1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 PROTEIN
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
4AVBA 3BPVA 2JDCA 2JTVA 4JXQA 1IUYA 3P2FA 2O61A 2J8NA 3RDIA 1IW7F 4PK3A 4RS2A 2G9WA 3ML6A 5F1RA 3IWGA 1ZAOA 3MZHA 2A61A 3M8EA 2ZPAA 3T9YA 5E18F 4PCQA 2RN7A 1XSDA 5FLXK 2PG4A 2DPDA 1T98A 2J5PA 2ELHA 1Z4EA 3JUWA 3VEPA 3SFZA 4S04A 1I21A 3AAFA 3KP3A 1YW8A 1QNTA 2EK5A 1R00A 4ZZLA 5LRRA 2Q0YA 4KIGA 4D0PA 3HIFA 4HAMA 5IB0A 1Q2CA 4B5PB 4A5NA 3IHUA 2RGVA 1YW7A 5LEKA 3EXNA 3GYHX 1J5YA 1YS6A 2YX4A 4M74A 1G3TA 1I12A 3K0LA 1R1UA 2F5FA 1XDUA 3T90A 1BI3A 3U1DA 5HDKA 3F8FA 2FCKA 4KN7X 1Y9KA 5DV5A 1NHAA 1R22A 1Z05A 3P9KA 1P6RA 1LJ9A 5JPHA 1YLEA 2G7HA 1K79A 3ZMVA 2VEZA 4JLYA 1MDMA 1JGSA 4M73A 3D3SA 1LDDA 4JQFA 1D3YA 4PSWA 4WXDA 4ZH4F 4JD6A 2VZYA 3S6FA 4XPDB 3KP7A 4LUAA 5DYMA 2OBPA 4XLPF 2REFA 2FQ3A 3GFJA 4Y15A 4EV0A 2HS5A 3I3GA 3MAJA 3HYIA 1KGSA 4CZZA 2DK5A 1MKMA 4O5VA 4MNUA 5F46A 3EO4A 2PEXA 3G3ZA 3SQNA 5HMNA 1ZGAA 2KJCA 1W7PD 2QQ9A 3TOAA 2FL4A 3RI4A 4GYIA 3EY5A 1LRZA 2DT5A 4IPAA 2HZTA 2HGCA 3GFMA 4LG0A 3FB3A 2M45A 4CRZB 1ONVA 1JHFA 3D2PA 2ETHA 2OZHA 4QVTA 1LVAA 2V79A 4YFNF 5LHIA 4HDVA 4OINF 3WGIA 2XAJA 1V4RA 3FXUA 1XIXA 4OU0A 2D45A 1ODDA 1VKCA 1G3WA 1LEAA 4NQWA 3IWZA 2VQYA 1KYZA 3TO7A 3C18A 4ZYEA 5H6QA 2W85A 2DW4A 4RGXA 2IA1A 1H0MA 1G6NA 4LFUA 2KIFA 2OU2A 4XNHC 1ZRCA 1QSMA 1SAXA 1Z7UA 1J7KA 4EM2A 1IRFA 2GE3A 1BC7C 3HRSA 4R9MA 3WR7A 3BROA 1VHSA 5HS8A 1FYMA 3CO7C 3ZPLA 5ED4A 3KZYA 2FIAA 1KQ0A 4G6DA 1GXPA 1WKMA 5ICEA 2VZZA 3I9SA 2HR3A 3HHHA 1MGTA 3PFIA 2Z99A 3T0YA 1O3RA 2PR1A 4HX4A 1ZN2A 3DQVC 5H6RA 4XBFA 2BE5F 2HUZA 4UHTA 3CDHA 1PUEE 5IV0A 3I58A 4OIQF 