2SGFI

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTFEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgfI00
1H0ZA 1N13A 2JZMA 1LR8A 2JXDA 1Z7KB 1R0RI 1PJUA 3TJQA 1TUSA 1CGII 1M8CA 1TIHA 2NU1I 1UUCA 2ERWA 1SGPI 2SGDI 2P6AC 4HGUA 1PCEA 1TBQR 4SGBI 1YTPA 1CGJI 3SEKC 3SGQI 1YU6C 2JYYA 2KMPA 1DS3I 2M5XA 3QTLD 1SGEI 1CT2I 2NU0I 1CSOI 2WCYA 1Y1CA 1OYVI 2OVOA 2QQCA 2SGPI 1NUBA 1SGNI 1OVOA 2NU4I 3OVOA 4GI3C 1HPTA 2NU2I 2KMOA 2GKRI 1TGSI 1PPFI 2BUSA 2SGEI 1IW4A 2N17A 2KMRA 2KMQA 1KMAA 2B0UC 2GKTI 1M8BA 1OMUA 1HJAI 1AN1I 2LEOA 1BMOA 1LR7A 1BUSA 1UVGA 3B4VC 1DS2I 1SGRI 2ARPF 1LR9A 1CT0I 2N71A 1CT4I 1Y1BA 1SGYI 1UVFA 1IY6A 1CHOI 2V53A 1MT1A 1SGDI 2QQDA 5DAEA 2F3CI 2GKVA 1FYBA 1IY5A 1HDLA 1OMTA 2KCXA 2N52A 2NU3I 1SGQI 1TURA 2XRCA 3HH2C 2SGQI 4OVOA 1TBRR 2SGFI 5JHWC 1CE3A 3SGBI
chains in the Genus database with same CATH superfamily
1V1IA 1H0ZA 1N13A 2JZMA 4AMLA 1LR8A 1K7TA 2QQ0A 2JXDA 1Z7KB 7WGAA 1R0RI 3CXLA 1PJUA 3TJQA 2JA1A 2ROWA 2QPOA 1K7UA 2DIPA 1XA6A 5CCLA 1TUSA 1NXUA 1CGII 1M8CA 1X74A 1P9GA 3OL0A 1XX6A 1ULNA 2RIJA 1TIHA 5J8CA 3QAHA 1Z2IA 2NU1I 5EX3A 2DKVA 3UFFA 3GOXA 1UUCA 2ERWA 1SGPI 2X3TA 1TBNA 2SGDI 1X4SA 2YUUA 2P6AC 4HGUA 1PCEA 1PTQA 2DB6A 3VE5A 1TBQR 3R5BA 2L7XA 4SGBI 3TO6A 1VDDA 2J87A 1YTPA 2LUYA 1CGJI 3SEKC 4MPIA 3SGQI 2OD1A 1YU6C 4FKDA 3UEYA 5E3PA 2JYYA 2KMPA 1DS3I 5HI7A 2M5XA 2Y0MA 4L9MA 2CWHA 2ORWA 3QTLD 3UGLA 1SGEI 5FUVA 5FUYA 3OXLA 1CT2I 2NU0I 2W0TA 1CSOI 1K7VA 2WCYA 1Y1CA 1WKXA 1OYVI 2E5RA 3FSYA 2OVOA 2QQCA 4JCVE 2SGPI 1WTJA 2L8EA 1NUBA 1SGNI 9WGAA 1OVOA 2NU4I 3OVOA 1MJ9A 1HPTA 2NU2I 2J9RA 2GKRI 2KMOA 2WVJA 1Q9BA 1PPFI 1TGSI 3MEKA 2X52A 3R5DA 3VDPA 2BUSA 1UHAA 5FUXA 2SGEI 5E3QA 3R5CA 4UXHA 2N17A 1IW4A 1P9ZA 1S20A 3D00A 2CWFA 3OXFA 2K9HA 5FUWA 2KMRA 2KMQA 1V1HA 1WGTA 2ELIA 1XBTA 2A20A 3KY9A 3TOBA 3FSXA 4E1PA 1MJAA 1HEVA 1KMAA 2B0UC 3TO9A 2GKTI 1M8BA 1OMUA 1Y8FA 3UEJA 1HJAI 2ORVA 2CWGA 2UZ3A 1AN1I 2V1CC 2LEOA 2OU2A 4WP4A 4A24A 1FAQA 2ENZA 1BMOA 4B6DA 