2SGFI

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTFEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgfI00
2KCXA 1TGSI 1IW4A 2NU1I 4HGUA 2ERWA 2NU4I 1HPTA 3SGBI 4OVOA 1DS2I 1OVOA 1HJAI 1MT1A 3HH2C 1OMUA 2SGFI 1NUBA 2NU0I 1SGYI 2V53A 1UVFA 1IY6A 2M5XA 1BMOA 1TIHA 3TJQA 1Y1CA 3SGQI 2GKVA 1SGDI 1FYBA 3QTLD 2N17A 2KMQA 1Y1BA 2QQCA 1UUCA 1YTPA 1R0RI 1TUSA 1SGQI 3OVOA 1H0ZA 2SGDI 1M8BA 1TBRR 2N52A 2F3CI 2N71A 1TBQR 2SGQI 1PPFI 3B4VC 1KMAA 1SGNI 2NU2I 2NU3I 2JYYA 1IY5A 1HDLA 1CT2I 2JXDA 1BUSA 1SGEI 2SGPI 1LR8A 1Z7KB 2BUSA 1UVGA 2B0UC 1N13A 1TURA 2GKTI 1CGII 1PCEA 4SGBI 2JZMA 1CGJI 2GKRI 1CT0I 5DAEA 1DS3I 2KMPA 1SGRI 1OYVI 2QQDA 1CE3A 2SGEI 2XRCA 1PJUA 1LR9A 1M8CA 2ARPF 2OVOA 2P6AC 1CSOI 1LR7A 2LEOA 1CHOI 5JHWC 1SGPI 4GI3C 1OMTA 2KMOA 1YU6C 2KMRA 1CT4I 1AN1I 3SEKC 2WCYA
chains in the Genus database with same CATH superfamily
1W3SA 2GIVA 3R5BA 2KCXA 2QQEA 1K7UA 1TGSI 1WKXA 2E73A 2FNFX 2V1CC 1Y8FA 2RIJA 1IW4A 2NU1I 4HGUA 2ERWA 3FC3A 3TOBA 2YUUA 3OXFA 1K7VA 3R5DA 1WTJA 3UEYA 2NU4I 2OD1A 3R5AA 1W4RA 1HPTA 1TOTA 3SGBI 1MJBA 1VDDA 2ROWA 4FKDA 4OVOA 2Y0MA 3KY9A 3RU0A 1DS2I 1OVOA 4UXJA 1HJAI 1MT1A 1UHAA 3VDUA 1ULNA 3PDNA 4WP4A 1Z2IA 2JW6A 3HH2C 5FUYA 3UOEA 1OMUA 2GVIA 2SGFI 1XBTA 2UZ3A 4JCVE 2L7XA 1PTQA 2YQPA 1NUBA 2NU0I 1SGYI 2V53A 5E3RA 1UVFA 2ORWA 7WGAA 1IY6A 2M5XA 2WVJA 1BMOA 2ENZA 1TIHA 1S20A 1V1HA 4MPIA 3TJQA 1K7TA 1Y1CA 2RC4A 2GKVA 3SGQI 1SGDI 1FYBA 1P9GA 1TBNA 3QTLD 3VDPA 2N17A 5CCMA 3E2IA 5J8CA 2KMQA 1Y1BA 3MEKA 2QQCA 4E1PA 1UUCA 1YTPA 1R0RI 1TUSA 2CWGA 2JA1A 2DB6A 1SGQI 3OVOA 1X74A 3E59A 5FUXA 2ORVA 2SGDI 1H0ZA 2N1AB 5J8FA 1XA6A 5EX3A 4B6DA 4L9MA 1M8BA 1TBRR 1U5KA 4AMLA 1X4SA 2N52A 2F3CI 2N71A 2ODDA 2ENNA 1TBQR 3TOAA 5E3PA 1FY7A 1XX6A 2SGQI 1PPFI 3FSXA 5FUVA 3B4VC 3UFFA 1KMAA 1ULKA 1MJAA 1TBOA 1V1IA 1SGNI 2NU2I 1Q9BA 1HEVA 4UXIA 2ELIA 2OZUA 2NU3I 3TO9A 2JYYA 3UGIA 2WGCA 3GOXA 3FSYA 1IY5A 1WGTA 5E3QA 1HDLA 1CT2I 1RFHA 2E5RA 2JXDA 1BUSA 1MJ9A 3TO6A 1KBEA 2B8TA 