1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 PROTEIN
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
2G9WA 5ILVA 4UVAA 4IHTA 2ZXJA 4BXUA 4PV6A 1J9IA 2P8TA 3VWEA 1R1TA 4CZZA 1O7FA 1TQIA 2DBBA 3DF8A 4QBJA 4I7HA 4A0YA 4U7DA 4OU0A 5K5QA 3R6SA 2HKOA 4JK1X 1I1SA 2P4WA 1IUYA 1Z6RA 5FFXA 1F5TA 1B6BA 1RI7A 4UHTA 1T6SA 2A69F 5EEGA 4RB3C 3JW4A 4ENKA 3R9FA 3WTSC 4YIFA 1XGMA 4FT8A 4KUBA 4HZFA 3T5XA 5L3EA 1KQ9A 5BPIA 1M44A 3D8PA 3DNSA 2QYOA 3VB2A 3RYRA 2RV8A 5K5OA 3ZZIA 3V8IA 4QLCU 2VT2A 1T2KA 1PU9A 1ZG5A 4II9A 5F49A 1UFHA 3HRUA 1FP2A 4OMYA 2I79A 2MLKA 4R87A 2F2EA 2GWRA 5CVIA 5E18F 4IPAA 1K78B 4IUSA 3FHZA 2JDDA 3WODF 5H84A 2M1BA 2JSCA 2WTEA 4AB7A 2B3UA 3F23A 4IHSA 4FX4A 1DUXC 3S6HA 3FZVA 4R9MA 2ZW6A 1IYLA 4HKFA 3SXOA 3ZJ0A 5JI6A 1YS7A 1RIOH 5J8CA 4ESBA 1FBQA 1YVKA 2PQ8A 1T38A 2VI7A 1BO4A 3H3ZA 3CXSA 4G94A 3GW2A 3I4PA 2DK5A 3V8LA 4AVCA 1DDNA 5CJ9A 2FE7A 3MAJA 5E20A 5J6XA 3J80K 3U2RA 2LNBA 4A5NA 3IHUA 3GKRA 3EUHA 5HH1A 2VOPA 3BDDA 4J3GA 3ML6A 1FYMA 1SAXA 1Q2DA 4CS0B 4NCZA 3D2MA 3GO5A 5KTDA 1RO5A 4KYWA 2YU3A 3E0KA 3HTUA 1R22A 5KVRA 4UXNA 1ZAOA 4HV6A 1JHHA 5LHHA 3LQQA 2RGVA 5IT3A 3M1EA 3L09A 2O03A 3GVAA 3I59B 5HS9A 4L89A 4NHJA 3HHHA 4ENNA 2MBFA 1S7LA 2Z0ZA 5DYMA 4G7HF 2QVOA 1T0FA 2DFIA 1H0MA 3F5BA 3IWGA 1YLFA 4LB6B 5HLIA 4G9YA 1G4DA 3RDIA 4MBUA 2A61A 3SHPA 2OAZA 1NSLA 3F8MA 1W5SA 1SFXA 1FBUA 4EGYA 1ZRFA 2IJLA 1V4RA 4UBRA 3CUQB 5DD4A 1HQCA 3K1PA 2X4HA 2VBZA 3T0YA 4BHBA 1KYZA 1HW5A 2Q44A 1K6OA 3KP6A 3BJ7A 2JDCA 2Z9OA 1G3TA 4XNHB 2HZTA 3DP7A 2A3SA 1O3RA 4PGGA 2P5LC 2VZYA 3U9GA 1Z4EA 3ISPA 4HF2A 3E6BA 1S3ZA 2BGCA 4AIHA 2EJRA 4AG9A 4IRGA 1FZPB 2A07F 2HOEA 3ZMDA 4KN7X 4OIQF 1RZ4A 3E6DA 4Q47A 1CGPA 1B87A 3D3SA 4EM1A 4E2AA 2PFBA 2M45A 2H09A 1TW2A 1GXPA 3GUDA 1YG2A 2BEIA 1YW7A 4HAMA 3WU0A 2B4BA 5HLHA 2CYYA 1IAWA 3UY5A 2UWMA 1KU7A 1S5KA 2P6SA 5L3FA 1O57A 1YFHA 2ZO4A 3RYPA 5A2QK 1QZZA 2MA3A 5IX3A 2QQBA 1XCBA 2A6HF 1XEBA 3HUGA 4A12A 5CVRA 4KVME 5AIPA 3K9UA 3MGDA 1Z9UA 4ZYHA 4G7ZF 3GFIA 1XSXA 5ICCA 2PG4A 1UHWA 5DCMB 4UV9A 2BE5F 2PDOA 5F64A 2VE9A 4KZTA 4E8OA 2ZBKA 1Y9WA 1K78A 1Q2YA 4U9ZA 2VE8A 1S7OA 2EV6A 3F0AA 3PZJA 4DNCA 4KOXA 2EFNA 4MJ8A 1ZLKA 2P6FA 4BH9A 1T39A 4EM2A 1Q2CA 3O6BB 4XPLA 4DQ2A 5JR3A 3KEOA 2PR1A 2DXQA 1S29A 1XB4A 4HQMA 3TT2A 5LBQA 2MH9A 3TCVA 2Z99A 1ZHFA 3I0TA 1F1ZA 3P9KA 3CUQC 2REFA 3EDPA 1WWXA 4OADA 1FNNA 4I2OA 3ABUA 1Z6TA 3EQLF 4OIOF 3C7JA 2ZNYA 5TJJA 5LEJA 4NB5A 5JVTA 2IA1A 3RJPA 4M6YA 4MHDA 4KICA 2WC2A 3CJNA 1ONVA 4EMSA 3C3WA 1FY7A 1JGSA 4B5OA 2OA4A 1X3UA 2FCKA 5LGNA 1Y0UA 1BM9A 3QPTA 5JQ4A 1YLEA 3V7CA 4KT5C 2R8VA 3JTGA 3R9GA 2CQKA 4LB5A 2FNPA 4MQVA 1U5TB 2YPRA 1TBXA 5E96A 4UVBA 2JEVA 5FD5A 1S6LA 4ENJA 1PP8F 3S6KA 4Q48A 4JXQA 2G7HA 4AWXB 3SZPA 2XAJA 2PI0A 1XGOA 4O3MA 1XN7A 2EB7A 2FIAA 3ZQ7A 1A04A 2DO7A 1R23A 5DUKA 3CO7C 4JQFA 4NEXA 3IRQA 1E2XA 5LGTA 3F22A 1YW9A 3RTRA 2KJBA 2H6BA 1FYLA 3CLOA 1LNWA 3S6GA 2ZXVA 5HDGA 4XSZF 4AIKA 4EJVA 2DAOA 1R5HA 4CHUA 3E6CC 3L2CA 4CGZA 2FA5A 3GF2A 3HRMA 4AIJA 1DP7P 2G3TA 1SD4A 2MC3A 1SQHA 2B4DB 2BL1A 5CVUA 3FMQA 2O0YA 3ZMVA 1T98A 4S05A 1P0HA 2EA4A 3WTWC 4L9TA 4EV0A 5BOXA 1REPC 3EO4A 3TDUC 5CVVA 3FNCA 2JLMA 2LDUA 3GYAA 2P5KA 1P4NA 4A2UA 4RGRA 2CY2A 2Q4VA 4B8XA 2VOOA 2FSRA 5CNPA 3FM3A 4S04A 1JXSA 2O61A 1K4JA 2L02A 2HR3A 5D5VB 3S2WA 3RKYA 3CXQA 3IWZA 1VKCA 2JZYA 3Q9VA 4E0AA 2CSOA 2Q2EA 2O3FA 4AVBA 4ESFA 1IN8A 4MTDA 1HXDA 2IPQX 3ERED 4KLWA 3KLNA 1TNSA 3R9EA 4MEYF 3Q5FA 4L9VA 4HF0A 4RGXA 2GIVA 4KMUX 2Z11A 4ON0A 4KOYA 2ZJ2A 2ISZA 2QENA 3RKWA 1KUYA 3KLOA 3JVNA 1AOYA 4YFXF 3Q9SA 1FPQA 3TKYA 1MZBA 5JHUA 3VEPA 4OINF 1D8JA 2J5OA 2UXNA 4P9FA 4HV5A 4CDGA 3SHFA 3TOAA 3QU6A 3W91A 3ZMUA 2C27A 2HV2A 4QVTA 2FBIA 3W6SA 1WK4A 3M8EA 3H4QA 4E70A 3I3GA 2NYXA 2FRHA 4L9JA 3EETA 3WR7A 1XGSA 4EGZA 1KUVA 4QC6A 3WE3A 4HNXB 3WE2A 2K4BA 3KETA 1LQ1A 1FSHA 5BPDA 5HS7A 2EFWA 3IKVA 4NF1A 2D1VA 3F6OA 3GYHX 3T1BA 1W5TA 4M9ZA 1NE9A 2GQQA 1OYIA 3QOPA 5E1ZB 3ZPLA 5IB0A 4GXOA 2R98A 5LRSA 3V8KA 4KMFA 3EYIA 1U6MA 1U78A 3HTSB 3P9IA 1Z1DA 2RN7A 1I27A 1FBSA 1BBYA 2YX7A 1PP7U 3KZYA 3QRFF 1J59A 3FMRA 2QECA 2F5EA 4MHGA 4U9YA 1R5GA 2L4AA 2FT0A 3IC7A 5HOOA 2A5YB 3GFLA 2Y0MA 2PC1A 3MZYA 4AVPA 1OZPA 4U0YA 2OB0A 1I21A 1XMAA 2IL4A 2COMA 2B0LA 4Y15A 3B8GA 4EVYA 1ZYRF 5KTCA 4BHPA 1UB9A 1SD7A 3QAHA 2RVCA 2QIRA 4F6AA 4QWQA 1IF1A 4HW0A 3F8FA 4UUVA 4G7OF 4F0YA 1G3YA 3L9FA 1HSTA 3QB8A 2ZPAA 1J7KA 3C18A 1LEAA 2B3VA 1M1DA 2HYGD 3CTAA 1KYWA 2X0LA 3K0LA 4AG7A 4HX4A 1ON2A 3MWMA 4RGUA 1V3FA 4M74A 3WG9A 1TTYA 2M30A 1R36A 5ERIA 1ZG3A 3F6VA 3LQRA 3F8BA 1IICA 2R1IA 4EVIA 4Z2YA 2Z33A 2PEXA 3EFAA 1S7FA 2Q0OA 2VXZA 2FOKA 1XSVA 2REEA 1UHMA 4HA8A 4L18B 2VBQA 5FLXZ 4L0YB 1M4IA 2V6CA 2K27A 4KFCA 1KQ8A 2CO5A 4UVCA 1D5VA 1QSNA 4M9SA 2J8NA 2FBHA 4A0XA 4F7ZA 3QP5A 2EWNA 2CNTA 3KE2A 4I98B 4LG0B 5CLSA 4B09A 2F5IA 1G3WA 1MJAA 4ENMA 1BJAA 2ARHA 1OYYA 1WRJA 3WTYC 4KIBA 1MD0A 1Y7RA 2OH1A 2ZMEB 5GCNA 1BC7C 5BMZA 2G3AA 1XCVA 3KP3A 3R4KA 2BSWA 3F8NA 5H6QA 5EBVA 4R79A 4LMYA 4HOBA 3SFZA 4ONUA 3BPVA 2CNSA 4HF1A 3FMSA 3S6FA 4CAVA 