3BJIA 3RU0A 1W3SA 1LR7A 3QWPA 2ODDA 2N1AB 3UGIA 1BUSA 2FNFX 3TOAA 1UVGA 3UGDA 3B4VC 1FARA 2QQEA 1DS2I 1SGRI 2ARPF 1LR9A 1CT0I 2CJSC 4UXIA 3R5AA 2N71A 1CT4I 1Y1BA 3E59A 1SGYI 2UVOA 5CCMA 1UVFA 2ENNA 1IY6A 1CHOI 4DNCA 1FY7A 2V53A 2GIVA 1MT1A 1SGDI 2LB7A 2QQDA 3OXGA 5HQ8A 3VDUA 3E2IA 1TBOA 4UXJA 5DAEA 5E3RA 2F3CI 2GKVA 1FYBA 1TOTA 2RC4A 1U5KA 5EX0A 4GI3C 1R79A 1ULKA 1WGCA 2JW6A 2GVIA 1KBFA 2YQPA 1MJBA 3UOEA 4E1RA 3FC3A 1IY5A 1HDLA 2V1CA 1OMTA 2KCXA 2N52A 2NU3I 2WGCA 1SGQI 1TURA 2XRCA 1ULMA 3HH2C 1RFHA 2VRWB 2SGQI 2B8TA 2OZUA 1TBRR 1PTRA 2PQ8A 4OVOA 3TO7A 3PDNA 2SGFI 5JHWC 1CE3A 1W4RA 3SGBI 5J8FA 2E73A 1KBEA
chains in the Genus database with same CATH topology
1V1IA 1H0ZA 1N13A 2JZMA 1LR8A 2QQ0A 2JXDA 1Z7KB 1R0RI 3CXLA 1PJUA 3TJQA 2JA1A 2ROWA 2QPOA 2DIPA 1XA6A 5CCLA 1TUSA 1CGII 1M8CA 1X74A 3OL0A 1XX6A 1TIHA 2NU1I 5EX3A 3UFFA 3GOXA 1UUCA 2ERWA 1SGPI 1TBNA 2SGDI 1X4SA 2YUUA 2P6AC 4HGUA 1PCEA 1PTQA 2DB6A 3VE5A 1TBQR 2L7XA 4SGBI 1VDDA 2J87A 1YTPA 2LUYA 1CGJI 3SEKC 3SGQI 2OD1A 1YU6C 4FKDA 3UEYA 2JYYA 2KMPA 1DS3I 5HI7A 2M5XA 4L9MA 2ORWA 3QTLD 3UGLA 1SGEI 5FUVA 5FUYA 3OXLA 1CT2I 2NU0I 2W0TA 1CSOI 2WCYA 1Y1CA 1OYVI 2E5RA 2OVOA 2QQCA 4JCVE 2SGPI 2L8EA 1NUBA 1SGNI 1OVOA 2NU4I 3OVOA 4GI3C 1HPTA 2NU2I 2J9RA 2GKRI 2KMOA 2WVJA 1TGSI 1PPFI 3MEKA 3VDPA 2BUSA 5FUXA 2SGEI 4UXHA 2N17A 1IW4A 3D00A 3OXFA 2K9HA 5FUWA 2KMRA 2KMQA 1V1HA 2ELIA 1XBTA 2A20A 3KY9A 4E1PA 1KMAA 2B0UC 2GKTI 1M8BA 1OMUA 1Y8FA 3UEJA 1HJAI 2ORVA 2UZ3A 1AN1I 2V1CC 2LEOA 1FAQA 4A24A 2ENZA 1BMOA 4B6DA 3BJIA 3RU0A 1W3SA 1LR7A 3QWPA 2ODDA 2N1AB 3UGIA 1BUSA 2FNFX 3UGDA 1UVGA 3B4VC 1FARA 2QQEA 1DS2I 1SGRI 2ARPF 1LR9A 1CT0I 2CJSC 4UXIA 2N71A 1CT4I 1Y1BA 3E59A 1SGYI 5CCMA 1UVFA 2ENNA 1IY6A 1CHOI 2V53A 1MT1A 1SGDI 2QQDA 3OXGA 5HQ8A 3VDUA 3E2IA 1TBOA 4UXJA 5DAEA 2F3CI 2GKVA 1FYBA 1TOTA 1U5KA 5EX0A 1R79A 2JW6A 2GVIA 1KBFA 2YQPA 4E1RA 3FC3A 1IY5A 1HDLA 2V1CA 1OMTA 2KCXA 2N52A 2NU3I 1SGQI 1TURA 2XRCA 3HH2C 1RFHA 2VRWB 2SGQI 2B8TA 4OVOA 1TBRR 