4H0EA 4B5PA 3PP9A 2DPUA 3QRFF 2E7XA 5DCFA 2OH1A 2CNSA 3V7CA 3GW2A 4WWCA 1PDNC 1QGPA 1ULYA 1QBJA 1V3FA 1UCRA 3P7NA 3TO6A 5DD8A 4E0AA 2L01A 1U6GA 2HWVA 1L0CA 2H27A 2W57A 1IB1E 3GKRA 5HVQC 3TT2A 1ON1A 1KU2A 2REEA 2KIUA 3HSEA 4NXYA 5FGMA 3SXOA 3FZVA 1Z9UA 3QPHA 2D4PA 4KUBA 3CUQC 2J5OA 2A69F 3M1EA 1KQ8A 4JK1X 1GVJA 2BBYA 4OOIA 1KU7A 4HBLA 4O3MA 3CUQB 4HX8A 1IN5A 3GF2A 1XCVA 2ZCWA 3HOTA 4XRFA 1HBXG 1J4JA 2Q4YA 3WG9A 3PQJA 2HKOA 3FF5A 4UV8A 1FP2A 1IN7A 3E6MA 1CM0A 3K9TA 4ZYHA 4FD5A 4MJ8A 1M4IA 1TIQA 2EV6A 3CLOA 5AIPA 2HYFA 4HNWB 3BPXA 2OZGA 1J75A 1RO5A 2FA5A 2OQRA 3GZ6A 3FIXA 4L5IA 2QLZA 5D4RA 4R3KA 1TW3A 1S7LA 3VODA 1DDNA 2BEIA 2WPXA 4XSZF 3WE3A 1YX0A 3WTSC 1JHHA 4QUSA 4GS4A 5BOXA 5D5WB 2ATRA 3I0TA 4H6UA 1T39A 1FSEA 2GWRA 5CVIA 2ARHA 3V8JA 1RXTA 2OAZA 1XB4A 4AIKA 3TTHA 4PZJA 1Q2YA 4KN4X 5IT3A 3QU3A 1KUVA 1CF7B 3NEUA 2EFWA 4ETSA 1U5TB 1F1ZA 3KE2A 4UVCA 2NMTA 1RI7A 3D8PA 5AONA 2FT0A 3PGPA 1QSRA 2M5WA 4KOUA 5I0CA 4EM1A 2VONA 1DP7P 2EV0A 4CAWA 4IRIA 4XPKA 1PP8F 2QYOA 4OIPF 2ISZA 1QSTA 1YGHA 1KYWA 1IXCA 2L54A 4B09A 2QMLA 2D2WA 2M1BA 5J6XA 4WF2A 5HDGA 2XHKA 2K4BA 3DNSA 4IXAA 1QPMA 5A2QK 4PV6A 1STZA 2IW5A 2QWWA 2ZNYA 5F64A 3E6BA 2QQBA 3KKWA 4BXUA 5LLQA 4U88A 3GO5A 2AJ6A 4Y17A 3D0SA 2G3TA 2QQAA 3BDDA 2O8XA 1TLHB 1IIDA 2EFPA 2ZJ2A 4MHGA 2PI0A 3P2HA 3SHPA 1YFHA 1UFHA 3HHGA 3LODA 2V6CA 3QP5A 4P9FA 3HRMA 2H5MA 4L89A 3CUQA 1Z6TA 2XROA 1YIOA 2NS0A 2CSOA 4CAVA 3K1MA 1YG2A 5LHHA 2O6GE 4U0YA 3IRQA 1I6XA 1FZPB 1QZYA 3R6SA 5D5UB 1XGOA 1W5SA 4HF2A 3EQLF 4LLNA 3EUHA 2ZMEB 3GX4X 1P0HA 2JLMA 5KK1A 1R58A 1FYKA 2XRNA 1Z6RA 3L00A 4LLGF 5ERIA 4M72A 4AVPA 1OR7A 1YVKA 3LAJA 4KORA 4RI1A 