4PK2A 4M9XA 5BS6A 2NAZA 4IF4A 4XNHC 2IRFG 3FXUA 2XRNA 3MZHA 2FL4A 3EY5A 4R3LA 3HRSA 2PMUA 3FRMA 1IN7A 4P9UA 4BQAA 3IWFA 3EC4A 2QMLA 2KCWA 3DXJF 2HTJA 3ZMSA 4GGGA 1J4JA 3OOPA 2VBWA 3JAMK 2AS5F 1EV7A 4XPDC 2D4PA 3CUOA 5FFZA 4HDVA 4BYYA 4RB1A 2V79A 2E7XA 1LRZA 1Y9KA 1YS6A 2EK5A 3LA2A 4L0ZB 2AJ6A 3R95A 3MFKA 3T9YA 4OIPF 3LA7A 3NEUA 2H94A 2VT3A 3VFZA 4R57A 3R0JA 4FD6A 2VODA 1I6XA 2IA0A 3BZ6A 5CYVA 4KOUA 1KQ0A 3EYYA 2P7CB 3FB3A 4FD7A 2ELHA 1P92A 1ODDA 4A6EA 2QLZA 3IKTA 2XIGA 3CUQA 2XAFA 2WPXA 3KP5A 4JBAA 3JAMZ 1R58A 1XIXA 1GVJA 1YGHA 3GY9A 1WI9A 2ISYA 2O28A 1IXCA 2VXKA 2STTA 2G0BA 3FXQA 3ELKA 1VHSA 1D3YA 2Q4YA 2B58A 1D8KA 2ADUA 1KGSA 1S7NA 1LB2A 1USSA 5EC4A 2L3DA 4FD4A 2Q04A 1TQPA 4L5JA 4FX0A 1FP1D 2B5GA 3DFGA 2EV0A 2HGCA 3GZ6A 4LG0A 4XLPF 4JWPA 2FMYA 5DCFA 1PDNC 2EFOA 4GS4A 2HQYA 4HX7A 4EJOA 2QBYA 2V1DA 4NQWA 1YTYA 3ROUA 2FBKA 1BI1A 3HSEA 4G6DA 4MI4A 2XHKA 1GHCA 1FX7A 2D45A 2QM3A 3QPHA 2V1XA 3VWDA 1W7PA 2IT0A 4LLLA 1Z7UA 2UZKA 4LLNA 1J0RA 4OIRF 2H5MA 3RI4A 5C88A 2FE3A 1GXQA 1IRGA 5LHGA 3DSBA 1CF7B 5ISVA 5E17F 3LFKA 3GEZA 4I0BA 2MH2A 5L3DA 3RKXA 2DPDA 4LUAA 1S7KA 5ICEA 3G3ZA 3H92A 3I5UA 4BMHA 1ZN2A 4I01A 1L3LA 2OZHA 3F8CA 4JJXA 2AXLA 5HDNA 3COAC 1NMTA 1QSOA 1F4KA 4P55A 4RI1A 4BAYA 1QGPA 3W6JB 2WV0A 2GXGA 3BJAA 3KP4A 2K02A 2DQLA 2XKOA 4WX9A 3LA3A 4P96A 2QUFA 1MJBA 4X5KA 4M71A 3M7GA 5F48A 5EEHA 1TIQA 3GFMA 5J8FA 4HDUA 2A6EF 4HX8A 4LD5A 3LAJA 3I53A 1SMTA 1ZLJA 1JE8A 3E5XA 2JT1A 2F5FA 1WWZA 2VC1A 3RIRA 2BUEA 4HLXA 5D8KB 1RNLA 3D2PA 5E8IA 4U0WA 1FYKA 2CW0F 2ACJA 1V0CA 2FEZA 3FX3A 5DCMA 5LRRA 1ULYA 2DK8A 2K86A 1IXRC 2ZNZA 5C82A 1RUNA 2OZ6A 2A68F 1KUXA 2OZUA 2G7UA 1QQIA 5E1WA 4WXDA 3ZN0A 3LWFA 3HRTA 1BI0A 4YIIA 2VZZA 2NS0A 3GLXA 3W6XA 2F5CA 2M87A 1LDJA 1HBXG 4PZJA 4FHTA 1W4MA 1TW3A 3DEUA 3JSOA 2BV6A 3TO7A 1OMIA 2VBYA 5H86A 4LK0F 4U0VA 2PBIA 1QBJA 4KIFA 3WTUC 4CRZB 1I1DA 5LEKA 3DR8A 4MEXF 4PSWA 2WPWA 4RAZA 2QZ8A 3FWEA 5D5XB 4H89A 1YREA 4HNYB 3TO9A 1OYWA 4UA3A 2NNNA 3FBUA 4M3SA 1FLIA 4A5MA 3K1NA 3BOQA 1I5ZA 1HW2A 3MQ0A 2E1CA 1YO5C 4KOWA 2VN2A 4L8AA 1FSEA 2HYFA 2J5PA 1O7LA 5HVQC 3F3XA 4L9NA 4YGOA 2PR8A 1HKSA 1BI2A 4EJUA 1U5TC 4O5VA 2OU2A 1BN5A 3B73A 4IRIA 1MDMB 2HUZA 2IP2A 3HHGA 3J81K 4RGSA 2CG4A 2HFHA 2PSWA 2GANA 5F46A 1DPRA 4IRHA 3LSTA 4U88A 2J8RA 1Z4RA 4YFJA 4EQQA 2FXFA 4PSXA 1P2FA 4JXRA 4KOVA 3LODA 3WTTC 1N71A 2XVCA 3K9TA 2K4JA 2X7BA 4BHCA 3TTHA 5DWNA 5L3GA 4D0PA 3F8KA 3KFWX 3DV8A 4Q5SF 2ZCWA 2D2WA 5K5RA 4MGRA 3O3KA 5F1RA 1RXTA 1SMYF 1BI3A 1IW7F 1I1GA 3MCZA 5DV5A 4XLNF 4IXAA 4AD9A 3L7WA 3GWZA 1R1UA 4CXFA 3WGIA 1KU9A 2BYVE 2CNMA 3LAPA 5D8LB 2ZKZA 4WXHA 1E17A 1HKTA 3EXNA 3RPQA 2KIMA 3R60A 1RUOA 4QB9A 1O3QA 1FWZA 3VODA 4K2EA 1J2XA 3ECOA 1JHFA 2HWVA 1B6AA 1J75A 1STZA 2UXXA 2ETHA 4M73A 2AE6A 2FXAA 4ESJA 2A4NA 5D5WB 2JTVA 4R8HA 4Y49B 4BNCA 2GZWA 4ZBGA 4HLYA 1BIAA 2RDPA 3TDZC 1IRFA 1YX0A 3I58A 4M85A 4U7BA 2ESHA 2L4MA 1PUEE 4OLLA 4XPDB 1WSUA 1YYVA 3ABTA 4KN4X 4M6XA 4Y49C 5DWMA 1ZH5A 1LDDA 4CYDA 2C6YA 4PK3A 2DLLA 4RB0A 3B02A 5HS8A 2W57A 3NE7A 3TQNA 4LJZF 2OZGA 5JFRA 1H9GA 2HS5A 4KVXA 1MK4A 4WXCA 4U5YA 3GFJA 5LHIA 2GA1A 2ZMEA 4JD6A 2L54A 5FVJA 5HLGA 2V1UA 3JSPA 4IVNA 3BJ6A 4ASNA 1IN4A 2P6TA 1QSRA 1U2WA 4R3KA 1AWCA 1YK3A 3FM5A 3RPUA 2KKOA 2W85A 2HEOA 3RYOA 4MY3A 3HOSA 2CFXA 1LJ9A 1FC3A 4UNOA 5F6FA 1UFMA 3PGPA 4A6DA 1ON1A 1SD5A 2O6GE 4OOIA 5HDKA 2Q7BA 3BJ8A 2H27A 3J7AO 3I9SA 3R0AA 1USTA 2ZW4A 2DQRA 3GXOA 2FIWA 2XAGA 3BROA 4KUAA 4OMZA 3FYNA 3SZTA 4HQEA 2QQ9A 2LF7A 2DT5A 2HDCA 1IN6A 1BC8C 4Q4ZF 3AAFA 4ZZLA 2JPCA 2GAUA 2D4OA 1XDUA 2IA2A 2XROA 2R7FA 3R61A 2QBYB 3T8RA 4CO8A 3DQVC 1K79A 4I09A 1ZRDA 4EM0B 3SXNA 2XV4S 2PMHA 4LK1F 1CF7A 5ILSA 3HSFA 4LLGF 3U1DA 1SFUA 4R1HA 1QSTA 3MEXA 4G8XA 4MTEA 2W24A 3R1KA 1B4AA 2ZFWA 2PJPA 3I54A 4ZH4F 2BEOA 2RKHA 2XKPA 4WK8F 1NHAA 1QZYA 3HOTA 4Y17A 4XPKA 3TO6A 1SFEA 3BP8A 4A0ZA 1ZRCA 1S3JA 3TOBA 1QNTA 5AONA 4P5OA 5IT9Z 1TQMA 2KIFA 5L3BA 3KKWA 1U3EM 3OV8A 4N0BA 1XF8A 4TV7A 3WTZA 1XSDA 3TE4A 2XGXA 1YIOA 3DKWA 2DTRA 3OWCA 3VOEA 2YR2A 3P2FA 4WWCA 1P4AA 2Z5UA 3DPTA 2XUBA 4KVOE 3PQJA 4EJTA 2YSRA 3FXTA 1R1VA 2EA2A 3P9CA 4PCQA 2PRBA 4GCVA 4KOTA 3E97A 5A2QZ 1R7JA 4YG2F 3HSRA 4L5IA 4JLYA 5ILUA 1B1BA 4H0EA 3I59A 5ICFA 4FD5A 2HQRA 1YQAA 2CWEA 2FQ3A 3SQNA 3WTVC 1XD7A 4O6JA 2VBXA 3N4MA 3O2PE 2W25A 5D6FA 1ZARA 5FD6A 2FF4A 3BJOA 4CRYB 3ULQB 1MDMA 4XRFA 2HTSA 1J5YA 2FS5A 1YR0A 1B9NA 2KJCA 4M72A 4XSXF 5DEQA 1Q1HA 4AVAA 3C1DA 3NQOA 5E8GA 4H6ZA 2BBYA 1ON0A 1G3SA 4HBLA 2M8EA 3TGNA 1OR7A 1S8NA 3M8FA 1HKQA 5D4RA 4KLVA 1U5TA 3WTXC 1G6NA 4EJWA 3N97A 1TLHB 1O3TA 3PFIA 1KU2A 2FU4A 2IW5A 3KCCA 1L0CA 2L01A 2EFPA 2PN6A 1MGTA 2XASA 4KA4A 3E5UA 5D4SA 1ZREA 5KK1A 5JPHA 1R00A 2ESNA 4HNWB 3TFYA 1XMTA 4PDKA 3KP2A 1XMKA 3DDDA 3T90A 2Z3YA 2MLGA 3CDHA 1LEBA 1TNTA 4MNUA 5TRDA 1IB1E 2DW4A 3BWGA 1ZGAA 3V7SA 1UCRA 2FSWA 2JPBA 3W6KB 2ATRA 2J8MA 1I12A 4G6QA 2XAHA 5L3CA 4CAWA 2E7WA 2EV5A 2RQPA 2E1NA 2B4DA 2H6CA 1MKMA 3REOA 2GA2A 2P6GA 1LDKB 4HYEA 4B5PA 1B9MA 1QSMA 2RNJA 1U8RA 2P5VA 1FOKA 4KNYA 3WGHA 3HYIA 4OAEA 2JRTA 