW A;  4DNC A;  1UHA A;  1ULN A;  2V53 A;  5CCL A;  2B8T A;  1Z2I A;  2DB6 A;  2JA1 A;  2QQ0 A;  1HEV A;  1OYV I;  1XBT A;  1V1I A;  4WP4 A;  1WTJ A;  2J87 A;  3R5A A;  5J8C A;  1SGR I;  1SGE I;  1V1H A;  3SGB I;  2LB7 A;  1ULM A;  2Y0M A;  2X52 A;  1FAR A;  1HJA I;  4L9M A;  3E59 A;  1TUS A;  1XX6 A;  1M8B A;  2DKV A;  2QQD A;  3SEK C;  5E3Q A;  5HI7 A;  2YQP A;  3TO9 A;  1DS3 I;  1CGJ I;  1K7U A;  4UXH A;  3MEK A;  1TIH A;  1X74 A;  5J8F A;  4E1R A;  1WGT A;  2ORV A;  1MT1 A;  2E73 A;  1RFH A;  2P6A C;  1MJA A;  1PCE A;  5EX0 A;  5FUY A;  2QPO A;  1NUB A;  1CSO I;  1SGD I;  1M8C A;  1ULK A;  4GI3 C;  3VDP A;  2KCX A;  4JCV E;  5JHW C;  2ENN A;  2KMR A;  3PDN A;  1IY5 A;  2ODD A;  3OXL A;  1XA6 A;  5FUW A;  2GKT I;  3TO6 A;  1KMA A;  3HH2 C;  3RU0 A;  3TOA A;  1PPF I;  1PTR A;  2X3T A;  1MJ9 A;  1N13 A;  1SGN I;  2RC4 A;  2B0U C;  2N1A B;  2ORW A;  2ARP F;  2NU4 I;  3CXL A;  5E3P A;  1W3S A;  7WGA A;  1PTQ A;  1FYB A;  1H0Z A;  1UVG A;  3VDU A;  2NU0 I;  2LEO A;  3QAH A;  2CJS C;  1Q9B A;  3UGD A;  3E2I A;  1K7T A;  1TBQ R;  2WVJ A;  3FSY A;  4B6D A;  2J9R A;  2KMQ A;  2NU2 I;  1LR8 A;  1KBE A;  1OVO A;  4FKD A;  3GOX A;  2YUU A;  1TBN A;  2ENZ A;  3OXG A;  4MPI A;  3UGI A;  1CT0 I;  3FSX A;  1CT4 I;  1TBO A;  2UZ3 A;  1IW4 A;  1WGC A;  2V1C C;  2SGF I;  3TOB A;  2SGP I;  3UGL A;  1UVF A;  2M5X A;  2ERW A;  3B4V C;  1UUC A;  3QTL D;  1FY7 A;  3UEY A;  2RIJ A;  2UVO A;  3OXF A;  1Y1B A;  2N17 A;  1MJB A;  1TBR R;  2CWH A;  1Y1C A;  3R5B A;  1R0R I;  5DAE A;  2WGC A;  3SGQ I;  5FUX A;  1U5K A;  1CT2 I;  1AN1 I;  3OL0 A;  4UXI A;  1CE3 A;  2L8E A;  1SGQ I;  2JZM A;  1LR7 A;  1VDD A;  1YTP A;  2CWF A;  2DIP A;  2FNF X;  2JW6 A;  2JYY A;  2OVO A;  1TOT A;  2XRC A;  3BJI A;  5E3R A;  3TO7 A;  1TUR A;  3UEJ A;  1IY6 A;  2GVI A;  2GKV A;  2CWG A;  3UOE A;  1BMO A;  3R5D A;  2JXD A;  1FAQ A;  1OMU A;  2A20 A;  2GKR I;  2PQ8 A;  2QQC A;  1R79 A;  9WGA A;  4OVO A;  4AML A;  1SGY I;  1K7V A;  2SGQ I;  2QQE A;  3D00 A;  5CCM A;  2KMP A;  1LR9 A;  2N71 A;  2OD1 A;  1X4S A;  2F3C I;  3VE5 A;  1P9Z A;  4E1P A;  2BUS A;  4SGB I;  1KBF A;  1CHO I;  3UFF A;  2KMO A;  3R5C A;  2OZU A;  2SGD I;  1Y8F A; 
#chains in the Genus database with same CATH homology
 2X3T A;  2LB7 A;  1ULM A;  4AML A;  2X52 A;  7WGA A;  1WKX A;  2CWG A;  2DKV A;  1Q9B A;  1P9G A;  1K7T A;  9WGA A;  1K7U A;  1K7V A;  4MPI A;  1WGT A;  1WGC A;  1UHA A;  1ULN A;  1ULK A;  1P9Z A;  2UVO A;  1HEV A;  2WGC A;  4WP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...