1SGEI 2SGPI 1LR8A 1WGCA 3OL0A 2QPOA 9WGAA 2CJSC 1Z7KB 2BUSA 2CWHA 1UVGA 2B0UC 1N13A 1TURA 2UVOA 2GKTI 1CGII 2X52A 1PCEA 2LUYA 1NXUA 4SGBI 3QAHA 4DNCA 3QWPA 1P9ZA 2JZMA 5CCLA 1CGJI 2GKRI 2CWFA 1CT0I 2QQ0A 3UGDA 5DAEA 1DS3I 3UEJA 1KBFA 2KMPA 1SGRI 1OYVI 2K9HA 2LB7A 2QQDA 5HQ8A 3VE5A 1CE3A 2VRWB 2SGEI 2XRCA 3OXLA 2X3TA 3UGLA 1PJUA 2PQ8A 5HI7A 2OU2A 1LR9A 2W0TA 1M8CA 2DKVA 5EX0A 2ARPF 4E1RA 2J87A 2OVOA 2V1CA 2P6AC 1PTRA 1CSOI 1LR7A 3D00A 3OXGA 3R5CA 4A24A 2J9RA 2LEOA 3CXLA 1CHOI 1ULMA 3TO7A 5JHWC 2L8EA 1SGPI 3BJIA 5FUWA 1FAQA 4GI3C 1OMTA 2KMOA 1R79A 2A20A 1FARA 1YU6C 2DIPA 2KMRA 1CT4I 1AN1I 3SEKC 2WCYA 4UXHA
chains in the Genus database with same CATH topology
1W3SA 2KCXA 2QQEA 1TGSI 2E73A 2FNFX 2V1CC 1Y8FA 1IW4A 2NU1I 4HGUA 2ERWA 3FC3A 2YUUA 3OXFA 3UEYA 2NU4I 2OD1A 1W4RA 1HPTA 1TOTA 3SGBI 1VDDA 2ROWA 4FKDA 4OVOA 3KY9A 3RU0A 1DS2I 1OVOA 4UXJA 1HJAI 1MT1A 3VDUA 3PDNA 2JW6A 3HH2C 5FUYA 1OMUA 2GVIA 2SGFI 1XBTA 2UZ3A 4JCVE 2L7XA 1PTQA 2YQPA 1NUBA 2NU0I 1SGYI 2V53A 1UVFA 2ORWA 1IY6A 2M5XA 2WVJA 1BMOA 2ENZA 1TIHA 1V1HA 3TJQA 1Y1CA 3SGQI 2GKVA 1SGDI 1FYBA 1TBNA 3QTLD 3VDPA 2N17A 5CCMA 3E2IA 2KMQA 1Y1BA 3MEKA 2QQCA 4E1PA 1UUCA 1YTPA 1R0RI 1TUSA 2JA1A 2DB6A 1SGQI 3OVOA 1X74A 3E59A 5FUXA 2ORVA 2SGDI 1H0ZA 2N1AB 1XA6A 5EX3A 4B6DA 4L9MA 1M8BA 1TBRR 1U5KA 1X4SA 2N52A 2F3CI 2N71A 2ODDA 2ENNA 1TBQR 1XX6A 2SGQI 1PPFI 5FUVA 3B4VC 3UFFA 1KMAA 1V1IA 1TBOA 1SGNI 2NU2I 4UXIA 2ELIA 2NU3I 2JYYA 3UGIA 3GOXA 1IY5A 1HDLA 1CT2I 1RFHA 2E5RA 2JXDA 1BUSA 1KBEA 2B8TA 1SGEI 2SGPI 1LR8A 3OL0A 2QPOA 2CJSC 1Z7KB 2BUSA 1UVGA 2B0UC 1N13A 1TURA 2GKTI 1CGII 1PCEA 2LUYA 4SGBI 3QWPA 2JZMA 5CCLA 1CGJI 2GKRI 1CT0I 2QQ0A 3UGDA 5DAEA 1DS3I 3UEJA 1KBFA 2KMPA 1SGRI 1OYVI 2K9HA 2QQDA 5HQ8A 3VE5A 1CE3A 2VRWB 2SGEI 2XRCA 3OXLA 3UGLA 1PJUA 5HI7A 2W0TA 1LR9A 5EX0A 1M8CA 2ARPF 2J87A 2OVOA 2V1CA 2P6AC 1PTRA 1CSOI 1LR7A 3D00A 3OXGA 4A24A 4E1RA 2J9RA 2LEOA 3CXLA 1CHOI 5JHWC 2L8EA 1SGPI 3BJIA 5FUWA 1FAQA 4GI3C 1OMTA 2KMOA 2A20A 1R79A 