2OQGA 5H20A 3G73A 4KDPA 1IYKA 4RS8A 1M4GA 1IXSB 2EFQA 2OBPA 3GX4X 4NSQA 4YFNF 2B5GB 1EH6A 1CJWA 3WGGA 1EH7A 2DI3A 4KOSA 3JTHA 3E6MA 3R96A 3ZMZA 5K1YA 1Z05A 3ZN1A 4IJAA 3PP9A 2DU9A 4GO1A 1MJ9A 1VTNC 4RS2A 5FGMA 4Y13A 2LKPA 2CGPA 1P4WA 3GZ5A 1KA8A 3DPLC 3T8TA 4I02A 2K7LA 3P7NA 3D0SA 4I49A 3BLNA 2LSOA 1YVOA 5LLQA 1OPCA 3C26A 2Y75A 1BOBA 4NXYA 3F72A 2D1HA 4YRHA 3FXRA 1DPUA 5FO5A 4KIGA 4ZYDA 1KU3A 1U6GA 3L00A 2Q8KA 2YX4A 1ZGJA 2EUIA 1ZG1A 4WF2A 3V4GA 2VONA 2KRFA 2W84A 4N9IA 4YFKF 2HKXA 4ETSA 3DR6A 3V7RA 4KUMA 2QQAA 2PLYA 5HMNA 5IV0A 4UV8A 4LFUA 3N7ZA 1GHEA 1XE4A 2M5WA 5KTAA 1W7PB 5D6EA 5LGUA 3H3UA 5D5UB 2GE3A 1S60A 1K7AA 1BOAA 2QWWA 1HSJA 2KIUA 1Z91A 1F9NA 2ZW5A 2RC4A 2VC0A 1B59A 4CAXA 3V8JA 4LX9A 1CM0A 1W7PD 4RAYA 4WCGA 2R7HA 3G8WA 1OKRA 3QP6A 5FB2A 1Z9CA 3K1MA 4MQ9F 4XBFA 1YW8A 4PGHA 5F47A 5BQTA 1HW1A 2NMTA 1QPMA 3FF5A 4UWIA 3K2ZA 3SXYA 1LVAA 1L0OC 4QUSA 2TDXA 5ICGA 1C0WA 2FNAA 3BPXA 3P2HA 3ZP5A 1WKMA 1IZ1A 3M9AA 2Q0YA 1WQ2A 2OD5A 1XGNA 3QU3A 2R3SA 2LF8A 2R7DA 3FIXA 2P0WA 2VQYA 5ED4A 1P4XA 2P7VB 3IL2A 3CXPA 3J80Z 3ECHA 2XAQA 2HQNA 3IRRA 3ZMTA 2IVMA 4RB2C 2OQRA 2K5TA 1IN5A 2O8XA 4ZYGA 3JUWA 1QO0D 2STWA 4K30A 3K69A 2ZW7A 2WWYA 3I64A 4GYGA 3NRVA 4LGWA 3E5QA 3KP7A 5IT9K 1R57A 2GXBA 4N9HA 4H6UA 4ORFA 5DD8A 5AIQA 3KEQA 3WU1B 1PUAA 3F21A 5E1XA 4CICA 4UWJA 2VEZA 4MY0A 1SD6A 3E3VA 2FMLA 1M4DA 1BIBA 1KZFA 6PAXA 4I0AA 1P6RA 3HIFA 3BY6A 3IGRA 2MD5A 1EH8A 4ZYEA 2F5DA 4ZZDA 1IIDA 1H9TA 2NNYA 2I00A 2EVNA 4B5PB 1O3SA 4KORA 3D5LA 2DPUA 4IF5A 2V9VA 2P6EA 5DDGA 5CVJA 3G3SA 5FLXK 5H6RA 3PQKA 2Y48A 2NRAC 3KZZA 3CO6C 1S7AA 5DUIA 1XDSA 5I0CA 2Z10A 1FT9A 3J81Z 3LD2A 4GYIA 3I71A
chains in the Genus database with same CATH superfamily
3KHXA 2G9WA 2M7AA 5ILVA 2CWGA 4P4JA 3R5CA 4UVAA 4IHTA 2ZEGA 2ZXJA 4BXUA 1ETOA 4PV6A 1J9IA 2P8TA 3IAS2 5FUXA 3VWEA 3OS2A 2GVIA 2ELJA 1R1TA 4CZZA 3RAMA 2ORVA 3GTOJ 3HB9A 1O7FA 1ETKA 1TQIA 4KISA 2CXAA 2DBBA 1V5GA 3DF8A 4QBJA 4I7HA 2O7OA 5THWA 4A0YA 2N17A 2F8HA 4U7DA 1Z67A 4UB6C 3SDGA 4P4BA 4OU0A 5K5QA 4E7KA 2PRQA 3R6SA 2HKOA 4RM3A 3TBIA 4JK1X 3QAYA 2E5NA 4K3NA 1I1SA 4DJLA 2P4WA 5C4XJ 2CUFA 1IUYA 1Z6RA 5FFXA 1F5TA 3BR5A 1B6BA 1RI7A 2XC7A 4S0HB 3TP3A 4UHTA 1T6SA 2F5VA 4NGTA 4UCMA 4CYQA 3PNVA 3HOWJ 2A69F 5EEGA 4RB3C 1AYEA 3JW4A 2NS8A 4ENKA 5J47A 3R9FA 2WA0A 1DGRM 3WTSC 4YIFA 2ZJRF 1XGMA 4FT8A 3BTIA 4OC1A 4BKXA 2XEIA 4KUBA 4HZFA 2AO9A 1NSAA 2JWTA 1LFBA 3T5XA 5L3EA 3H3VK 1KQ9A 4E1RA 1R4NB 3CCYA 5BPIA 1M44A 3D8PA 3DNSA 2QYOA 3S1MJ 2XRCA 1IOFA 3CDXA 1JGGA 3S9MA 1LUJB 3VB2A 3RYRA 2RV8A 5K5OA 2HVSA 3UGIA 4WJBA 1WGCA 1T95A 2NSMA 4LOCA 4ANJA 3V8IA 4QLCU 3ZZIA 1WH5A 2VT2A 4IOAF 1GV2A 3UGLA 1T2KA 1PU9A 4EATA 3LFUA 2JA5J 1K7TA 1ZG5A 4II9A 5F49A 1UFHA 3KPHA 3HRUA 2BZTA 1FP2A 4OMYA 2X1EA 2I79A 3QWLA 4MHYA 1CSOI 2MLKA 1AKHB 4EMEA 1CT2I 2V1CC 4R87A 2XDVA 3L2VA 2F2EA 2GWRA 5CVIA 1WCMJ 5E18F 4IPAA 2ME6A 1IRXA 3PSIA 1K78B 4IUSA 3FHZA 4A24A 2JDDA 1S5LC 3WODF 1CT0I 5H84A 2M1BA 2JSCA 2E36A 2CF4A 2WTEA 3I55I 2GLOA 4AB7A 4ITVA 2B3UA 3AG2H 1NG7A 3F23A 4IHSA 4KS9A 4OWRB 4FX4A 1D5YA 1DUXC 3S6HA 3FZVA 5DM7F 4R9MA 2ZW6A 1IYLA 3PUFA 2XSJC 3PO2J 2FUG2 4HKFA 3SXOA 4XONA 1X4OA 3ZJ0A 5JI6A 3B3CA 1YS7A 1RIOH 3UEJA 5J8CA 4ESBA 3OYDA 1FBQA 1YVKA 3HUGB 2PQ8A 1T38A 2VI7A 1BO4A 3H3ZA 3LSJA 1ZGWA 4G94A 3CXSA 2M8GX 3GW2A 3I4PA 1YMEA 1QHGA 2DK5A 3V8LA 4F93B 1QPIA 4AVCA 1DDNA 5CJ9A 2FE7A 4P10A 3MAJA 4YRVA 1R43A 2K3FA 3HKZN 5E20A 5J6XA 2KPMA 3OIQA 3J80K 3U2RA 3WHCA 1QVTA 2LNBA 1M1EB 4A5NA 5CPAA 4ZTFA 3S9LA 3IHUA 4MCRA 4J19A 4IHVA 3GKRA 3EUHA 5HH1A 2VOPA 3BDDA 2VIXA 4J3GA 2ZXIA 2UUZA 1VQMI 1DS2I 3SJGA 3ML6A 1FYMA 3H0DA 2B8TA 5IP9J 3SJEA 1SAXA 1Q2DA 3ESWB 4CS0B 3NAUA 2E2IJ 1VQ8I 3D2MA 4NCZA 1JT6A 4CZCA 3L2UA 4UFVA 3GO5A 1WZ2A 5K8MA 5KTDA 4UFXA 3O8HA 1RO5A 4KYWA 2YU3A 3E0KA 3HTUA 1R22A 2E60A 3AL0B 2JUGA 5KVRA 4UXNA 1ZAOA 1Y8QB 1YITI 4HV6A 3SJMA 3DWLE 1VQOI 3LSMA 3IV5A 2R5YB 1JHHA 5LHHA 3LQQA 2X9DA 2DDAA 2RGVA 5IT3A 3M1EA 3L09A 1WJBA 2BW3A 4FKDA 2Z3OA 2O03A 3GVAA 3I59B 3S93A 5BNGA 2BHZA 6CPAA 4QSHA 5HS9A 1BW5A 2GLFA 4L89A 4OC3A 4NHJA 1MBHA 2HI3A 3HHHA 3OYAA 2M2EA 4ENNA 3BG5A 4OMEA 1R4MB 2MBFA 1S7LA 2Z0ZA 5DYMA 4G7HF 3S9NA 1VQNI 2O53A 2QVOA 2RREA 3D7HA 1T0FA 3BR0A 2DFIA 2X1DA 1ZLHA 5A27A 3HPHA 5M3FJ 1H0MA 1OR7C 3F5BA 1YLFA 3IWGA 4ZY1A 4LB6B 2LRDA 5HLIA 4BACA 4IL6C 3VYUB 4G9YA 2HOTA 1G4DA 4L5EA 3RDIA 4MBUA 1QZEA 2RB7A 4XK4A 3GBGA 4M6IA 2CWFA 1WPKA 3IH4A 2A61A 3SHPA 2LY2A 3DKYA 3B6CA 2OAZA 1NSLA 3F8MA 1SVLA 4BJ6C 2PJ2A 3HJEA 2BO9A 5F0HA 3OSGA 4UEZA 3F0CA 3D7DA 1W5SA 4FETA 3KGQA 1SFXA 1FBUA 5LYIA 4EGYA 1ZRFA 1PTQA 2IJLA 1V4RA 2F6CA 2IGOA 4A3IJ 3S3NA 4UBRA 4RA2A 3CUQB 5K7FA 5DD4A 1HQCA 3K1PA 2NU2I 2X4HA 2D5VA 2VBZA 5J1UA 3T0YA 2Y31A 3G4SI 4BHBA 1K7VA 1KBEA 1KYZA 4F3QA 1HW5A 2DJIA 3CMEI 1K6OA 3KP6A 2Q44A 2L9RA 1BA5A 2C6PA 3BJ7A 1QVUA 2ENNA 1QQ9A 4Y52J 2DCEA 4FISA 2JDCA 2Z9OA 1G3TA 3OYFA 2LFBA 3OL0A 4XNHB 2MC4A 4XR6A 2HZTA 3DP7A 4BY7J 2JZMA 1CPXA 2A3SA 3PNTA 1O3RA 2H8RA 4PGGA 2P5LC 2VZYA 3U9GA 1Z4EA 2M4GA 3ISPA 3E6BA 4HF2A 2R7WA 2DA7A 