1K7VA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,6galbeta1,4glc
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA04
1ULMA 9WGAA 1WGTA 1ULKA 1P9GA 2UVOA 1HEVA 1K7VA 4WP4A 1Q9BA 1P9ZA 2X52A 2CWGA 2WGCA 1WGCA 4AMLA 1ULNA 1K7UA 4MPIA 7WGAA 2LB7A 2DKVA 2X3TA 1WKXA 1K7TA 1UHAA
chains in the Genus database with same CATH superfamily
3FSYA 2N17A 2GVIA 4OVOA 1R79A 3UGDA 1W4RA 1SGYI 3PDNA 3R5CA 2V53A 2JW6A 2M5XA 2JZMA 2V1CC 1NXUA 1PTRA 2ERWA 5EX3A 1P9GA 1TUSA 1DS2I 2GIVA 2YUUA 3BJIA 1TBRR 5DAEA 2ROWA 2BUSA 1TBQR 1SGEI 1VDDA 2KCXA 2QQDA 3OXLA 2GKTI 2NU1I 1Y8FA 1FARA 4E1PA 1ULNA 4FKDA 1NUBA 2PQ8A 4MPIA 2N71A 1UVFA 2NU0I 4UXIA 5HI7A 5J8FA 3UEJA 5FUXA 2ENNA 2DKVA 1M8BA 2X3TA 3R5AA 1SGPI 2CJSC 2XRCA 4E1RA 2L7XA 2SGQI 3B4VC 2RC4A 2QQEA 4SGBI 1Z7KB 2GKVA 2F3CI 3OL0A 3OVOA 4JCVE 5FUVA 1MT1A 5EX0A 2RIJA 3FC3A 2QQ0A 1FY7A 1V1IA 4L9MA 1N13A 2A20A 2N52A 5E3RA 5FUYA 2SGFI 3MEKA 3OXFA 1HEVA 1K7VA 4UXHA 1OMUA 3UEYA 1CT0I 3OXGA 1TOTA 1WTJA 5E3QA 1XA6A 1HDLA 3QAHA 2CWGA 3R5DA 1CSOI 2SGDI 4B6DA 1H0ZA 1M8CA 1SGDI 1UUCA 1WGCA 4HGUA 2B8TA 4AMLA 2J9RA 2LEOA 3SGQI 1CHOI 2KMOA 5HQ8A 3QWPA 1KMAA 3RU0A 1MJBA 1UVGA 1S20A 1MJ9A 3SEKC 3TOAA 4A24A 2KMPA 1TURA 1TGSI 2FNFX 2OD1A 5JHWC 1PTQA 1LR8A 1W3SA 1TBOA 1ULMA 3SGBI 1IY6A 1FAQA 1XBTA 2JYYA 1YTPA 2KMQA 3QTLD 1IY5A 3D00A 2OU2A 1WGTA 2ODDA 9WGAA 1ULKA 2QPOA 2SGEI 1CT2I 3TO9A 1BMOA 3UOEA 2Y0MA 3E2IA 2NU4I 2W0TA 3KY9A 4WP4A 3UFFA 1P9ZA 2X52A 1OVOA 2WGCA 1CGII 3FSXA 1RFHA 1XX6A 2SGPI 1V1HA 2N1AB 3TJQA 2UZ3A 1SGNI 2CWFA 1TIHA 2LUYA 5CCLA 1HJAI 3VE5A 2V1CA 1FYBA 2NU2I 2WVJA 3VDPA 1WKXA 2WCYA 2YQPA 2E5RA 3TO7A 1CGJI 5J8CA 2L8EA 2P6AC 1BUSA 5FUWA 1OYVI 1Z2IA 3R5BA 1R0RI 4UXJA 2DIPA 1YU6C 1LR9A 1PPFI 2B0UC 2CWHA 3TO6A 1CE3A 2JA1A 3E59A 1AN1I 4DNCA 1MJAA 1X4SA 1X74A 2ELIA 3UGIA 2J87A 2QQCA 2JXDA 1Y1CA 2K9HA 2GKRI 3CXLA 1Y1BA 2UVOA 2OZUA 1SGQI 1PCEA 2NU3I 5E3PA 1Q9BA 1SGRI 3TOBA 2DB6A 2KMRA 2VRWB 2E73A 1IW4A 3UGLA 3GOXA 3HH2C 2ORVA 1K7UA 2ORWA 1HPTA 1OMTA 1PJUA 4GI3C 5CCMA 7WGAA 1TBNA 2ARPF 1KBFA 1DS3I 2OVOA 2ENZA 2LB7A 1KBEA 3VDUA 1LR7A 1U5KA 1K7TA 1UHAA 1CT4I
chains in the Genus database with same CATH topology
1ULMA 9WGAA 1WGTA 1ULKA 1P9GA 2UVOA 1HEVA 1K7VA 4WP4A 1Q9BA 1P9ZA 2X52A 2CWGA 2WGCA 1WGCA 4AMLA 1ULNA 1K7UA 4MPIA 7WGAA 2LB7A 2DKVA 2X3TA 1WKXA 1K7TA 1UHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULM A;  9WGA A;  1WGT A;  1ULK A;  1P9G A;  2UVO A;  1HEV A;  1K7V A;  4WP4 A;  1Q9B A;  1P9Z A;  2X52 A;  2CWG A;  2WGC A;  1WGC A;  4AML A;  1ULN A;  1K7U A;  4MPI A;  7WGA A;  2LB7 A;  2DKV A;  2X3T A;  1WKX A;  1K7T A;  1UHA A; 
#chains in the Genus database with same CATH topology