1FARA 1YU6C 2DIPA 2KMRA 1CT4I 1AN1I 3SEKC 2WCYA 4UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCX A;  1TGS I;  1IW4 A;  2NU1 I;  4HGU A;  2ERW A;  2NU4 I;  1HPT A;  3SGB I;  4OVO A;  1DS2 I;  1OVO A;  1HJA I;  1MT1 A;  3HH2 C;  1OMU A;  2SGF I;  1NUB A;  2NU0 I;  1SGY I;  2V53 A;  1UVF A;  1IY6 A;  2M5X A;  1BMO A;  1TIH A;  3TJQ A;  1Y1C A;  3SGQ I;  2GKV A;  1SGD I;  1FYB A;  3QTL D;  2N17 A;  2KMQ A;  1Y1B A;  2QQC A;  1UUC A;  1YTP A;  1R0R I;  1TUS A;  1SGQ I;  3OVO A;  1H0Z A;  2SGD I;  1M8B A;  1TBR R;  2N52 A;  2F3C I;  2N71 A;  1TBQ R;  2SGQ I;  1PPF I;  3B4V C;  1KMA A;  1SGN I;  2NU2 I;  2NU3 I;  2JYY A;  1IY5 A;  1HDL A;  1CT2 I;  2JXD A;  1BUS A;  1SGE I;  2SGP I;  1LR8 A;  1Z7K B;  2BUS A;  1UVG A;  2B0U C;  1N13 A;  1TUR A;  2GKT I;  1CGI I;  1PCE A;  4SGB I;  2JZM A;  1CGJ I;  2GKR I;  1CT0 I;  5DAE A;  1DS3 I;  2KMP A;  1SGR I;  1OYV I;  2QQD A;  1CE3 A;  2SGE I;  2XRC A;  1PJU A;  1LR9 A;  1M8C A;  2ARP F;  2OVO A;  2P6A C;  1CSO I;  1LR7 A;  2LEO A;  1CHO I;  5JHW C;  1SGP I;  4GI3 C;  1OMT A;  2KMO A;  1YU6 C;  2KMR A;  1CT4 I;  1AN1 I;  3SEK C;  2WCY A; 
#chains in the Genus database with same CATH topology
 1W3S A;  2GIV A;  3R5B A;  2KCX A;  2QQE A;  1K7U A;  1TGS I;  1WKX A;  2E73 A;  2FNF X;  2V1C C;  1Y8F A;  2RIJ A;  1IW4 A;  2NU1 I;  4HGU A;  2ERW A;  3FC3 A;  3TOB A;  2YUU A;  3OXF A;  1K7V A;  3R5D A;  1WTJ A;  3UEY A;  2NU4 I;  2OD1 A;  3R5A A;  1W4R A;  1HPT A;  1TOT A;  3SGB I;  1MJB A;  1VDD A;  2ROW A;  4FKD A;  4OVO A;  2Y0M A;  3KY9 A;  3RU0 A;  1DS2 I;  1OVO A;  4UXJ A;  1HJA I;  1MT1 A;  1UHA A;  3VDU A;  1ULN A;  3PDN A;  4WP4 A;  1Z2I A;  2JW6 A;  3HH2 C;  5FUY A;  3UOE A;  1OMU A;  2GVI A;  2SGF I;  1XBT A;  2UZ3 A;  4JCV E;  2L7X A;  1PTQ A;  2YQP A;  1NUB A;  2NU0 I;  1SGY I;  2V53 A;  5E3R A;  1UVF A;  2ORW A;  7WGA A;  1IY6 A;  2M5X A;  2WVJ A;  1BMO A;  2ENZ A;  1TIH A;  1S20 A;  1V1H A;  4MPI A;  3TJQ A;  1K7T A;  