1S3ZA 2BGCA 3FK6A 4AIHA 2ZOFA 5CCMA 4B43A 2PX9A 2ZEEA 2EJRA 2PJ4A 4AG9A 3DBHB 4IRGA 1FZPB 2KRHA 2KDZA 1MMGA 1UWYA 2JMWA 2A07F 7CPAA 2HOEA 3LL7A 3WABA 1UZCA 1YX5A 4PJMA 3ZMDA 4KN7X 3CF2A 2RFHA 3KHZA 4OIQF 5G22A 2JA1A 4W9YA 1HDPA 1RZ4A 1MMNA 1UG0A 3E6DA 4Q47A 1CGPA 4A3BJ 3H5AA 1B87A 2NU3I 3D3SA 1ENHA 4EM1A 1ELLP 1AKHA 4E2AA 2PFBA 2A5WA 2M45A 1B72B 2JQ7A 2H09A 5IYCJ 1RESA 2Q7SA 3J7ZI 3PB9X 1TW2A 1GXPA 2KHMA 3GUDA 4BGDA 1YG2A 2DMTA 4R6TA 2Y2ZA 2BEIA 2EZIA 1YW7A 5FKMA 3OOUA 3MD2A 4GXHA 4HAMA 3WU0A 5C4JJ 3PRTA 2B4BA 5HLHA 3HUVA 4IO9F 2CYYA 1V5FA 1Y8RB 1IAWA 2LBFB 1OBRA 3UY5A 4A3LJ 3IJ3A 3OYHA 1EKEA 2UWMA 2DF5A 1KU7A 1S5KA 3A4CA 4IEJA 2P6SA 3MN8A 3ONQA 1R9TJ 5L3FA 2PJ5A 1O57A 2B7EA 2KMUA 1YFHA 4BE0A 2ZO4A 3RYPA 5FKKA 1QZZA 5A2QK 2MA3A 5A28A 2QQBA 1XCBA 4M3GA 1RRJA 5IX3A 3OVOA 4M6GA 1K6YA 2K9NA 5M5YJ 2AHQA 2A6HF 1XEBA 3HUGA 4D1QA 4A12A 2LKSA 5CVRA 3DLJA 4KVME 5AIPA 1RR8C 4C2TA 2ZEHA 3W2WA 3N5FA 5B1AH 4B10A 2LVSA 3K9UA 2NVYJ 3PDNA 3UOEA 2LG4A 3MGDA 5EZGA 1Z9UA 3FJUA 4ZYHA 4G7ZF 5JH9A 3GFIA 1XSXA 4TWEA 1X1PA 5ICCA 3I4NJ 1ZELA 2PG4A 1KONA 3QYFA 1UHWA 2EK9A 5DCMB 4UV9A 2Q1ZB 3VYSB 2FOWA 3HGYA 4XLEA 1Y0RA 2BE5F 5GAEJ 2XSDC 1SANA 1YU6C 2PDOA 5F64A 2DA5A 2CW8A 3S32A 1SGDI 1LANA 3PBBA 1BR2A 1TBOA 2VE9A 4KZTA 2QCOA 4E8OA 3BI0A 2ZBKA 3DTKA 1X58A 1Y9WA 4X8IA 4KITB 1DS3I 1VQ6I 3SEZA 1K78A 1ULNA 1Q2YA 4U9ZA 2EBIA 2VE8A 1S7OA 2EV6A 3K70C 3OYBA 4DYCA 3F0AA 3PB8X 3PZJA 4DNCA 2H8WA 2EFNA 4KOXA 4MO7A 4BS9A 4MJ8A 1ZLKA 2P6FA 3B4VC 4BH9A 4EM2A 1T39A 1Q2CA 4BDYA 8CPAA 1ELMP 3O6BB 4IHMA 1LAPA 3RBUA 1OFCX 4XPLA 1NUBA 1XX6A 3JRAA 4DQ2A 5JR3A 4B11A 2CTCA 3B3VA 4IAVA 2PJCA 3B6AA 3KEOA 2R5YA 2PR1A 2DXQA 1S29A 1U0JA 1XB4A 4HQMA 1SEUA 1JKQC 2V77A 1HPTA 3BTJA 1MBGA 4HSTA 3TT2A 5LBQA 2BW3B 2MH9A 1JI8A 3B3SA 3TCVA 1NG6A 2Z99A 5IOZA 1ZHFA 2LMDA 3I0TA 5FLVA 1R79A 4XIDA 1F1ZA 4P44A 2K9LA 3P9KA 3CUQC 1YJNI 2REFA 3BJIA 3JCUC 4BU2A 1WKXA 3C2GA 3EDPA 1WWXA 4OADA 2DMPA 1FNNA 4II2A 4I2OA 2PIYA 3CPXA 3ABUA 3JRHA 1Z6TA 3EQLF 1FMVA 3C7JA 2ZNYA 4OIOF 2R93J 3OXGA 5IOYA 5TJJA 5LEJA 2IEKA 2PIZA 4ZDOA 4NB5A 4MFDA 2JVGA 5JVTA 2IA1A 1PUFB 1ZR2A 3RJPA 4M6YA 4MHDA 4KICA 2CW7A 2WC2A 1OMUA 3MRUA 1BLLE 3H1CA 3VYRB 3HKZA 5FKOA 3CJNA 5JGFA 4HRIA 1ONVA 4E7HA 1IRZA 4EMSA 2PJAA 3C3WA 1FY7A 1JGSA 2WBMA 4B5OA 4CA0A 1UUCA 2OA4A 3JRFA 4CGNA 1ORKA 1X3UA 2FCKA 5LGNA 1Y0UA 4P6YA 1BM9A 3QPTA 4E7ZA 2O8KA 4SGBI 3FBIB 5JQ4A 1YLEA 3V7CA 4FAIA 4KT5C 2R8VA 1TP4A 3JTGA 3R9GA 2CQKA 4LB5A 4DIQA 4CCNA 1ARLA 4KSFA 5G1ZA 2NU0I 2NVTJ 2SGPI 2FNPA 2QGUA 4MQVA 1U5TB 2YPRA 2X6XA 4PQAA 3ZQFA 2R7VA 2GKVA 1R71A 1TBXA 3DBLB 2RIJA 3MMYB 4ZC3A 5E96A 4UVBA 2JEVA 3BCAA 1S6LA 5FD5A 3CCEI 4ENJA 1PP8F 1VQKI 3CC7I 2LY9A 1YE9A 3O8GA 3GTQJ 3DLLF 3S6KA 4Q48A 3ZCOA 4JXQA 3RU0A 2G7HA 4AWXB 3SZPA 4CYOA 3WU2C 2GFQA 4Y4RA 2XAJA 2FX0A 1MBJA 2PI0A 4ZI6A 1XGOA 4O3MA 1XN7A 2EB7A 4BXFA 2FIAA 3ZQ7A 1A04A 2Z3LA 3SJXA 3AG3H 2L9SA 2DO7A 1R23A 5DUKA 3CO7C 4Y3OA 1QU3A 4UF4A 4JQFA 4NEXA 3IRQA 2O4HA 1E2XA 1VQLI 2W1OA 3B3WA 5LGTA 4E7SA 1YW9A 3RTRA 3F22A 3QNVA 3U1KA 2XEFA 3F9KA 2XB0X 2KJBA 2H6BA 1GVDA 4G6TB 1FYLA 3CLOA 1DQUA 1Z8WA 2CRGA 1LNWA 2HPMA 2JBJA 4LQGA 3S6GA 2ZXVA 1ULKA 5HDGA 3H35A 4EFDA 1YOVB 4XSZF 4AIKA 2GM4A 4EJVA 3CC2I 2DAOA 1R5HA 4UUTA 4MMOA 4CHUA 3E6CC 3L2CA 4CGZA 2FA5A 1W3SA 1K83J 2HU9A 5EZHA 3KYDB 1YQEA 4ZTJA 2WB1A 3GF2A 1GDTA 3HRMA 2MW8A 3FIWA 4AIJA 1TL8A 4OKOA 1WHUA 1WH7A 1DP7P 2G3TA 1SD4A 2MC3A 2COBA 3K7AJ 3PUBA 1SQHA 2B4DB 3BHXA 2R7TA 3OXFA 3VSLA 2BL1A 5CVUA 3FMQA 3H9GA 2O0YA 2L7MP 4MXUA 4C2YA 2ZEMA 3ZMVA 4XQFA 1T98A 4S05A 1P0HA 2EA4A 3Q0VA 3J7YJ 2Z3KA 4DZJA 3WTWC 2PJRB 4MCQA 4L9TA 5LYDA 4EV0A 2L9VA 1SGNI 2YU9J 1XC5A 3HOXJ 5BOXA 1REPC 3EO4A 3TDUC 5CVVA 2QA4I 3FNCA 2JLMA 2LDUA 3GYAA 3H9JA 3KI9A 5HXDA 2P5KA 1P4NA 4A2UA 4M6VA 3IH2A 4RGRA 5EG0A 2CY2A 2Q4VA 3K10A 4B8XA 2VOOA 2FSRA 5CNPA 3HGGA 2BY2A 3CF5F 3FM3A 5HNFA 4S04A 5F1JA 4Z6YA 4UB8C 2ORWA 1JXSA 2O61A 1K4JA 2V4JC 2L02A 2HR3A 4XKVA 2E35A 1Z7KB 2X48A 3GUXA 3BR6A 1A6IA 5D5VB 3S2WA 3RKYA 3PEIA 3H8FA 2VL8A 3CXQA 1TWFJ 2OTJI 3IWZA 1VKCA 2GLJA 2JZYA 3Q9VA 4E0AA 4A3GJ 2YNCA 1Z2IA 2CSOA 2Q2EA 2O3FA 2NVQJ 1XA6A 4RN7A 3OR1C 4BE1A 1IDZA 1JWQA 3FECA 3AG1H 3A0HC 4AVBA 4ESFA 1IN8A 2V8VA 4MTDA 4R76A 5GPCA 1HXDA 2IPQX 3ERED 2HOAA 4PK4A 4KLWA 3KLNA 1TNSA 3R9EA 4MEYF 3Q5FA 2IGMA 4HSRA 3SFIA 2HXIA 4L9VA 3ABLH 4HF0A 1YHQI 4XNFA 1BR4A 4RGXA 2GIVA 4KMUX 2Z11A 4ON0A 4KOYA 2ZJ2A 1UAAA 2ISZA 4AC0A 3LSRA 1YLOA 1WJDA 2QENA 3RKWA 4AMLA 3KLOA 3GTJJ 1KUYA 1OYVI 3JVNA 3CDLA 3IAM2 3IC1A 1BW6A 1AOYA 4YFXF 2VQCA 2DT7B 3SGQI 1UHSA 3Q9SA 1FPQA 3TKYA 4QIWN 3W6VA 1YW4A 1MZBA 3I3LA 5JHUA 2EIMH 2WB1N 4OINF 3VEPA 4B1RA 1XBTA 2SGQI 1FT7A 4ZY0A 1D8JA 2J5OA 5HVGA 2CV2A 2UXNA 4P9FA 4HV5A 4LITA 4CDGA 4PXDA 4UXIA 4X3RA 4A33A 1Z2LA 3SHFA 3TOAA 3V7ZA 2MG4A 3QU6A 3AFHA 3W91A 4P1WA 3ZMUA 4RDUA 2C27A 2C6GA 2HV2A 3A9LA 4QVTA 2FBIA 4MFZA 3W6SA 4QPOA 1WK4A 2HOSA 3M8EA 2K5CA 3H4QA 2KCXA 4E70A 3K4NA 2NYXA 4N4OB 3I3GA 2OUMA 1I3QJ 1W0UA 4PFOA 2FRHA 5CBMA 4L9JA 1CX8A 3KEYA 4QPQA 3EETA 2A20A 