1PTRA 3PDNA 2SGFI 5JHWC 1CE3A 1W4RA 3SGBI 2E73A 1KBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0Z A;  1N13 A;  2JZM A;  1LR8 A;  2JXD A;  1Z7K B;  1R0R I;  1PJU A;  3TJQ A;  1TUS A;  1CGI I;  1M8C A;  1TIH A;  2NU1 I;  1UUC A;  2ERW A;  1SGP I;  2SGD I;  2P6A C;  4HGU A;  1PCE A;  1TBQ R;  4SGB I;  1YTP A;  1CGJ I;  3SEK C;  3SGQ I;  1YU6 C;  2JYY A;  2KMP A;  1DS3 I;  2M5X A;  3QTL D;  1SGE I;  1CT2 I;  2NU0 I;  1CSO I;  2WCY A;  1Y1C A;  1OYV I;  2OVO A;  2QQC A;  2SGP I;  1NUB A;  1SGN I;  1OVO A;  2NU4 I;  3OVO A;  4GI3 C;  1HPT A;  2NU2 I;  2KMO A;  2GKR I;  1TGS I;  1PPF I;  2BUS A;  2SGE I;  1IW4 A;  2N17 A;  2KMR A;  2KMQ A;  1KMA A;  2B0U C;  2GKT I;  1M8B A;  1OMU A;  1HJA I;  1AN1 I;  2LEO A;  1BMO A;  1LR7 A;  1BUS A;  1UVG A;  3B4V C;  1DS2 I;  1SGR I;  2ARP F;  1LR9 A;  1CT0 I;  2N71 A;  1CT4 I;  1Y1B A;  1SGY I;  1UVF A;  1IY6 A;  1CHO I;  2V53 A;  1MT1 A;  1SGD I;  2QQD A;  5DAE A;  2F3C I;  2GKV A;  1FYB A;  1IY5 A;  1HDL A;  1OMT A;  2KCX A;  2N52 A;  2NU3 I;  1SGQ I;  1TUR A;  2XRC A;  3HH2 C;  2SGQ I;  4OVO A;  1TBR R;  2SGF I;  5JHW C;  1CE3 A;  3SGB I; 
#chains in the Genus database with same CATH topology
 1V1I A;  1H0Z A;  1N13 A;  2JZM A;  4AML A;  1LR8 A;  1K7T A;  2QQ0 A;  2JXD A;  1Z7K B;  7WGA A;  1R0R I;  3CXL A;  1PJU A;  3TJQ A;  2JA1 A;  2ROW A;  2QPO A;  1K7U A;  2DIP A;  1XA6 A;  5CCL A;  1TUS A;  1NXU A;  1CGI I;  1M8C A;  1X74 A;  1P9G A;  3OL0 A;  1XX6 A;  1ULN A;  2RIJ A;  1TIH A;  5J8C A;  3QAH A;  1Z2I A;  2NU1 I;  5EX3 A;  2DKV A;  3UFF A;  3GOX A;  1UUC A;  2ERW A;  1SGP I;  2X3T A;  1TBN A;  2SGD I;  1X4S A;  2YUU A;  2P6A C;  4HGU A;  1PCE A;  1PTQ A;  2DB6 A;  3VE5 A;  1TBQ R;  3R5B A;  2L7X A;  4SGB I;  3TO6 A;  1VDD A;  2J87 A;  1YTP A;  2LUY A;  1CGJ I;  3SEK C;  4MPI A;  3SGQ I;  2OD1 A;  1YU6 C;  4FKD A;  3UEY A;  5E3P A;  2JYY A;  2KMP A;  1DS3 I;  5HI7 A;  2M5X A;  2Y0M A;  4L9M A;  2CWH A;  2ORW A;  3QTL D;  