3FXTA 2D1HA 3CXPA 1IN8A 1SMYF 3J80K 4FD6A 4Q47A 2CFXA 2G0BA 5E1ZB 1YK3A 3OV8A 3OOPA 4RB0A 4UUVA 2MBFA 2L4AA 3ECHA 3I54A 2FMLA 2IRFG 1P92A 1FX7A 4MEYF 3JVNA 3EYYA 2VBQA 4R87A 3SZTA 4EJTA 3T8TA 2Q8KA 5K5RA 4E2AA 1IF1A 1R7JA 3JAMK 1XSXA 2XAFA 4MBUA 3J81Z 2XAQA 3PZJA 4MY3A 4LX9A 4FD7A 4NEXA 2VC1A 2A68F 5CVUA 1XGNA 2WPWA 4U7BA 2F2EA 1EH8A 2VXKA 1CF7A 3VB2A 1TQPA 1U5TA 4HNYB 2A6EF 5BMZA 4F0YA 1SD5A 2XV4S 4GGGA 1P4AA 5EBVA 4U0VA 4I2OA 4PSXA 3I64A 4J3GA 3Q9VA 4I09A 4G7OF 1MZBA 1I5ZA 2YR2A 4AG7A 2KIMA 2ZO4A 1WRJA 5JHUA 4QC6A 5KTAA 1BN5A 4A6DA 2LDUA 3BJOA 4Q5SF 3G8WA 1SFUA 3O6BB 3VWEA 4HLYA 4M6YA 2XUBA 4IHTA 3HOSA 2WV0A 2QECA 1E2XA 4KLWA 1KUYA 1OMIA 3DKWA 3RKWA 1O3TA 1XD7A 1BI0A 4EJOA 3F6OA 2Z9OA 4IF4A 4HF1A 4OIRF 1M4DA 3T1BA 4L18B 2WC2A 3ZMTA 4ASNA 5BPDA 2FBHA 1Z91A 5FO5A 1G3SA 1QO0D 2JPCA 4KOYA 4GO1A 2ACJA 3F8KA 4QBJA 1P2FA 4L9JA 2P5KA 4P5OA 2GA2A 3WGHA 5IX3A 3GUDA 2Q7BA 3BJAA 2VBZA 1JXSA 3ZMZA 1B1BA 1OZPA 1KA8A 2ZMEA 1MK4A 5DWMA 2V9VA 4L9VA 4U9ZA 2LF7A 2QZ8A 4R79A 2Q2EA 2CNTA 1HSTA 2COMA 4NHJA 4G8XA 1IXSB 4LD5A 3N4MA 1HKQA 3R96A 1RUOA 2DAOA 2FXAA 1HKTA 3W6KB 4XPDC 4M6XA 1VTNC 2R7HA 2XASA 3B73A 3PQKA 5JR3A 1SD6A 3FHZA 1IYLA 2EV5A 4WXCA 3EC4A 2PFBA 4QLCU 2BL1A 1FBQA 3COAC 2Y0MA 2FU4A 3V4GA 3W6JB 1V0CA 3U9GA 4A12A 5TRDA 3FBUA 2CWEA 3U2RA 1HW2A 3DXJF 1ZARA 5FFZA 4MI4A 4NCZA 1BO4A 3FMRA 2K86A 5CJ9A 5E8IA 1HQCA 2JZYA 1FC3A 4RB1A 3E0KA 1HW5A 2Y75A 1XMAA 2F5CA 2GZWA 1LQ1A 1BIBA 1F9NA 2OQGA 4P55A 2HV2A 4N9IA 3HRTA 3FWEA 1T6SA 3M7GA 4FX0A 2P8TA 4F7ZA 1N71A 3KCCA 1B9MA 4M9XA 4QWQA 4HLXA 1O57A 4UWIA 3TFYA 1H9GA 3DSBA 2DU9A 5CVRA 2FIWA 1M1DA 1M4GA 3F6VA 2DBBA 2G7UA 1Q2DA 