2CIJA 1XGSA 2Y69H 3PB4X 2KZGA 3WR7A 9ANTA 2GOMA 4EGZA 3CC4I 1KUVA 4QC6A 3BT9A 3WE3A 4HNXB 4A3MJ 2KDOA 3WE2A 2K4BA 5CQGA 3KETA 1LQ1A 1HEEA 3G71I 4XOPA 1IU8A 2MSYA 3B2YA 1FSHA 4B3XA 1BAVA 2ID6A 5BPDA 1MH3A 2WUUA 5HS7A 2EFWA 3IKVA 1NTCA 3ZRGA 4NF1A 3S1RJ 4E4HA 5IP7J 1CT4I 3KY9A 2D1VA 3F6OA 1TF9A 3GYHX 1PTRA 3T1BA 3E7LA 1W5TA 4M9ZA 1NE9A 2GQQA 1RTQA 4V19K 1OYIA 3QOPA 1D1CA 3MKLA 3DU5A 5E1ZB 3ZPLA 5J3LA 4A39A 5IB0A 4GXOA 2OD1A 2R98A 5LRSA 1JTYA 3V8KA 4KMFA 3IEHA 1Y1CA 4R8FA 2KFDA 3EYIA 2DA1A 4ZGYB 2NOGA 1U6MA 1U78A 3HTSB 4X6AJ 1FNOA 1OISA 3FHNA 3P9IA 3CCRI 2Y30A 2ZEOA 1Z1DA 5GPAA 4MHNA 2RN7A 4XKBA 2X52A 1AMPA 1I27A 1FBSA 1BBYA 3G1MA 1QRYA 2YX7A 3KZYA 1PP7U 1HDUA 3QRFF 1J59A 3CPAA 3K4CA 3NA6A 2AFSA 3KR5A 3FMRA 3MKYB 2QECA 2F5EA 5E3MA 4BINA 3K4MA 4U87A 3OYMA 4MHGA 2JBKA 3FXOA 4U9YA 1IO2A 1R5GA 2IS1A 2BHYA 2L4AA 2FT0A 3IC7A 1TKFA 2DA6A 5HOOA 2A5YB 3GFLA 4V2FA 5D29A 1BMOA 2Y0MA 3CMMA 3P5JA 2PC1A 1FOYA 1XOVA 3MZYA 1RETA 2L9NA 4GRIA 4AVPA 3SZGA 3CLQA 1POGA 1Z7LA 4U0YA 1OZPA 2OB0A 3UKGA 2VI6A 1I21A 2VQLA 3CJQB 3ZQHA 2R4GA 5HODA 1XMAA 4BQQA 1AHDP 2KMRA 2IL4A 2COMA 2VQHA 2J87A 2B0LA 1TBNA 3DTEA 4Y15A 3B8GA 5E3QA 4EVYA 1ZYRF 3BZKA 4CGLA 2MGQA 2XPVA 5KTCA 1SVMA 2XEGA 2YNCC 4BHPA 1UB9A 1SD7A 3QAHA 5AG4A 1P7JA 2DMQA 2RVCA 4ABZA 2QIRA 2XF5A 2YUSA 3K2KA 4F6AA 4QWQA 4XLCA 4HW0A 1IF1A 2AFOA 2EK8A 4X2TA 3F8FA 2B9SA 4UUVA 4G7OF 4F0YA 1G3YA 3L9FA 1HSTA 3QB8A 2PVVA 4IK2A 2VJ5A 2ZPAA 5AG7A 1WFXA 1J7KA 2R7ZJ 3C18A 1LEAA 4HNTA 2B3VA 3DEWA 1M1DA 1SFOJ 2HYGD 3CTAA 1ZKGA 5C3EJ 5ELYA 3BR3A 1KYWA 3PL8A 3S1NJ 2X0LA 3K0LA 4AG7A 4HX4A 3FXMA 1ON2A 3FX6A 2E1MC 3HH2C 3MWMA 4RGUA 1V3FA 3W3CA 2SGDI 1MIJA 5FKNA 5IP6A 4M74A 3WG9A 2KL4A 3PIOF 1TTYA 2JA2A 1X2MA 2E5RA 2K40A 2M30A 2PJ8A 1KMAA 1UJ8A 1R36A 3LSHA 5ERIA 1ZG3A 3UNGC 2O9LA 3F6VA 3LQRA 3F8BA 4KLVA 1IICA 4H4KC 4B4CA 2L5QA 2HQ5A 2CUEA 4M3EA 1WJEA 2R1IA 4H2KA 1Z8TA 2Y0SN 3NH5A 4E7JA 4EVIA 3PFOA 4Z2YA 2UZ3A 1VNDA 4L9MA 5DTDA 3A01A 2Z33A 2PEXA 5FUWA 3FKJA 3Q3SA 3EFAA 1S7FA 4II3A 3SI2A 2Q0OA 2VXZA 3WC6A 2FOKA 4JP0A 2NU4I 3R5AA 5K8PA 1JUPA 4NGPA 3CQZJ 1XSVA 1NXUA 3S14J 4ONWA 2QF7A 1TWHJ 2REEA 1UHMA 4RLFA 3WHBA 4HA8A 4L18B 3E1SA 4A94A 4FCYA 4MFKA 2ARPF 2VBQA 3HC7A 3A01B 4Q38A 4A30A 4D7MA 2OOTA 2GIZA 5FLXZ 1Y39A 4L0YB 1M4IA 2V6CA 2K27A 4KFCA 1KQ8A 3FBNB 2CO5A 1OCZH 3DEEA 2DN0A 2LB7A 2Y9YA 4UVCA 4CCLA 1D5VA 4CCJA 5EG0B 1QSNA 4M9SA 2J8NA 2FBHA 4A0XA 1FTZA 4F7ZA 3QP5A 2EWNA 2CNTA 3KE2A 3RCOA 4I98B 2R0QC 2ZFUA 4FE7A 5CLSA 5DM6F 4LG0B 3IO1A 4B09A 4CGPA 2F5IA 4V2GA 1BPNA 4OVOA 1G3WA 3TMOA 1G59A 5DWMA 1HOMA 1MJAA 5E3LA 3OYIA 3D7FA 3CT9A 3CMYA 4ENMA 1BJAA 2ARHA 1OYYA 1WRJA 2QYVA 3WTYC 4KIBA 1MD0A 1S9HA 1DU6A 3FMCA 1Y7RA 2OH1A 4CAFA 2ZMEB 5GCNA 2TCTA 3DTIA 1BC7C 1CGII 5BMZA 1V1HA 2G3AA 1XCVA 3KP3A 3R4KA 2BSWA 3D00A 1DE4C 4I76A 3F8NA 5H6QA 5EBVA 3LNQA 3JRGA 1CGJI 4A95A 2XAUA 4R79A 4LMYA 4AUXA 4UUSA 4M6HA 4HOBA 1OCOH 3SFZA 4Z65A 4ONUA 1Z8XA 2ECCA 1T56A 3BPVA 3EUAA 3FMSA 4HF1A 2LLKA 2CNSA 4PK2A 3S6FA 4CAVA 2WADA 3M8JA 3PB7X 4M9XA 4G12A 4FASD 2B63J 2DDBA 2ZB9A 3G1OA 2F7VA 4KSAA 5IPAA 5BS6A 2NAZA 4C3IJ 1VI0A 4IF4A 5K7ZA 4PJLA 1ZTRA 4XNHC 2IRFG 5K7HA 3OYKA 2XF7A 3FXUA 2XRNA 3SJFA 4A3DJ 1FIPA 3MZHA 2FL4A 4NNJA 1E0EA 2L0KA 1IDYA 2Y0SA 3EY5A 4R3LA 3HRSA 2HQAA 1PJUA 1GYTA 2QQ0A 1V54H 1CE3A 4XN3A 2PE3A 2GOXB 2PMUA 5M5XJ 5LD2C 2LD5A 3OSFA 3QQAA 3FRMA 1X1BA 4KT6A 3RPUD 1F43A 1IN7A 1P7IA 1Y6IA 4P9UA 2B0UC 4BQAA 4RBOA 3IWFA 2YGWA 2QMLA 3EC4A 2KCWA 4RMNA 2CV0A 4MFEA 3DXJF 5FKLA 2HTJA 5IYBJ 3ZMSA 1FYBA 1ARMA 5DS0A 4GGGA 4C2MJ 4DJAA 2MABA 1J4JA 3OOPA 1TZLA 1VGYA 4NJQA 2VBWA 2JW6A 4DZPA 5TISC 4QTRA 2PJ0A 3I1UA 3JAMK 1MNDA 2OVOA 2AS5F 1EV7A 1MMAA 3HLPA 4XPDC 2D4PA 2V9PA 3CUOA 5FFZA 4HDVA 2IXSA 4PXCA 1YSJA 4BYYA 4RB1A 1JJ6C 2V79A 1W4RA 3JTKA 2ZSIB 4NFRA 2E7XA 1OCRH 1D0YA 1LRZA 1Y9KA 2MFZA 1YS6A 2NXNB 2EK5A 3W2AA 3TW7A 3LA2A 4L0ZB 2AJ6A 2I3CA 3DPUA 3FXJA 3MFKA 3R95A 3T9YA 4AU7A 4P4DA 4OIPF 2Z3MA 4OAYA 5LYFA 5JLXA 3LA7A 1VF9A 4C2UA 3NEUA 2H94A 2VT3A 3VFZA 2FNFX 4NC7A 4R57A 3R0JA 1ITYA 2Q2EB 4FD6A 2VODA 4IHYA 1I6XA 1V55H 2IA0A 2V6EA 1A5JA 2CU7A 2QQDA 1ZQ3P 1S7EA 3BZ6A 3SDBA 5CYVA 2EIKH 2N1AB 4R7MA 3WT4A 3OIPA 1N13A 4KOUA 2OR4A 2WVJA 1KQ0A 2W00A 3AL0C 3EYYA 2AQEA 2P7CB 3FB3A 2UV1A 3CCUI 4FD7A 2ELHA 1P92A 2XPUA 4ZX9A 1ODDA 4A6EA 2QLZA 4MCPA 1UMQA 3IKTA 2XIGA 1WJCA 3CUQA 2XAFA 2WPXA 3KP5A 4FUUA 4JBAA 5J40A 2EILH 1R58A 3JAMZ 1LE8B 1GVJA 1XIXA 1YGHA 3GY9A 1WI9A 2VKHA 3OR2C 1Y7EA 2ISYA 1LFPA 5HNHA 3CCSI 2O28A 4NGQA 4A38A 3I4MJ 1IXCA 2DMUA 2VXKA 2STTA 1R3NA 2G0BA 4D5FA 4CGOA 3FXQA 4CCOA 2VL1A 3ELKA 1VHSA 1D3YA 2YS9A 2B58A 2Q4YA 3BXMA 1D8KA 2ADUA 1W36D 1PPFI 4A3KJ 1KGSA 1LE8A 1S7NA 3BG9A 1LB2A 1TC3C 1BJZA 3KYLA 1USSA 1HDDC 5EC4A 3DGVA 2L3DA 4FD4A 2CFOA 2I10A 1TQPA 2IJZA 3QWPA 2IGKA 2Q04A 2ZENA 4L5JA 4FX0A 1FP1D 2B5GA 3DFGA 1WTJA 2EV0A 2HGCA 3GZ6A 3TC8A 1JKRC 3I9V2 4LG0A 3K4BA 4XLPF 4JWPA 2FMYA 5DCFA 2EFOA 1PDNC 3KIOA 2HQYA 4GS4A 5HLTA 4HX7A 4EJOA 5JHFA 2JEWA 1HF0A 2HVRA 4B44A 1IY5A 2W4SA 1F2OA 2QBYA 2V1DA 2E73A 