1Y1C A;  2RC4 A;  2GKV A;  3SGQ I;  1SGD I;  1FYB A;  1P9G A;  1TBN A;  3QTL D;  3VDP A;  2N17 A;  5CCM A;  3E2I A;  5J8C A;  2KMQ A;  1Y1B A;  3MEK A;  2QQC A;  4E1P A;  1UUC A;  1YTP A;  1R0R I;  1TUS A;  2CWG A;  2JA1 A;  2DB6 A;  1SGQ I;  3OVO A;  1X74 A;  3E59 A;  5FUX A;  2ORV A;  2SGD I;  1H0Z A;  2N1A B;  5J8F A;  1XA6 A;  5EX3 A;  4B6D A;  4L9M A;  1M8B A;  1TBR R;  1U5K A;  4AML A;  1X4S A;  2N52 A;  2F3C I;  2N71 A;  2ODD A;  2ENN A;  1TBQ R;  3TOA A;  5E3P A;  1FY7 A;  1XX6 A;  2SGQ I;  1PPF I;  3FSX A;  5FUV A;  3B4V C;  3UFF A;  1KMA A;  1ULK A;  1MJA A;  1TBO A;  1V1I A;  1SGN I;  2NU2 I;  1Q9B A;  1HEV A;  4UXI A;  2ELI A;  2OZU A;  2NU3 I;  3TO9 A;  2JYY A;  3UGI A;  2WGC A;  3GOX A;  3FSY A;  1IY5 A;  1WGT A;  5E3Q A;  1HDL A;  1CT2 I;  1RFH A;  2E5R A;  2JXD A;  1BUS A;  1MJ9 A;  3TO6 A;  1KBE A;  2B8T A;  1SGE I;  2SGP I;  1LR8 A;  1WGC A;  3OL0 A;  2QPO A;  9WGA A;  2CJS C;  1Z7K B;  2BUS A;  2CWH A;  1UVG A;  2B0U C;  1N13 A;  1TUR A;  2UVO A;  2GKT I;  1CGI I;  2X52 A;  1PCE A;  2LUY A;  1NXU A;  4SGB I;  3QAH A;  4DNC A;  3QWP A;  1P9Z A;  2JZM A;  5CCL A;  1CGJ I;  2GKR I;  2CWF A;  1CT0 I;  2QQ0 A;  3UGD A;  5DAE A;  1DS3 I;  3UEJ A;  1KBF A;  2KMP A;  1SGR I;  1OYV I;  2K9H A;  2LB7 A;  2QQD A;  5HQ8 A;  3VE5 A;  1CE3 A;  2VRW B;  2SGE I;  2XRC A;  3OXL A;  2X3T A;  3UGL A;  1PJU A;  2PQ8 A;  5HI7 A;  2OU2 A;  1LR9 A;  2W0T A;  1M8C A;  2DKV A;  5EX0 A;  2ARP F;  4E1R A;  2J87 A;  2OVO A;  2V1C A;  2P6A C;  1PTR A;  1CSO I;  1LR7 A;  3D00 A;  3OXG A;  3R5C A;  4A24 A;  2J9R A;  2LEO A;  3CXL A;  1CHO I;  1ULM A;  3TO7 A;  5JHW C;  2L8E A;  1SGP I;  3BJI A;  5FUW A;  1FAQ A;  4GI3 C;  1OMT A;  2KMO A;  1R79 A;  2A20 A;  1FAR A;  1YU6 C;  2DIP A;  2KMR A;  1CT4 I;  1AN1 I;  3SEK C;  2WCY A;  4UXH A; 
#chains in the Genus database with same CATH homology
