1K7VA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,6galbeta1,4glc
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7vA04
2WGCA 1ULMA 2DKVA 1ULNA 2CWGA 4WP4A 2X52A 2X3TA 7WGAA 1WGCA 1ULKA 1P9GA 4MPIA 1K7TA 1WKXA 1K7VA 1UHAA 1P9ZA 2LB7A 1K7UA 4AMLA 1Q9BA 9WGAA 1HEVA 1WGTA 2UVOA
chains in the Genus database with same CATH superfamily
1SGQI 2P6AC 2KMQA 3FSXA 1YTPA 3QTLD 2DKVA 1PPFI 2ARPF 1PJUA 3UGIA 1PTQA 1VDDA 2ROWA 5DAEA 1OVOA 3SGBI 3TO6A 2N1AB 1WGCA 4UXHA 2N52A 3UEJA 1K7TA 1TBRR 1HPTA 3TOBA 2QQEA 1IY6A 2RC4A 1K7VA 2ODDA 2KCXA 2SGEI 3CXLA 1N13A 2NU1I 2RIJA 2PQ8A 3QWPA 2KMOA 1TUSA 3GOXA 1X4SA 3UEYA 1SGDI 2JA1A 3E2IA 1Y1BA 2F3CI 2LUYA 2B8TA 1SGEI 3OL0A 3PDNA 3FC3A 2BUSA 1Q9BA 2CJSC 1PCEA 2L8EA 4JCVE 5FUXA 5J8FA 2E5RA 2E73A 5EX0A 3UGLA 2UVOA 1XBTA 2WGCA 2YQPA 2GKTI 1ULMA 1CHOI 1NXUA 2YUUA 1TBOA 1LR7A 2ELIA 3BJIA 3R5BA 3TOAA 1CSOI 1DS2I 1XA6A 2ENNA 3E59A 4WP4A 3UOEA 3SGQI 3R5AA 2ERWA 3R5CA 3VDUA 1BMOA 1R0RI 2CWHA 2QQDA 1CT2I 2NU4I 2WCYA 1H0ZA 4DNCA 2QQCA 1Y1CA 1UHAA 1Z2IA 3MEKA 3R5DA 1R79A 4L9MA 3OXFA 3TJQA 2NU3I 2N17A 1MT1A 4E1RA 1S20A 2DB6A 1CGJI 1Z7KB 3QAHA 1TIHA 1PTRA 1WTJA 5E3PA 5EX3A 4AMLA 1BUSA 2UZ3A 2SGFI 2KMPA 4B6DA 5CCMA 9WGAA 4SGBI 5E3QA 1KBEA 1HDLA 4FKDA 1MJBA 3D00A 3RU0A 3UGDA 1LR9A 2K9HA 2OU2A 2JW6A 1OYVI 1SGNI 1MJAA 1CGII 2Y0MA 3FSYA 1TBQR 1ULNA 2CWGA 4HGUA 1U5KA 2OD1A 2X52A 4E1PA 1IW4A 2X3TA 7WGAA 5FUYA 5J8CA 2JXDA 1TOTA 1P9GA 1SGRI 2OZUA 2SGDI 4A24A 2VRWB 3VDPA 1V1HA 2N71A 2B0UC 5HQ8A 3TO7A 5E3RA 5CCLA 2A20A 2FNFX 3OVOA 5FUVA 2SGQI 1FY7A 1CT4I 1MJ9A 1P9ZA 1SGPI 1UUCA 1W3SA 3B4VC 3OXLA 1TURA 2J87A 2ENZA 3KY9A 1NUBA 2NU0I 4UXIA 2GIVA 2WVJA 1OMTA 5FUWA 2CWFA 1M8BA 2W0TA 2OVOA 1FYBA 3OXGA 2V1CC 2J9RA 1W4RA 2GKVA 2SGPI 5JHWC 1ULKA 1SGYI 1UVFA 1X74A 2JZMA 2V1CA 4MPIA 1CT0I 3SEKC 3UFFA 2QPOA 3VE5A 1RFHA 1V1IA 2KMRA 1WKXA 3HH2C 1XX6A 2V53A 4UXJA 2ORVA 3TO9A 1DS3I 1KBFA 1FARA 2ORWA 1TBNA 2XRCA 2NU2I 2L7XA 2GVIA 1IY5A 1M8CA 1Y8FA 4GI3C 1CE3A 2QQ0A 2LB7A 1HJAI 1K7UA 1AN1I 2LEOA 4OVOA 5HI7A 1FAQA 1TGSI 2GKRI 1KMAA 1YU6C 2M5XA 1HEVA 1UVGA 1LR8A 1WGTA 1OMUA 2JYYA 2DIPA
chains in the Genus database with same CATH topology
2WGCA 1ULMA 2DKVA 1ULNA 2CWGA 4WP4A 2X52A 2X3TA 7WGAA 1WGCA 1ULKA 1P9GA 4MPIA 1K7TA 1WKXA 1K7VA 1UHAA 1P9ZA 2LB7A 1K7UA 4AMLA 1Q9BA 9WGAA 1HEVA 1WGTA 2UVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGC A;  1ULM A;  2DKV A;  1ULN A;  2CWG A;  4WP4 A;  2X52 A;  2X3T A;  7WGA A;  1WGC A;  1ULK A;  1P9G A;  4MPI A;  1K7T A;  1WKX A;  1K7V A;  1UHA A;  1P9Z A;  2LB7 A;  1K7U A;  4AML A;  1Q9B A;  9WGA A;  1HEV A;  1WGT A;  2UVO A; 
#chains in the Genus database with same CATH topology