4NQWA 3CJTB 1YTPA 1YTYA 3ROUA 3MZ8A 2FBKA 2WAFA 4B3AA 1BI1A 3HSEA 4NGNA 1X10A 4DUKA 3VDXA 4AIDA 4G6DA 1LR8A 2XHKA 4MI4A 1VHEA 1GHCA 3IFEA 5IYDJ 1FX7A 2D45A 3OWTA 1TGSI 2QM3A 2VB6A 1YJ9I 2WV1A 3VE5A 3QPHA 3BG7A 2V1XA 1OCCH 3VWDA 1UHAA 1Y1VJ 1W7PA 1EE3P 2IT0A 3R5BA 4LLLA 1Z7UA 2UZKA 4LLNA 3DKXA 4CH7A 3S1QJ 2JA7J 1J0RA 3VATA 1ETYA 2IMOA 4OIRF 2H5MA 3RI4A 5C88A 2EIJH 3B35A 3HOUJ 2H1KA 3WC7A 5FRMA 2FE3A 1GXQA 2PMZA 1RPWA 3M1CA 1IRGA 4JOMA 4X1EA 2EQRA 4XORA 5LHGA 1LAMA 1MNMC 3DSBA 1EA3A 1CF7B 3GMEA 1IG7A 5ISVA 2IS4A 5E17F 3LFKA 2XGEA 2NVXJ 1CBXA 4YU9A 3GEZA 4I0BA 3S3MA 3H8EA 4F55A 2MH2A 5L3DA 1U9NA 2BY0A 3RKXA 4B47A 4UUSB 4CSWA 2DPDA 4LUAA 2GXAA 1S7KA 5GTHC 3CMAI 5ICEA 1SVOA 2LUYA 2CUZA 3G3ZA 3VWBA 5E3PA 2Q43A 2WYRA 1J09A 3H92A 2BOAA 3I5UA 1XFOA 4BMHA 1ZN2A 4I01A 1LKXA 3ZOBA 2CJJA 1L3LA 4F92B 1XTAA 2OZHA 3F8CA 4JJXA 2AXLA 3H8GA 4F8ZA 4MFPA 5HDNA 3COAC 5EX3A 2V1CA 1SGQI 1NMTA 2LP0A 1QSOA 3OYGA 3CZ6A 4P55A 3OY9A 2L2OA 1F4KA 2Q4ZA 4PXEA 1B72A 2DYRH 4BAYA 4RI1A 1QGPA 3W6JB 1VDDA 3HOZJ 2C6CA 2WV0A 1X1CA 2GXGA 4CCMA 5J1RA 4AYBN 3BJAA 3KP4A 4ZDLA 3JRUA 2P6AC 2K02A 3KQZA 2DQLA 2XKOA 2E71A 4IHXA 2DPTA 1W36C 4WX9A 4PPZA 1LR7A 3LA3A 1TT0A 4P96A 5HQ8A 3D67A 1JUMA 3FK7A 5BWAB 1Q1VA 2QUFA 4NGSA 2XPWA 1MJBA 1MSEC 4X5KA 3GLLA 4M71A 3M7GA 1FARA 5F48A 5EEHA 3NWTA 1TIQA 3ISXA 3GFMA 5J8FA 1N25A 3ZQIA 4NGRA 4LIVA 2AFZA 4HDUA 2A6EF 4HX8A 4LD5A 3PO3J 3C2BA 3LAJA 1M8CA 3I53A 2LOOA 3LSPA 1SMTA 5KCMA 2PJRA 1ZLJA 1JE8A 1I6HJ 3E5XA 3K4KA 2JT1A 3LACA 2F5FA 3RZOJ 1WWZA 2VC1A 3KX2A 1K4SA 3RIRA 4GM5A 2BUEA 5EGOB 2L8EA 2QQ8A 4HLXA 5D8KB 1RNLA 1VFCA 1DTDA 3D2PA 5E8IA 2KMQA 4BY1J 4U0WA 2NVUB 2NU1I 3K4LA 2CW0F 1FYKA 2K9MA 2ACJA 1V0CA 3IWEA 2FEZA 3FX3A 2I8DA 5DCMA 5LRRA 1ULYA 1YJWI 3BCBA 2CQQA 5EGOA 3ABMH 1H8LA 5FRNA 2DB6A 4PFPA 4ZYAA 2R5ZA 2AFUA 2DK8A 2K86A 1X1AA 3JRCA 2F4IA 1IXRC 2ZNZA 3K4JA 1K7UA 5LRKA 4ZJZA 4A32A 5C82A 3PIPF 1RUNA 1Z77A 5C44J 1A31A 2OZ6A 1X19A 2A68F 3QTLD 1KUXA 2MYSA 2OZUA 2ODFA 2G7UA 2EBJA 2ZEDA 1QQIA 5E1WA 4WXDA 3ZN0A 3LWFA 3HRTA 1OMTA 3FSYA 4MRIA 1BI0A 4YIIA 2VZZA 1NK3P 1N75A 2NS0A 2W48A 2Z1DA 3A02A 3GLXA 3W2VA 1Y8FA 3W6XA 2F5CA 2LEOA 4A2ZA 3IUOA 2JUCA 2M87A 1LDJA 4E7LA 3S2DJ 3RNZA 1HBXG 4BBSJ 1FJLA 4PZJA 4FHTA 2CMPA 3PM1A 4P45A 1W4MA 5GTIC 1TW3A 2R92J 2V26A 3DEUA 3JSOA 1TKHA 2BV6A 2KISA 3MN2A 4LG3A 1Z3YA 3TO7A 4C7HA 1OMIA 2VBYA 1APLC 5D8NA 5H86A 4LK0F 4U0VA 3H5RA 2PBIA 1QBJA 2QSHX 3D68A 2OPTA 4LIUA 4KIFA 1ZG8A 2AFMA 3DU6A 3WTUC 1QMUA 4CRZB 2ELIA 2EINH 5LEKA 1I1DA 2IQ6A 4MEXF 3DR8A 1PYVA 4BEHB 1R5ID 4BUPA 4PSWA 2JJ7A 2WPWA 2R7QA 4RAZA 2QZ8A 3FWEA 5D5XB 4IX7A 4H89A 1YREA 3NH4A 4HNYB 1LR9A 1LPQA 3TO9A 4IQ4A 2OF7A 1T8IA 1OYWA 4UA3A 2NNNA 3FBUA 4M3SA 1FLIA 4A5MA 1Z3XA 4F52A 3SGBI 2ZEFA 3K1NA 3FVLA 3BOQA 1I5ZA 1HW2A 5KAFC 2VLAA 1IGBA 4A3CJ 1Z0XA 2VPRA 3MQ0A 2E1CA 2PVWA 4BL0B 1N77A 4CYNA 3CDIA 1YO5C 4KOWA 4UEEA 3RSNA 2VN2A 2ID3A 4L8AA 1WI3A 1F36A 2CJSC 1FSEA 2FD5A 2HYFA 2J5PA 1O7LA 2HDDA 2FQ4A 5HVQC 4IHWA 3F3XA 4L9NA 1TURA 2PR8A 3IU2A 4YGOA 1HKSA 4GDFA 3S15J 3OXLA 2JYYA 1BI2A 4EJUA 1U5TC 5FLMJ 1IY7A 4O5VA 2A6TA 2OU2A 1V5EA 1BN5A 3B73A 4C7IA 4OC4A 4IRIA 4LQ6A 2DOAA 1MDMB 2HUZA 1GUUA 2IP2A 3HHGA 3J81K 3S2HJ 4RGSA 2CG4A 2HFHA 2PSWA 2W0TA 2GBYA 3PFYA 2GANA 3UEYA 5F46A 1DPRA 4IRHA 1H88C 3GOXA 3UR3C 1A2ZA 2VKVA 2R7OA 4TNUA 1MBFA 3LSTA 3BTLA 4U88A 2J8RA 1Z4RA 3B3TA 1SGPI 4UY8I 4YFJA 3QOEA 4EQQA 2FXFA 4XRSG 4PSXA 3WG7H 1M4LA 1P2FA 2YQPA 2A05A 4JXRA 2AQFA 2L7XA 4KOVA 3I56I 3LODA 3M07A 3WTTC 2OCCH 4D9JA 2XVCA 1N71A 4PXBA 3K9TA 3DCFA 1AUGA 2GREA 2K4JA 2X7BA 3H5ZA 4BHCA 3TTHA 5DWNA 5L3GA 1P9GA 4D0PA 2JK3A 1LCPA 3F8KA 3KFWX 3DV8A 3OS1A 4Q5SF 2ZCWA 4DYQA 2KZVA 2NS7A 3ZR8X 2J9RA 2D2WA 2JA6J 4MHPA 5K5RA 1VQ4I 4MGRA 3NE8A 3O3KA 5F1RA 1RXTA 1SMYF 4NC8A 1BI3A 2X3TA 4A31A 1IW7F 1I1GA 3MCZA 3PNYA 5DV5A 5TGTA 4XLNF 5JVGF 4IXAA 5J4YA 4AD9A 3L7WA 3GWZA 4BDZA 4W97A 1D0ZA 1R1UA 4CXFA 1TIHA 1ZG7A 3WGIA 5FROA 1ZLIA 1KU9A 2BYVE 1MH4A 3E2IA 2CNMA 3FKIJ 3QPSA 3OYNA 3LAPA 3BI1A 2EWBA 5E3OA 1M8BA 3KR4A 1KBFA 1ERDA 5D8LB 3GTPJ 2ZKZA 4FWUA 4WXHA 2F48A 1E17A 2DMNA 1HKTA 3EXNA 3RPQA 1F2PA 2KIMA 3R60A 4IOCF 1RUOA 4QB9A 1O3QA 1YRNB 2ZJQF 1BUSA 5AGEA 5J1QA 3HM5A 1FWZA 1VQ7I 3S17J 1KZHA 1MNEA 2V8DA 2OV7A 3VODA 2LK2A 4K2EA 1J2XA 1F57A 3ECOA 1JHFA 2HWVA 1OLTA 5HI7A 2DEAA 3HDDA 3FH4A 3GLJA 2DFEA 3GB0A 1Y0NA 3TL4X 2IGNA 1B6AA 2LBFA 1IGNA 3HEFA 1XJOA 1J75A 1E3OC 1STZA 4RUHA 2UXXA 4XL9A 2ETHA 1XX5A 2YUUA 4M73A 4F9VA 2GKTI 1HLVA 2AE6A 9WGAA 2E34A 2FXAA 4ESJA 2PJ7A 1JQGA 2IS6A 2A4NA 5D5WB 2JTVA 4R8HA 3CCMI 1CHOI 2POKA 4Y49B 4BNCA 2BUSA 2V8HA 1QA6A 2GZWA 4ZBGA 3AKZA 4HLYA 4ZX8A 1BIAA 3FISA 2ZJPF 2E19A 2RDPA 5JHWC 5F0CA 3FSXA 3TDZC 1IRFA 1YX0A 3I58A 4XLAA 4M85A 4U7BA 2ESHA 2L4MA 1X4SA 1PUEE 5LRJA 4OLLA 1CQTA 4XPDB 2L7KA 2AXTC 5DAEA 2QKMB 4RM2A 4C3JJ 4PJ0C 1LOKA 5K8NA 2XF6A 2CWHA 2LYCA 4BD9A 4HNUA 1WSUA 1OVOA 4WP4A 1YYVA 3ABTA 4KN4X 4M6XA 4Y49C 1W1WE 3FXLA 1ZH5A 1LDDA 3V42A 1IV8A 3BQZA 4CYDA 2C6YA 1DU0A 4PK3A 2DLLA 4RB0A 2WAQA 1TBRR 1Y56A 4NBQA 3B02A 