2FNAA 3KEOA 4AG9A 3K1PA 1YO5C 4EVIA 1W7PB 1FOKA 1I27A 3GFLA 2IP2A 4RB2C 3LQRA 1ZYRF 4AD9A 2MLGA 3B02A 1IICA 2M30A 4YGOA 4UA3A 2ZW5A 2FF4A 1DPRA 1OYWA 5CNPA 3ISPA 3KLNA 2XKPA 5L3DA 3V7SA 3I59B 2RDPA 3FNCA 4PGHA 1BOAA 5LGNA 3C26A 2JT1A 3VOEA 3WTYC 2I79A 4HX7A 3MWMA 2PQ8A 2R8VA 1I1DA 5E17F 2VOOA 5E8GA 3K1NA 1R23A 1BBYA 2EJRA 4OMYA 3ZQ7A 2NYXA 5FD6A 2PN6A 1MJAA 1XE4A 3IGRA 1O3SA 2V1XA 3TDZC 4MTDA 4OMZA 1R5HA 3JW4A 1FBUA 4ENNA 3FXRA 1MJ9A 3FX3A 3F8CA 2VN2A 1HW1A 3TO9A 4YIFA 4IRGA 1K7AA 4KVXA 4FX4A 3RYPA 2DQLA 1LB2A 2EVNA 2K4JA 2OZUA 2HDCA 4K2EA 1Z4RA 4AWXB 1WWZA 4EVYA 3R61A 3LWFA 2X4HA 4M85A 3FM3A 4HOBA 2VBXA 3M9AA 3IKVA 1SFEA 5D4SA 4UVAA 2ZNZA 5DCMB 3IC7A 1GHCA 2YPRA 4KLVA 5EC4A 1L3LA 1Z9CA 2C27A 2R1IA 4MHDA 2FBIA 4GCVA 3KP5A 3KP4A 3JSPA 4U5YA 5C88A 1XEBA 1BIAA 5E1XA 4UNOA 5F49A 2A3SA 3LSTA 5D6FA 4GYGA 2ZW4A 4EJWA 1TQMA 1TTYA 3CTAA 3F22A 3TCVA 4HZFA 3TQNA 3FMQA 3C7JA 5D6EA 4RAYA 1G3YA 5CYVA 5HS9A 4AVCA 1S6LA 2EB7A 4CXFA 3LA3A 2PR8A 3WU0A 2CG4A 5L3GA 5FLXZ 4R57A 2BUEA 3DDDA 3BWGA 1M44A 3REOA 4MY0A 1C0WA 2Z5UA 2ZKZA 1W7PA 4N0BA 4RGUA 4LB6B 2VT3A 1S7KA 4BQAA 2P5LC 3BOQA 4IUSA 2EA2A 3UY5A 4WK8F 5L3CA 1USTA 4KZTA 4KOSA 4L8AA 3I59A 2DQRA 2FOKA 1TNTA 3P9CA 2DLLA 3F72A 2B4DB 2AXLA 4I0BA 1U5TC 2OA4A 1LNWA 2WTEA 3ZMUA 1ON0A 3TKYA 5F47A 2Z10A 2GANA 1R36A 2RKHA 4OIOF 5TJJA 1B6BA 1SD4A 2TDXA 3RPUA 2P6GA 4MQVA 4KIBA 1EH7A 4NB5A 2PBIA 4BYYA 4PGGA 1T2KA 2H6CA 1R1VA 5C82A 2P6TA 4A0ZA 3DR8A 1Q1HA 2CQKA 1ZG3A 5K5OA 3R9FA 5JQ4A 4IHSA 4Z2YA 1L0OC 4DNCA 1J59A 2F5IA 2B5GB 2JDDA 1YW9A 3ROUA 1QSNA 2VC0A 1MD0A 4LK1F 1F5TA 2FEZA 3BJ6A 1XMKA 1PU9A 3QP6A 1H9TA 3WTTC 3R95A 1XSVA 1Y0UA 