 1SGQ I;  2P6A C;  2KMQ A;  3FSX A;  1YTP A;  3QTL D;  2DKV A;  1PPF I;  2ARP F;  1PJU A;  3UGI A;  1PTQ A;  1VDD A;  2ROW A;  5DAE A;  1OVO A;  3SGB I;  3TO6 A;  2N1A B;  1WGC A;  4UXH A;  2N52 A;  3UEJ A;  1K7T A;  1TBR R;  1HPT A;  3TOB A;  2QQE A;  1IY6 A;  2RC4 A;  1K7V A;  2ODD A;  2KCX A;  2SGE I;  3CXL A;  1N13 A;  2NU1 I;  2RIJ A;  2PQ8 A;  3QWP A;  2KMO A;  1TUS A;  3GOX A;  1X4S A;  3UEY A;  1SGD I;  2JA1 A;  3E2I A;  1Y1B A;  2F3C I;  2LUY A;  2B8T A;  1SGE I;  3OL0 A;  3PDN A;  3FC3 A;  2BUS A;  1Q9B A;  2CJS C;  1PCE A;  2L8E A;  4JCV E;  5FUX A;  5J8F A;  2E5R A;  2E73 A;  5EX0 A;  3UGL A;  2UVO A;  1XBT A;  2WGC A;  2YQP A;  2GKT I;  1ULM A;  1CHO I;  1NXU A;  2YUU A;  1TBO A;  1LR7 A;  2ELI A;  3BJI A;  3R5B A;  3TOA A;  1CSO I;  1DS2 I;  1XA6 A;  2ENN A;  3E59 A;  4WP4 A;  3UOE A;  3SGQ I;  3R5A A;  2ERW A;  3R5C A;  3VDU A;  1BMO A;  1R0R I;  2CWH A;  2QQD A;  1CT2 I;  2NU4 I;  2WCY A;  1H0Z A;  4DNC A;  2QQC A;  1Y1C A;  1UHA A;  1Z2I A;  3MEK A;  3R5D A;  1R79 A;  4L9M A;  3OXF A;  3TJQ A;  2NU3 I;  2N17 A;  1MT1 A;  4E1R A;  1S20 A;  2DB6 A;  1CGJ I;  1Z7K B;  3QAH A;  1TIH A;  1PTR A;  1WTJ A;  5E3P A;  5EX3 A;  4AML A;  1BUS A;  2UZ3 A;  2SGF I;  2KMP A;  4B6D A;  5CCM A;  9WGA A;  4SGB I;  5E3Q A;  1KBE A;  1HDL A;  4FKD A;  1MJB A;  3D00 A;  3RU0 A;  3UGD A;  1LR9 A;  2K9H A;  2OU2 A;  2JW6 A;  1OYV I;  1SGN I;  1MJA A;  1CGI I;  2Y0M A;  3FSY A;  1TBQ R;  1ULN A;  2CWG A;  4HGU A;  1U5K A;  2OD1 A;  2X52 A;  4E1P A;  1IW4 A;  2X3T A;  7WGA A;  5FUY A;  5J8C A;  2JXD A;  1TOT A;  1P9G A;  1SGR I;  2OZU A;  2SGD I;  4A24 A;  2VRW B;  3VDP A;  1V1H A;  2N71 A;  2B0U C;  5HQ8 A;  3TO7 A;  5E3R A;  5CCL A;  2A20 A;  2FNF X;  3OVO A;  5FUV A;  2SGQ I;  1FY7 A;  1CT4 I;  1MJ9 A;  1P9Z A;  1SGP I;  1UUC A;  1W3S A;  3B4V C;  3OXL A;  1TUR A;  2J87 A;  2ENZ A;  3KY9 A;  1NUB A;  2NU0 I;  4UXI A;  2GIV A;  2WVJ A;  1OMT A;  5FUW A;  2CWF A;  1M8B A;  2W0T A;  2OVO A;  1FYB A;  3OXG A;  2V1C C;  2J9R A;  1W4R A;  2GKV A;  2SGP I;  5JHW C;  1ULK A;  1SGY I;  1UVF A;  1X74 A;  2JZM A;  2V1C A;  4MPI A;  1CT0 I;  3SEK C;  3UFF A;  2QPO A;  3VE5 A;  1RFH A;  1V1I A;  2KMR A;  1WKX A;  3HH2 C;  1XX6 A;  2V53 A;  4UXJ A;  2ORV A;  3TO9 A;  1DS3 I;  1KBF A;  1FAR A;  2ORW A;  1TBN A;  2XRC A;  2NU2 I;  2L7X A;  2GVI A;  1IY5 A;  1M8C A;  1Y8F A;  4GI3 C;  1CE3 A;  2QQ0 A;  2LB7 A;  1HJA I;  1K7U A;  1AN1 I;  2LEO A;  4OVO A;  5HI7 A;  1FAQ A;  1TGS I;  2GKR I;  1KMA A;  1YU6 C;  2M5X A;  1HEV A;  1UVG A;  1LR8 A;  1WGT A;  1OMU A;  2JYY A;  2DIP A; 
#chains in the Genus database with same CATH homology
 2WGC A;  1ULM A;  2DKV A;  1ULN A;  2CWG A;  4WP4 A;  2X52 A;  2X3T A;  7WGA A;  1WGC A;  1ULK A;  1P9G A;  4MPI A;  1K7T A;  1WKX A;  1K7V A;  1UHA A;  1P9Z A;  2LB7 A;  1K7U A;  4AML A;  1Q9B A;  9WGA A;  1HEV A;  1WGT A;  2UVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...