5HS8A 2W57A 3NE7A 3TQNA 1JT0A 4PJJA 3SYTA 3RO0A 1MBEA 4LJZF 3LMSA 2OZGA 3ZXSA 5JFRA 1H9GA 2HS5A 4KVXA 1SGYI 1MK4A 4NJRA 2E1MB 4WXCA 2ERWA 3GFJA 1OCTC 4U5YA 3TX8A 5LHIA 1EJ9A 3KL9A 5GADJ 1U9OA 2GA1A 2ZMEA 4JD6A 1RR7A 3OL3A 2L54A 5J4VA 3GTKJ 2BXYA 5FVJA 5HLGA 2V1UA 2SGEI 4MLOA 3K6GA 3JSPA 2R7RA 4IVNA 2HDWA 3BJ6A 4ASNA 2AFXA 4Y33A 4ZYQA 1IN4A 2P6TA 4OIDA 3IP4B 1QSRA 1U2WA 4RLQA 4R3KA 1OJLA 4I6ZA 2M9HA 1AWCA 1YK3A 4EWTA 3FM5A 3RPUA 2KKOA 2W85A 4B13A 2HEOA 5JM6A 3RYOA 4MY3A 3VH9A 3HOSA 4XICA 1XG1A 3VPRA 2BY1A 2CFXA 3MVPA 1LJ9A 1G2HA 2Z3PA 1FC3A 2O5RA 3U21A 1G8XA 5B3SH 4UNOA 4OC5A 5F6FA 3D5RC 1UFMA 2VJIA 5B1BH 3LOCA 3S16J 3QYEA 3PGPA 4A6DA 1ON1A 1SD5A 2O6GE 1UG2A 3H9QA 2M34A 2NOJB 3BC8A 2F4OB 4OOIA 5HDKA 5FUYA 2Q7BA 1EF4A 2XRLA 3GCMA 4JYKA 1UVGA 2QVPA 4UEFA 3BJ8A 2H27A 3J7AO 3I9SA 2HYJA 2M3AA 3R0AA 1SAUA 1USTA 3ZQLA 1R0RI 1R49A 2TRTA 2DQRA 3GXOA 2ZW4A 2FIWA 4C3HJ 2XAGA 1PVEA 3BROA 1KWMA 4KUAA 3GTGJ 4OC2A 4OMZA 2CTBA 1WJAA 4KJZA 3FYNA 3SZTA 4DOZA 4HQEA 2ECBA 2QQ9A 2E2JJ 2LF7A 3VSKA 1FTTA 2DT5A 2CQ7A 2HDCA 2W7NA 2M0CA 2JN6A 2VJ4A 1HA8A 1IW4A 1IN6A 4YEJA 1BC8C 1YW6A 4Q4ZF 3AAFA 3IIBA 4ZZLA 5IY5H 2JPCA 2GAUA 2D4OA 1XDUA 2IA2A 2XROA 2R7FA 5K8OA 3R61A 4ZY2A 2QBYB 3T8RA 4CO8A 3DQVC 1K79A 2DKVA 1HDQA 2N8GA 4I09A 1ZRDA 4EM0B 2ZMEC 3SXNA 2XV4S 2PMHA 3EUKL 4LK1F 1CF7A 5ILSA 3FEEA 3HSFA 4LLGF 3U1DA 1SFUA 2ZELA 4R1HA 4DW6A 2ZC2A 1QSTA 3MEXA 2VJJA 1IOIA 2KP6A 2DA4A 2N52A 4G8XA 4MTEA 1TOTA 2W24A 2KQRA 3R1KA 3A0BC 2ZFWA 1B4AA 4DBRA 4NDLA 2PJPA 3I54A 4ZH4F 4M3BA 2EO8A 2ENZA 3NFZA 2BEOA 1S72I 2RKHA 2XKPA 4WK8F 3CJRB 1W5CC 1RC9A 4MFLA 4NGMA 3NH8A 1NHAA 1QZYA 2JSPA 3HOTA 4Y17A 1Z5RA 4GI3C 1CG2A 3OYJA 1D1BA 4RAFA 7WGAA 3OYCA 4XPKA 3TO6A 1GLNA 1SFEA 4MFJA 2QSGX 3BP8A 4A0ZA 1TF8A 3FDYA 3TW6A 1ZRCA 2ZSHB 2QEXI 1S3JA 5F0FA 3TOBA 1QNTA 5AONA 2OCEA 1ZG9A 4F9UA 1YRNA 3A2KA 4P5OA 2F3CI 4F0XA 5IT9Z 2JXDA 1WVRA 2XB5A 4YELA 1AA7A 2LKXA 1FAQA 2QJ8A 3KQXA 1VIXA 1TQMA 5I4MA 2L7FP 4P4IA 1WGXA 2J9AA 2KIFA 5L3BA 3KKWA 1D0XA 1U3EM 3OV8A 4A3EJ 4A93J 4UIAA 2M4KA 4N0BA 1XF8A 3SEQA 1Z8LA 4TV7A 3WTZA 3M3YJ 1XSDA 2AFWA 3TE4A 1ETQA 3JR9A 2ABZA 2V8GA 2QQCA 1ETWA 2XGXA 1YIOA 3DKWA 4BJTA 3BR2A 3CP2A 3RQIA 5GAHJ 2DTRA 1LFWA 3GZNB 4Q7AA 3OWCA 3D66A 2CS3A 3VOEA 5M3MJ 5E3NA 4XN0A 4P4FA 2YR2A 3P2FA 1I50J 3M4OJ 4WWCA 1P4AA 2Z5UA 3DPTA 5FUVA 2XUBA 4KVOE 2WAEA 2VKEA 3PQJA 3ASOH 2E5ZA 1IV6A 2YSRA 4EJTA 2BXZA 3OYEA 1R1VA 3JRIA 1XBUA 2EA2A 3FXTA 3P9CA 4PCQA 3NWSA 2PRBA 3KZWA 1FOWA 4GCVA 5B5EC 3D1NI 1V1IA 4KOTA 2M0MA 1Z21A 1JUSA 2Z16A 3E97A 5A2QZ 4N4NB 1R7JA 4YG2F 1LFUP 3HSRA 4L5IA 4CYCA 3TEDA 4JLYA 5ILUA 1B1BA 4JX6A 3I59A 5ICFA 2LY1A 4H0EA 1VZ0A 4IQJA 4MPIA 4FD5A 3G1LA 3CXLA 2HQRA 1YQAA 3LSGA 2CWEA 1CP6A 2FQ3A 2N71A 3SQNA 3PBEA 3WTVC 1XD7A 3OYLA 4O6JA 2VBXA 3N4MA 3O2PE 2DXIA 4NUBA 2W25A 5M5WJ 3LWUA 4CUGA 5DS9A 2JVHA 1ZARA 5D6FA 3OS0A 2WGCA 5FD6A 2FF4A 3BJOA 3MEKA 1TXRA 4CRYB 3ULQB 1WJ5A 3DLAA 1I3AA 2HTSA 4JX4A 4XRFA 1J5YA 1MDMA 2ICWG 2R5ZB 5CCLA 2FS5A 1XMBA 1YR0A 1B9NA 1OQYA 2KJCA 4M72A 5LYLA 2CUJA 4XSXF 4HG2A 5DEQA 3CCVI 1Q1HA 5IB9A 4AVAA 3C1DA 3KYCB 4BQNA 3CCJI 3NQOA 5CKTA 5E8GA 4H6ZA 2BBYA 1ON0A 1ULMA 1G3SA 4XLFA 2VPLA 1YX3A 4HBLA 2M8EA 2HPIA 5GP9A 3TGNA 4YIRX 1TWGJ 2ROWA 4HPSA 1OR7A 1IJWC 3S8PA 3BLYA 3B7IA 1S8NA 5KAIC 5E79C 3M8FA 1T0FC 1HKQA 5D4RA 1DGWY 1BR1A 1U5TA 4XM3A 2CQXA 3WTXC 4MIMA 4BE2A 2PCUA 1G6NA 4EJWA 3N97A 1TLHB 1O3TA 3HOYJ 5B66C 3PFIA 2EZLA 2KLOA 5FJ8J 4A3JJ 4HPQA 1KU2A 1VQ9I 2P81A 1PYTB 4E1PA 5HVHA 1A35A 1FEXA 2FU4A 3RZAA 2IW5A 1RKWA 2VXDA 3KCCA 3MKZA 4YWYA 2G0EA 3ZQCA 1L0CA 2V53A 1LVKA 4Q36A 2L01A 1P9ZA 2EFPA 4GFBA 1MMSA 5LFAA 2PN6A 2R7UA 2VASA 2XGDA 1IY6A 1MGTA 1JJ8C 2XASA 3CP8A 1TWCJ 4KA4A 4O23A 3E5UA 3VDPA 2ZEPA 4RAGA 3D4UA 1P9QC 5D4SA 5JLWA 1ZREA 5KK1A 3H5NA 5JPHA 2PJ3A 1R00A 5F09A 1K61A 2ESNA 1JTXA 4P4EA 4EEFG 4BQOA 4HNWB 3TFYA 2VQGA 1XMTA 1XMXA 4PDKA 3KP2A 1ZO0A 1XMKA 2H1LA 4XRMA 3AG4H 1MMDA 1GT0C 1N78A 3DDDA 2Z3YA 3HZJA 3FC3A 2MLGA 3T90A 3CDHA 2OTLI 1LEBA 2MD0A 1TNTA 4MNUA 5TRDA 4AXVA 5HVFA 3CCLI 1H89C 5G20A 3G6EI 1IB1E 2EZHA 5F04A 2DW4A 3BG6A 2X85A 3KASA 3BWGA 2ODDA 1ZGAA 2K9SA 3V7SA 4UCPA 1UCRA 2FSWA 2JPBA 3W6KB 1W0TA 3BR1A 2ATRA 2J8MA 1B8IA 1I12A 3MKWB 1H0ZA 4G6QA 4C2ZA 2XAHA 5L3CA 5H2FC 2KMPA 2E7WA 2EV5A 3L2RA 4CAWA 1X1DA 2RQPA 2HB6A 2E1NA 2B4DA 2H6CA 1MKMA 5KNLA 3REOA 1WGTA 3SI0A 2M5XA 2GA2A 2DT6A 2P6GA 5AG5A 3E59A 3TP0A 2X6WA 4CPAA 1LDKB 4HYEA 4B5PA 1B9MA 1QSMA 2IBDA 4B12A 1TBQR 4XKCA 4OAZA 2CH0A 2RNJA 5EYRA 4A69C 2BOLA 3LSKA 1T33A 1U8RA 2P5VA 4B48A 1FOKA 1HC8A 4KNYA 3WGHA 3HYIA 4AM3A 2IS2A 3L2NA 4OAEA 3K2AA 2JRTA 1GV5A 2OQGA 5H20A 3G73A 4KDPA 1IYKA 4RS8A 2Z3NA 1WJFA 4MHZA 1M4GA 4XRSA 1RKTA 1IXSB 2EFQA 2OBPA 3GX4X 1ZR4A 3IWWA 1FOXA 4NSQA 4YFNF 2B5GB 2QSFX 1MBKA 1EH6A 2OJED 4FTHA 1ACIA 2DIPA 1CJWA 3WGGA 1MW7A 3ERMA 1EH7A 4CCKA 5GAGJ 2XGCA 2DI3A 4KOSA 4HEA2 3D5SC 2ZXHA 3JTHA 2VRWB 3E6MA 3R96A 3QODA 4BXXJ 3E0JB 3TJQA 2LC2A 3ZMZA 1Z05A 5K1YA 3ZN1A 4IJAA 2X1CA 1PJRA 3PP9A 3PFEA 5AG6A 2ZXWH 2KMOA 4UCNA 2ELKA 2DU9A 