2CYYA 2O0YA 2JSCA 3K69A 1ZG1A 4EM0B 5H20A 1P4NA 4HA8A 3GZ5A 3I71A 1FPQA 1AOYA 2O3FA 1UFMA 2HKXA 1TQIA 2ZFWA 1Y9WA 2O28A 2O03A 1PUAA 4U9YA 2WWYA 1E17A 4UBRA 2VE9A 2VOPA 1R57A 3GVAA 4KUAA 1QZZA 3BJ8A 4XPLA 1DPUA 4KVOE 4F6AA 4MTEA 3G3SA 2STTA 5H84A 2PLYA 3LD2A 4HNXB 2HTJA 1YTYA 3FYNA 5J8CA 3C3WA 4I49A 5LHGA 2XAGA 1EH6A 1U8RA 3Q5FA 4Y49B 3CUOA 3E5QA 4S05A 4KFCA 1BI2A 2H6BA 3MCZA 4O6JA 3DR6A 4N9HA 3F21A 3L2CA 1IXRC 3EYIA 2PMHA 4HYEA 5LGUA 5CLSA 1FP1D 3ZN0A 3R1KA 4B5OA 2RQPA 3CJNA 2MH2A 3H3ZA 2EFOA 1CGPA 2H94A 3O3KA 3QPTA 2AS5F 4JWPA 3E97A 1W4MA 4EGZA 4UV9A 2MH9A 1SD7A 2RNJA 1R5GA 2B3VA 2Y48A 3Q9SA 2Q4VA 4ENKA 4A0XA 2DTRA 5HS7A 3R4KA 3DPTA 3TDUC 2R7FA 4Q48A 3KETA 2B58A 4M71A 4E70A 4KOXA 2B4DA 2Z0ZA 1T38A 5AIQA 3ABTA 5E20A 1BI1A 3HTSB 2M8EA 1Y7RA 5IT9Z 2LKPA 5K5QA 1W5TA 1SQHA 4ENJA 2QIRA 5CVVA 4DQ2A 5H86A 1XN7A 5KVRA 2P6SA 2HOEA 4A0YA 3HSFA 5D5XB 1S7NA 6PAXA 3S6HA 3TOBA 4XLNF 1KQ9A 4ON0A 3IL2A 4G94A 1XDSA 4YFXF 3LFKA 4EGYA 3HRUA 4LG0B 2B5GA 3LA7A 1A04A 5JI6A 3D5LA 2Q0OA 4BH9A 3ZP5A 1QSOA 4P96A 4CHUA 1XGMA 2ESHA 3KZZA 3EFAA 3KP2A 2UWMA 2IA0A 3GWZA 1ZGJA 2IA2A 3K2ZA 2YX7A 4I02A 5CVJA 2LF8A 2HEOA 3QAHA 3QOPA 4IRHA 3TE4A 1Z1DA 3KEQA 5BQTA 1UHWA 2HTSA 1TBXA 1RZ4A 3ZJ0A 2ZXJA 1HKSA 1S29A 5ICCA 3RPQA 4B8XA 5BS6A 3F23A 2CNMA 3MQ0A 1X3UA 3H4QA 4WXHA 4E8OA 1HXDA 3WTWC 3H92A 5L3BA 1S60A 4HDUA 4KYWA 1GHEA 1G4DA 1BJAA 1O3QA 2ISYA 1J9IA 1IAWA 1U6MA 2F5EA 3RKXA 1TW2A 2PJPA 3O2PE 4KOWA 1B6AA 2FMYA 2OD5A 1ZLKA 5L3FA 3WE2A 3MGDA 4CAXA 5LRSA 2STWA 3OWCA 1FY7A 3ULQB 2FSWA 4X5KA 2D4OA 1U78A 3V8LA 4M9SA 3KP6A 3WTVC 3KLOA 2GXGA 2EFQA 1IZ1A 3P9IA 1I1SA 5EEHA 1O7FA 4LK0F 2VBWA 3I4PA 