3UGL A;  1SGE I;  5FUV A;  5FUY A;  3OXL A;  1CT2 I;  2NU0 I;  2W0T A;  1CSO I;  1K7V A;  2WCY A;  1Y1C A;  1WKX A;  1OYV I;  2E5R A;  3FSY A;  2OVO A;  2QQC A;  4JCV E;  2SGP I;  1WTJ A;  2L8E A;  1NUB A;  1SGN I;  9WGA A;  1OVO A;  2NU4 I;  3OVO A;  1MJ9 A;  1HPT A;  2NU2 I;  2J9R A;  2GKR I;  2KMO A;  2WVJ A;  1Q9B A;  1PPF I;  1TGS I;  3MEK A;  2X52 A;  3R5D A;  3VDP A;  2BUS A;  1UHA A;  5FUX A;  2SGE I;  5E3Q A;  3R5C A;  4UXH A;  2N17 A;  1IW4 A;  1P9Z A;  1S20 A;  3D00 A;  2CWF A;  3OXF A;  2K9H A;  5FUW A;  2KMR A;  2KMQ A;  1V1H A;  1WGT A;  2ELI A;  1XBT A;  2A20 A;  3KY9 A;  3TOB A;  3FSX A;  4E1P A;  1MJA A;  1HEV A;  1KMA A;  2B0U C;  3TO9 A;  2GKT I;  1M8B A;  1OMU A;  1Y8F A;  3UEJ A;  1HJA I;  2ORV A;  2CWG A;  2UZ3 A;  1AN1 I;  2V1C C;  2LEO A;  2OU2 A;  4WP4 A;  4A24 A;  1FAQ A;  2ENZ A;  1BMO A;  4B6D A;  3BJI A;  3RU0 A;  1W3S A;  1LR7 A;  3QWP A;  2ODD A;  2N1A B;  3UGI A;  1BUS A;  2FNF X;  3TOA A;  1UVG A;  3UGD A;  3B4V C;  1FAR A;  2QQE A;  1DS2 I;  1SGR I;  2ARP F;  1LR9 A;  1CT0 I;  2CJS C;  4UXI A;  3R5A A;  2N71 A;  1CT4 I;  1Y1B A;  3E59 A;  1SGY I;  2UVO A;  5CCM A;  1UVF A;  2ENN A;  1IY6 A;  1CHO I;  4DNC A;  1FY7 A;  2V53 A;  2GIV A;  1MT1 A;  1SGD I;  2LB7 A;  2QQD A;  3OXG A;  5HQ8 A;  3VDU A;  3E2I A;  1TBO A;  4UXJ A;  5DAE A;  5E3R A;  2F3C I;  2GKV A;  1FYB A;  1TOT A;  2RC4 A;  1U5K A;  5EX0 A;  4GI3 C;  1R79 A;  1ULK A;  1WGC A;  2JW6 A;  2GVI A;  1KBF A;  2YQP A;  1MJB A;  3UOE A;  4E1R A;  3FC3 A;  1IY5 A;  1HDL A;  2V1C A;  1OMT A;  2KCX A;  2N52 A;  2NU3 I;  2WGC A;  1SGQ I;  1TUR A;  2XRC A;  1ULM A;  3HH2 C;  1RFH A;  2VRW B;  2SGQ I;  2B8T A;  2OZU A;  1TBR R;  1PTR A;  2PQ8 A;  4OVO A;  3TO7 A;  3PDN A;  2SGF I;  5JHW C;  1CE3 A;  1W4R A;  3SGB I;  5J8F A;  2E73 A;  1KBE A; 
#chains in the Genus database with same CATH homology