 1W3S A;  2KCX A;  2QQE A;  1TGS I;  2E73 A;  2FNF X;  2V1C C;  1Y8F A;  1IW4 A;  2NU1 I;  4HGU A;  2ERW A;  3FC3 A;  2YUU A;  3OXF A;  3UEY A;  2NU4 I;  2OD1 A;  1W4R A;  1HPT A;  1TOT A;  3SGB I;  1VDD A;  2ROW A;  4FKD A;  4OVO A;  3KY9 A;  3RU0 A;  1DS2 I;  1OVO A;  4UXJ A;  1HJA I;  1MT1 A;  3VDU A;  3PDN A;  2JW6 A;  3HH2 C;  5FUY A;  1OMU A;  2GVI A;  2SGF I;  1XBT A;  2UZ3 A;  4JCV E;  2L7X A;  1PTQ A;  2YQP A;  1NUB A;  2NU0 I;  1SGY I;  2V53 A;  1UVF A;  2ORW A;  1IY6 A;  2M5X A;  2WVJ A;  1BMO A;  2ENZ A;  1TIH A;  1V1H A;  3TJQ A;  1Y1C A;  3SGQ I;  2GKV A;  1SGD I;  1FYB A;  1TBN A;  3QTL D;  3VDP A;  2N17 A;  5CCM A;  3E2I A;  2KMQ A;  1Y1B A;  3MEK A;  2QQC A;  4E1P A;  1UUC A;  1YTP A;  1R0R I;  1TUS A;  2JA1 A;  2DB6 A;  1SGQ I;  3OVO A;  1X74 A;  3E59 A;  5FUX A;  2ORV A;  2SGD I;  1H0Z A;  2N1A B;  1XA6 A;  5EX3 A;  4B6D A;  4L9M A;  1M8B A;  1TBR R;  1U5K A;  1X4S A;  2N52 A;  2F3C I;  2N71 A;  2ODD A;  2ENN A;  1TBQ R;  1XX6 A;  2SGQ I;  1PPF I;  5FUV A;  3B4V C;  3UFF A;  1KMA A;  1V1I A;  1TBO A;  1SGN I;  2NU2 I;  4UXI A;  2ELI A;  2NU3 I;  2JYY A;  3UGI A;  3GOX A;  1IY5 A;  1HDL A;  1CT2 I;  1RFH A;  2E5R A;  2JXD A;  1BUS A;  1KBE A;  2B8T A;  1SGE I;  2SGP I;  1LR8 A;  3OL0 A;  2QPO A;  2CJS C;  1Z7K B;  2BUS A;  1UVG A;  2B0U C;  1N13 A;  1TUR A;  2GKT I;  1CGI I;  1PCE A;  2LUY A;  4SGB I;  3QWP A;  2JZM A;  5CCL A;  1CGJ I;  2GKR I;  1CT0 I;  2QQ0 A;  3UGD A;  5DAE A;  1DS3 I;  3UEJ A;  1KBF A;  2KMP A;  1SGR I;  1OYV I;  2K9H A;  2QQD A;  5HQ8 A;  3VE5 A;  1CE3 A;  2VRW B;  2SGE I;  2XRC A;  3OXL A;  3UGL A;  1PJU A;  5HI7 A;  2W0T A;  1LR9 A;  5EX0 A;  1M8C A;  2ARP F;  2J87 A;  2OVO A;  2V1C A;  2P6A C;  1PTR A;  1CSO I;  1LR7 A;  3D00 A;  3OXG A;  4A24 A;  4E1R A;  2J9R A;  2LEO A;  3CXL A;  1CHO I;  5JHW C;  2L8E A;  1SGP I;  3BJI A;  5FUW A;  1FAQ A;  4GI3 C;  1OMT A;  2KMO A;  2A20 A;  1R79 A;  1FAR A;  1YU6 C;  2DIP A;  2KMR A;  1CT4 I;  1AN1 I;  3SEK C;  2WCY A;  4UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...