5FVJA 4U0WA 2IT0A 2P5VA 5D8LB 4ZBGA 2VODA 5LEJA 2IVMA 1FYLA 3BLNA 1DUXC 4UXNA 1D8KA 3DP7A 2FS5A 2I00A 2EA4A 4L5JA 5A2QZ 5BPIA 1S7OA 5ILSA 2Z33A 4BAYA 2P6EA 4RS8A 4NF1A 2XKOA 3GXOA 2XIGA 2EWNA 5HOOA 1K78B 3ZZIA 3L7WA 4UWJA 1J0RA 1IN4A 4KDPA 5KTDA 2M87A 1S7FA 3RKYA 2XGXA 4AVAA 4RGSA 4CS0B 2ZW6A 1AWCA 3S6KA 3ZMSA 2P7CB 3HSRA 2D1VA 4KT5C 3LAPA 5D5VB 1PP7U 3ZMDA 2IJLA 1U3EM 4HW0A 3R9GA 4EJUA 1RIOH 4CDGA 4M9ZA 2QM3A 5ILVA 3E5XA 1XMTA 2KRFA 2HYGD 1I1GA 2OZ6A 4Q4ZF 1K6OA 2KKOA 2LSOA 4KOVA 4FHTA 2PMUA 5F48A 5E1WA 5FB2A 3DEUA 1FSHA 3F8NA 3ELKA 1OKRA 3N97A 4H6ZA 4G9YA 3NQOA 2LNBA 3FXQA 2GQQA 4LMYA 5J8FA 4KA4A 3BJ7A 4ZYGA 1D8JA 3K9UA 4OAEA 4RAZA 4EJVA 2R98A 3J80Z 2UXNA 2FXFA 3V8IA 3R60A 3BZ6A 1WI9A 1LEBA 1NSLA 3CXQA 3F5BA 3MFKA 2ADUA 3TGNA 1XF8A 2J8RA 4G7ZF 3SXYA 2HFHA 2GIVA 1B4AA 3DPLC 4G6QA 5D8KB 3QB8A 2EUIA 2FE3A 4XNHB 3V7RA 1RNLA 2FSRA 1F4KA 4IF5A 3JSOA 1LDKB 1S8NA 3JAMZ 4BNCA 4EMSA 3ERED 1USSA 2L02A 2Z3YA 4CO8A 3RYOA 1WK4A 4I01A 1T0FA 4MGRA 3GLXA 3LQQA 1ON2A 3EDPA 3W91A 4KIFA 4L0ZB 5JVTA 2BV6A 4IVNA 2JRTA 3BP8A 4I0AA 4CICA 4JJXA 3D2MA 2BSWA 3VFZA 4TV7A 1SMTA 2PSWA 1S7AA 2A5YB 4PK2A 1ZRDA 4KMFA 3ECOA 3NE7A 1FBSA 1YQAA 2MC3A 1YVOA 4FT8A 1ZLJA 4QB9A 3F8BA 2GA1A 2UZKA 4FD4A 5ICGA 2QUFA 5HLIA 2Q44A 2E7WA 1B87A 3J81K 3HUGA 3N7ZA 2IL4A 1RUNA 4OLLA 5HLHA 2FBKA 2V1DA 1ZRFA 3GYAA 4G7HF 2PC1A 2V1UA 3WU1B 5IT9K 1FWZA 4OADA 4YRHA 3VWDA 1LDJA 2B3UA 4HF0A 3CXSA 2PDOA 4RB3C 1WQ2A 1K78A 4YIIA 4A2UA 2P7VB 3SZPA 2XAHA 1BM9A 1UHMA 4ZZDA 5K1YA 1IYKA 1YREA 1OYIA 1O7LA 5FD5A 2P6FA 3M8FA 5ILUA 4KMUX 4U7DA 5GCNA 2QBYB 3DFGA 4BHCA 2CO5A 3BY6A 1FT9A 3W6SA 4BMHA 3LA2A 1OYYA 3F8MA 3FM5A 