4GO1A 1MJ9A 1VTNC 1X74A 2Y9ZA 1X4PA 3LSIA 5CPRB 2F4MB 5FGMA 4RS2A 3S3OA 4Y13A 1X3ZB 3VYTB 2UVOA 2Q51A 2LKPA 2CGPA 4AVZA 2KRCA 1P4WA 4PUSA 4C30A 1CPSA 3GZ5A 1MSFC 1KA8A 1ETXA 4B14A 2EPFA 2YNEA 3DPLC 3OL4A 3T8TA 4I02A 2PJBA 2K7LA 3P7NA 4IZZA 3HXLA 3D0SA 4F91B 4I49A 3BLNA 2LSOA 1Y0YA 5LLQA 1YVOA 1OPCA 4XKWA 3C26A 4M3DA 3RZDJ 2Y75A 1BOBA 1ZK8A 3DBRB 4NXYA 3F72A 3HOVJ 2LH9A 2D1HA 4XOTA 1U5KA 1U8BA 2WCYA 4YRHA 3FXRA 1DPUA 3PB6X 2WAQN 5FO5A 4HNVA 3R5DA 4KIGA 2GU2A 3T8WA 3GIUA 1AN1I 4ZYDA 4XMYA 1KU3A 3L2QA 3CESA 3UFFA 1U6GA 3L00A 2V1NA 2YX4A 2Q8KA 4I99C 1Y1BA 2QQEA 1NK2P 1ZGJA 1TKJA 1HJAI 2EUIA 2BY3A 1ZG1A 4WF2A 2EH3A 3V4GA 2KRFA 2VONA 2W84A 3CD6I 4N9IA 2LR8A 5EEAA 5EDNA 4UFWA 4YFKF 2DA3A 2HKXA 4ETSA 3DR6A 3V7RA 4KUMA 2QQAA 2PLYA 2R7XA 5HMNA 5IV0A 4UV8A 2VKDA 3JREA 2JRMA 3A03A 4LFUA 2V7FA 3N7ZA 3ZGKA 3CCQI 1GHEA 2BCOA 3PJRA 1XE4A 2M5WA 5CQEA 5KTAA 3FF3A 3ASNH 4DBQA 1W7PB 3OIOA 5D6EA 5LGUA 3H3UA 5J1YA 1Q9BA 5D5UB 1IUFA 3J7AY 1HCRA 3BG3A 2GE3A 5F08A 2PJ6A 4CGMA 4FBEA 1S60A 1K7AA 1BOAA 4D5CA 2PMZN 1HSJA 2QWWA 3ZQQA 1A6QA 3V38A 4ZDPA 3EPZA 4JCVE 4OIWA 2KIQA 2KIUA 3L1PA 2ZOGA 1Z91A 2FJ1A 4CAEA 4MFQA 1F9NA 5EMIA 2QKLB 2ZW5A 2XEJA 5LRGA 3CZXA 1TUSA 1VQPI 2RC4A 2VC0A 3HBLA 4XLHA 4E7IA 4MCSA 4DGWB 1MT1A 3RKQA 1B59A 2VUMJ 2I5UA 3V8JA 4B6DA 2BVLA 1FIAA 4LX9A 1CM0A 4CAXA 1W7PD 4RAYA 4WCGA 1AU7A 2R7HA 2V9KA 3Q0UA 5F27A 1JKOC 3G8WA 4CYPA 1OKRA 3QP6A 5FB2A 2WY8Q 1Z9CA 3K1MA 4MQ9F 1X12A 1B8IB 2X6OA 4XBFA 4A37A 2HXOA 1YW8A 4BBHA 4PGHA 5F47A 1I39A 4FQGA 5BQTA 1HW1A 1HDLA 4UIBA 2NMTA 3D7GA 1QPMA 3C2HA 3JRBA 3FF5A 4UWIA 1CP7A 1JKPC 2RNGA 3K2ZA 3SXYA 4J01A 2JA8J 1UVFA 3VARA 2DOFA 1LVAA 1L0OC 1QHHD 4QUSA 2TDXA 5ICGA 1C0WA 2FNAA 3BPXA 3P2HA 4PJNA 3ZP5A 1WKMA 1IZ1A 1ETVA 3M9AA 1VQ5I 1WQ2A 2OD5A 1BL0A 1DP3A 2Q0YA 2DA2A 1PCEA 1XGNA 3IH3A 3N05A 3QU3A 3L2WA 3VDUA 4C68A 2R3SA 2LF8A 3IU1A 2DFFA 2R7DA 2LTPA 4UXJA 1Q7LA 2PJ9A 3Q0WA 3FIXA 1UELB 2RQQA 3OMYA 1XS9A 1O4XA 3JRDA 2K9QA 2DJNA 2P0WA 5KHDA 4G1PA 4E6KG 2VQYA 3NARA 5ED4A 2L7ZA 1P4XA 2P7VB 3IL2A 3CXPA 3A1YA 3J80Z 1E3PA 3ECHA 1SGRI 2LREA 2XAQA 2HQNA 3IRRA 3ZMTA 2IVMA 1NH3A 4BBRJ 4KSIA 3K70D 2HZDA 1OCPA 3LMMA 2E1OA 5E3RA 4OP4A 4BJ5C 4RB2C 2OQRA 1XRYA 1IN5A 2O8XA 4ZYGA 2K5TA 3BZCA 3JUWA 2EZKA 1QO0D 3ABKH 2STWA 4K30A 3K69A 4DYRA 2WZNA 2ZW7A 4Y7NJ 2WWYA 3H0GJ 4C2XA 3FEDA 1A36A 3I64A 4GYGA 2DPSA 3FXKA 4W1UA 3NRVA 4WWVA 3X2QH 1YI2I 4HGUA 4LGWA 3E5QA 2W82A 3KP7A 5IT9K 1R57A 2GXBA 1FMWA 4N9HA 2IAIA 2M7BA 4H6UA 4ORFA 5DD8A 3SEKC 1IC8A 2ANPA 5AIQA 4CYCB 4B6ZA 1H8AC 3QYBA 3KEQA 3BQYA 3WU1B 3ISZA 2OC6A 3F21A 1PUAA 2FVGA 5E1XA 2CV1A 2K3PA 4CICA 4UWJA 2DYSH 3HG9A 2WSAA 3WC5A 5G21A 4M3FA 2K85A 4DYOA 2DODA 2VEZA 4MY0A 4D7NA 1SD6A 3E3VA 2FMLA 1M4DA 1BIBA 1TWAJ 1T08B 4FE4A 1SC7A 1KZFA 2YNDA 2QPOA 5EF6A 2E2HJ 1X2NA 2WY7Q 1PCAA 4JZ0A 6PAXA 4I0AA 4JYWA 2BVMA 3RQ4A 3SI1A 1P6RA 3H36A 5EX0A 3HIFA 3BY6A 2K9HA 3IGRA 5EJCA 2ME0A 2R7SA 3EUHC 1SGEI 3HPGA 2MD5A 2G9DA 4UXHA 4X0GA 2SGFI 1EH8A 1HEVA 2DTZA 2F5DA 4ZYEA 4ZZDA 1VHOA 1IIDA 1TT5B 2HC9A 1H9TA 2NNYA 2I00A 2X51A 1S20A 3HL2A 3KZIC 3UGDA 2DOEA 2EVNA 2X6YA 3PSFA 1O3SA 4KORA 4B5PB 1Y1WJ 1YIJI 3D5LA 2KT0A 3ZQGA 2RAEA 2GKRI 2Z2SB 2HVQA 2DFHA 2DPUA 1D1AA 4IF5A 2HNHA 1E3HA 2V9VA 2P6EA 5DDGA 3GTLJ 1SFKA 1X3WB 3BTCA 5CVJA 2CQNA 4IKFA 2PJ1A 3G3SA 5FLXK 4NC6A 5H6RA 4BEHA 3PQKA 2Y48A 4J00A 4NQWB 4A3FJ 2NRAC 4C9YA 1RFHA 4AYBA 3KZZA 3CO6C 1S7AA 5DUIA 1K4TA 3GTMJ 1XDSA 2C1CA 5I0CA 2Z10A 1BPMA 1FT9A 3J81Z 3QPLA 1PUFA 2NYQA 3LD2A 1XPXA 1R6RA 4OC0A 3G2BA 4GYIA 3I71A 4JX5A
chains in the Genus database with same CATH topology
2G9WA 5ILVA 4UVAA 4IHTA 2ZXJA 4BXUA 4PV6A 1J9IA 2P8TA 3VWEA 1R1TA 4CZZA 1O7FA 1TQIA 2CXAA 2DBBA 3DF8A 4QBJA 4I7HA 4A0YA 4U7DA 4OU0A 5K5QA 3R6SA 2HKOA 4JK1X 1I1SA 2P4WA 1IUYA 1Z6RA 5FFXA 1F5TA 1B6BA 1RI7A 4UHTA 1T6SA 4UCMA 4CYQA 2A69F 5EEGA 4RB3C 3JW4A 4ENKA 3R9FA 3WTSC 4YIFA 1XGMA 4FT8A 4KUBA 4HZFA 3T5XA 5L3EA 1KQ9A 5BPIA 1M44A 3D8PA 3DNSA 2QYOA 3VB2A 3RYRA 2RV8A 5K5OA 3ZZIA 3V8IA 4QLCU 2VT2A 1T2KA 1PU9A 1ZG5A 4II9A 5F49A 1UFHA 3HRUA 1FP2A 4OMYA 2I79A 2MLKA 4R87A 2F2EA 2GWRA 5CVIA 5E18F 4IPAA 1K78B 4IUSA 3FHZA 2JDDA 3WODF 5H84A 2M1BA 2JSCA 2WTEA 4AB7A 2B3UA 3F23A 4IHSA 4KS9A 4FX4A 1DUXC 3S6HA 3FZVA 4R9MA 2ZW6A 1IYLA 4HKFA 3SXOA 3ZJ0A 5JI6A 1YS7A 1RIOH 5J8CA 4ESBA 1FBQA 1YVKA 2PQ8A 1T38A 2VI7A 1BO4A 3H3ZA 3CXSA 4G94A 3GW2A 3I4PA 2DK5A 3V8LA 4AVCA 1DDNA 5CJ9A 2FE7A 3MAJA 5E20A 5J6XA 3J80K 3U2RA 2LNBA 4A5NA 3IHUA 3GKRA 3EUHA 5HH1A 2VOPA 3BDDA 4J3GA 3ML6A 1FYMA 1SAXA 1Q2DA 4CS0B 4NCZA 3D2MA 4UFVA 3GO5A 5KTDA 4UFXA 1RO5A 4KYWA 2YU3A 3E0KA 3HTUA 1R22A 5KVRA 4UXNA 1ZAOA 4HV6A 1JHHA 5LHHA 3LQQA 2RGVA 5IT3A 3M1EA 3L09A 2Z3OA 2O03A 3GVAA 3I59B 5HS9A 4L89A 4NHJA 3HHHA 4ENNA 2MBFA 1S7LA 2Z0ZA 5DYMA 4G7HF 2QVOA 1T0FA 2DFIA 5A27A 1H0MA 3F5BA 3IWGA 1YLFA 4LB6B 5HLIA 4G9YA 1G4DA 3RDIA 4MBUA 2A61A 3SHPA 2OAZA 1NSLA 3F8MA 1W5SA 1SFXA 1FBUA 4EGYA 1ZRFA 2IJLA 1V4RA 4UBRA 3CUQB 5DD4A 1HQCA 3K1PA 2X4HA 2VBZA 3T0YA 4BHBA 1KYZA 1HW5A 2Q44A 1K6OA 3KP6A 3BJ7A