 1V1I A;  1H0Z A;  1N13 A;  2JZM A;  1LR8 A;  2QQ0 A;  2JXD A;  1Z7K B;  1R0R I;  3CXL A;  1PJU A;  3TJQ A;  2JA1 A;  2ROW A;  2QPO A;  2DIP A;  1XA6 A;  5CCL A;  1TUS A;  1CGI I;  1M8C A;  1X74 A;  3OL0 A;  1XX6 A;  1TIH A;  2NU1 I;  5EX3 A;  3UFF A;  3GOX A;  1UUC A;  2ERW A;  1SGP I;  1TBN A;  2SGD I;  1X4S A;  2YUU A;  2P6A C;  4HGU A;  1PCE A;  1PTQ A;  2DB6 A;  3VE5 A;  1TBQ R;  2L7X A;  4SGB I;  1VDD A;  2J87 A;  1YTP A;  2LUY A;  1CGJ I;  3SEK C;  3SGQ I;  2OD1 A;  1YU6 C;  4FKD A;  3UEY A;  2JYY A;  2KMP A;  1DS3 I;  5HI7 A;  2M5X A;  4L9M A;  2ORW A;  3QTL D;  3UGL A;  1SGE I;  5FUV A;  5FUY A;  3OXL A;  1CT2 I;  2NU0 I;  2W0T A;  1CSO I;  2WCY A;  1Y1C A;  1OYV I;  2E5R A;  2OVO A;  2QQC A;  4JCV E;  2SGP I;  2L8E A;  1NUB A;  1SGN I;  1OVO A;  2NU4 I;  3OVO A;  4GI3 C;  1HPT A;  2NU2 I;  2J9R A;  2GKR I;  2KMO A;  2WVJ A;  1TGS I;  1PPF I;  3MEK A;  3VDP A;  2BUS A;  5FUX A;  2SGE I;  4UXH A;  2N17 A;  1IW4 A;  3D00 A;  3OXF A;  2K9H A;  5FUW A;  2KMR A;  2KMQ A;  1V1H A;  2ELI A;  1XBT A;  2A20 A;  3KY9 A;  4E1P A;  1KMA A;  2B0U C;  2GKT I;  1M8B A;  1OMU A;  1Y8F A;  3UEJ A;  1HJA I;  2ORV A;  2UZ3 A;  1AN1 I;  2V1C C;  2LEO A;  1FAQ A;  4A24 A;  2ENZ A;  1BMO A;  4B6D A;  3BJI A;  3RU0 A;  1W3S A;  1LR7 A;  3QWP A;  2ODD A;  2N1A B;  3UGI A;  1BUS A;  2FNF X;  3UGD A;  1UVG A;  3B4V C;  1FAR A;  2QQE A;  1DS2 I;  1SGR I;  2ARP F;  1LR9 A;  1CT0 I;  2CJS C;  4UXI A;  2N71 A;  1CT4 I;  1Y1B A;  3E59 A;  1SGY I;  5CCM A;  1UVF A;  2ENN A;  1IY6 A;  1CHO I;  2V53 A;  1MT1 A;  1SGD I;  2QQD A;  3OXG A;  5HQ8 A;  3VDU A;  3E2I A;  1TBO A;  4UXJ A;  5DAE A;  2F3C I;  2GKV A;  1FYB A;  1TOT A;  1U5K A;  5EX0 A;  1R79 A;  2JW6 A;  2GVI A;  1KBF A;  2YQP A;  4E1R A;  3FC3 A;  1IY5 A;  1HDL A;  2V1C A;  1OMT A;  2KCX A;  2N52 A;  2NU3 I;  1SGQ I;  1TUR A;  2XRC A;  3HH2 C;  1RFH A;  2VRW B;  2SGQ I;  2B8T A;  4OVO A;  1TBR R;  1PTR A;  3PDN A;  2SGF I;  5JHW C;  1CE3 A;  1W4R A;  3SGB I;  2E73 A;  1KBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...