5DUKA 1R1TA 5DDGA 4JBAA 5L3EA 2IPQX 4A6EA 4GXOA 4I98B 1NE9A 3HTUA 4RGRA 2DO7A 4A5MA 2NNNA 4JXRA 2J8MA 3WODF 3G73A 4BHPA 3B8GA 1REPC 3ABUA 1BOBA 1WWXA 2P0WA 1KU3A 3NRVA 2PRBA 4R8HA 3RYRA 1KU9A 4KICA 3CO6C 2YU3A 2KJBA 2DXQA 4KOTA 2H09A 3KFWX 2RC4A 2CW0F 3V8KA 2CY2A 1TNSA 1ZG5A 3W6XA 2UXXA 4I7HA 2OB0A 2KCWA 4ONUA 2RV8A 2Q04A 2JEVA 4L0YB 2GXBA 1IRGA 1KZFA 3FRMA 4HQEA 1FLIA 3RJPA 1YS7A 2ZXVA 5KTCA 1YLFA 3F0AA 2A6HF 2R3SA 3IRRA 3S6GA 3ZN1A 2EFNA 4CYDA 4NSQA 4AIJA 2FE7A 4ORFA 4R1HA 4EQQA 3WGGA 4UVBA 2E1NA 1GXQA 5HLGA 1ZREA 2DI3A 5DWNA 3J7AO 2K7LA 2ESNA 5DUIA 2MD5A 2X7BA 3R0JA 2Z11A 3DF8A 5DCMA 2HQNA 2DFIA 4WX9A 4HKFA 4MQ9F 1JE8A 1OPCA 2W24A 1K4JA 4II9A 1YYVA 2NRAC 5HH1A 3SXNA 2FNPA 3WTUC 4H89A 1ZHFA 5ISVA 3IKTA 1HSJA 2QENA 1U2WA 3L09A 4Y49C 3JTHA 4HV5A 1D5VA 3RTRA 4KUMA 2ZBKA 2A4NA 1SFXA 2BGCA 2CGPA 2VXZA 2MLKA 2VE8A 2HQRA 2FRHA 1S5KA 4HQMA 4L9TA 3RIRA 3GEZA 2QBYA 3R9EA 5DEQA 4K30A 4ESJA 2A07F 3DV8A 3H3UA 4ENMA 3QU6A 3C1DA 1XGSA 1ZH5A 2L3DA 4CRYB 1UB9A 2K27A 4YFJA 2MA3A 3E3VA 3EETA 4YFKF 3JTGA 3IWFA 4R3LA 2QVOA 3E5UA 4PDKA 2XVCA 1IN6A 2VT2A 1B9NA 1MJBA 2BEOA 5HDNA 1P4XA 4KNYA 1MDMB 1NMTA 3E6CC 2G3AA 2C6YA 1YR0A 3SHFA 1QQIA 4YG2F 2P4WA 3WTXC 1XCBA 5E96A 1FNNA 4WCGA 3GFIA 1S3JA 2YSRA 4XSXF 2AE6A 3I5UA 2DK8A 2BYVE 1EV7A 3F3XA 1CJWA 4HV6A 4ESBA 5LGTA 2X0LA 3S2WA 2F5DA 4L9NA 4IJAA 4AIHA 3MEXA 4LGWA 3GY9A 4LLLA 4LB5A 1WSUA 4MEXF 3I53A 1B59A 2ZW7A 5JFRA 2NAZA 2L4MA 3L9FA 5F6FA 2W25A 1BC8C 4ZYDA 2B0LA 3WTZA 5FFXA 3E6DA 1J2XA 3T5XA 4Y13A 2K02A 4P9UA 2K5TA 2VI7A 3T8RA 2VBYA 5DD4A 4BHBA 1S3ZA 1KUXA 2JPBA 2B4BA 4AB7A 2GAUA 5LBQA 4KVME 2W84A 5ICFA 4ESFA 3FMSA 3R0AA 1P4WA 4LJZF 2RVCA 4CGZA 2HQYA 4M3SA 2NNYA 5EEGA 2E1CA 3MZYA 2R7DA