 3FSY A;  2N17 A;  2GVI A;  4OVO A;  1R79 A;  3UGD A;  1W4R A;  1SGY I;  3PDN A;  3R5C A;  2V53 A;  2JW6 A;  2M5X A;  2JZM A;  2V1C C;  1NXU A;  1PTR A;  2ERW A;  5EX3 A;  1P9G A;  1TUS A;  1DS2 I;  2GIV A;  2YUU A;  3BJI A;  1TBR R;  5DAE A;  2ROW A;  2BUS A;  1TBQ R;  1SGE I;  1VDD A;  2KCX A;  2QQD A;  3OXL A;  2GKT I;  2NU1 I;  1Y8F A;  1FAR A;  4E1P A;  1ULN A;  4FKD A;  1NUB A;  2PQ8 A;  4MPI A;  2N71 A;  1UVF A;  2NU0 I;  4UXI A;  5HI7 A;  5J8F A;  3UEJ A;  5FUX A;  2ENN A;  2DKV A;  1M8B A;  2X3T A;  3R5A A;  1SGP I;  2CJS C;  2XRC A;  4E1R A;  2L7X A;  2SGQ I;  3B4V C;  2RC4 A;  2QQE A;  4SGB I;  1Z7K B;  2GKV A;  2F3C I;  3OL0 A;  3OVO A;  4JCV E;  5FUV A;  1MT1 A;  5EX0 A;  2RIJ A;  3FC3 A;  2QQ0 A;  1FY7 A;  1V1I A;  4L9M A;  1N13 A;  2A20 A;  2N52 A;  5E3R A;  5FUY A;  2SGF I;  3MEK A;  3OXF A;  1HEV A;  1K7V A;  4UXH A;  1OMU A;  3UEY A;  1CT0 I;  3OXG A;  1TOT A;  1WTJ A;  5E3Q A;  1XA6 A;  1HDL A;  3QAH A;  2CWG A;  3R5D A;  1CSO I;  2SGD I;  4B6D A;  1H0Z A;  1M8C A;  1SGD I;  1UUC A;  1WGC A;  4HGU A;  2B8T A;  4AML A;  2J9R A;  2LEO A;  3SGQ I;  1CHO I;  2KMO A;  5HQ8 A;  3QWP A;  1KMA A;  3RU0 A;  1MJB A;  1UVG A;  1S20 A;  1MJ9 A;  3SEK C;  3TOA A;  4A24 A;  2KMP A;  1TUR A;  1TGS I;  2FNF X;  2OD1 A;  5JHW C;  1PTQ A;  1LR8 A;  1W3S A;  1TBO A;  1ULM A;  3SGB I;  1IY6 A;  1FAQ A;  1XBT A;  2JYY A;  1YTP A;  2KMQ A;  3QTL D;  1IY5 A;  3D00 A;  2OU2 A;  1WGT A;  2ODD A;  9WGA A;  1ULK A;  2QPO A;  2SGE I;  1CT2 I;  3TO9 A;  1BMO A;  3UOE A;  2Y0M A;  3E2I A;  2NU4 I;  2W0T A;  3KY9 A;  4WP4 A;  3UFF A;  1P9Z A;  2X52 A;  1OVO A;  2WGC A;  1CGI I;  3FSX A;  1RFH A;  1XX6 A;  2SGP I;  1V1H A;  2N1A B;  3TJQ A;  2UZ3 A;  1SGN I;  2CWF A;  1TIH A;  2LUY A;  5CCL A;  1HJA I;  3VE5 A;  2V1C A;  1FYB A;  2NU2 I;  2WVJ A;  3VDP A;  1WKX A;  2WCY A;  2YQP A;  2E5R A;  3TO7 A;  1CGJ I;  5J8C A;  2L8E A;  2P6A C;  1BUS A;  5FUW A;  1OYV I;  1Z2I A;  3R5B A;  1R0R I;  4UXJ A;  2DIP A;  1YU6 C;  1LR9 A;  1PPF I;  2B0U C;  2CWH A;  3TO6 A;  1CE3 A;  2JA1 A;  3E59 A;  1AN1 I;  4DNC A;  1MJA A;  1X4S A;  1X74 A;  2ELI A;  3UGI A;  2J87 A;  2QQC A;  2JXD A;  1Y1C A;  2K9H A;  2GKR I;  3CXL A;  1Y1B A;  2UVO A;  2OZU A;  1SGQ I;  1PCE A;  2NU3 I;  5E3P A;  1Q9B A;  1SGR I;  3TOB A;  2DB6 A;  2KMR A;  2VRW B;  2E73 A;  1IW4 A;  3UGL A;  3GOX A;  3HH2 C;  2ORV A;  1K7U A;  2ORW A;  1HPT A;  1OMT A;  1PJU A;  4GI3 C;  5CCM A;  7WGA A;  1TBN A;  2ARP F;  1KBF A;  1DS3 I;  2OVO A;  2ENZ A;  2LB7 A;  1KBE A;  3VDU A;  1LR7 A;  1U5K A;  1K7T A;  1UHA A;  1CT4 I; 
#chains in the Genus database with same CATH homology
 1ULM A;  9WGA A;  1WGT A;  1ULK A;  1P9G A;  2UVO A;  1HEV A;  1K7V A;  4WP4 A;  1Q9B A;  1P9Z A;  2X52 A;  2CWG A;  2WGC A;  1WGC A;  4AML A;  1ULN A;  1K7U A;  4MPI A;  7WGA A;  2LB7 A;  2DKV A;  2X3T A;  1WKX A;  1K7T A;  1UHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...