chains in the Genus database with same CATH superfamily
4AVBA 2LUYA 3BPVA 1FARA 4RLQA 2JDCA 1K61A 4R76A 2HVQA 2JTVA 1IUYA 3I55I 1IW4A 3P2FA 2O61A 4JXQA 5AG4A 2HI3A 2J8NA 3PM1A 5EEAA 3RDIA 1IW7F 4PK3A 4RS2A 3S93A 5E3RA 2GIZA 2G9WA 3ML6A 2VL8A 5F1RA 3IWGA 1ZAOA 3IEHA 3MZHA 2A61A 1SVLA 1V5EA 2DYRH 4E1RA 3GB0A 3M8EA 4LIVA 2EK9A 2ZPAA 3T9YA 5E18F 4PCQA 2RN7A 3ZRGA 1XSDA 5FLXK 2XEFA 2O53A 2PG4A 2DPDA 1T98A 1CPXA 2J5PA 2ELHA 1Z4EA 3JUWA 1ZELA 3VEPA 3SFZA 1FMVA 4S04A 4E7JA 3AAFA 3KP3A 1YW8A 1I21A 1QNTA 2EK5A 4MLOA 1R00A 1SC7A 2ORWA 3BR3A 4ZZLA 5LRRA 2Q0YA 2IGOA 4KIGA 4D0PA 2MD0A 3HIFA 4HAMA 2RNGA 3KYCB 2ICWG 5IB0A 1Q2CA 4B5PB 4ZDLA 4A5NA 3WC5A 3IHUA 1BUSA 3PSFA 4KITB 2X1CA 4BQQA 2RGVA 1YW7A 3TP3A 5LEKA 4DZJA 3EXNA 4P4JA 1MSEC 3ZQCA 3GYHX 1J5YA 1YS6A 3BI0A 2YX4A 4M74A 2Q4ZA 4L9MA 1G3TA 1I12A 3K0LA 1R1UA 2F5FA 4NGQA 1XDUA 4M3DA 1FJLA 3NFZA 2BY0A 3T90A 1BI3A 1UELB 3U1DA 3F8FA 5HDKA 3PIOF 4X6AJ 4KN7X 1DTDA 2AFZA 1Z2IA 2EO8A 2FCKA 5AG7A 1Y9KA 5DV5A 2VJ5A 1NHAA 2CFOA 4XRSG 1CP6A 2IS6A 2EIMH 3CQZJ 3GTKJ 1HJAI 4CPAA 1R22A 1Z05A 3P9KA 1P6RA 4BL0B 1LJ9A 5GAEJ 5JPHA 1YLEA 2G7HA 1K79A 2HVRA 3ZMVA 4JX5A 4ABZA 4IHVA 4BQOA 4P4IA 2VEZA 4BEHB 2PIYA 1X2NA 5FKKA 4JLYA 1TWHJ 1MDMA 2W82A 1PJUA 1JGSA 2LR8A 2YUSA 4M73A 5GADJ 3D3SA 1V5FA 1PPFI 1LDDA 4JQFA 1D3YA 2DT6A 4M6VA 4PSWA 4WXDA 3JR9A 2EPFA 4ZH4F 4JD6A 2VZYA 3S6FA 4XPDB 3KP7A 4LUAA 5DYMA 2OBPA 4XLPF 3BXMA 3PIPF 4PJNA 1QU3A 2FQ3A 2RAEA 3FKIJ 2REFA 4HRIA 3KIOA 3I4NJ 2EWBA 5K7HA 3GFJA 3KL9A 3I9V2 2O8KA 4Y15A 4EV0A 4F9VA 2ELKA 2DPTA 2RREA 4R6TA 2HS5A 3I3GA 3MAJA 1QVUA 3A4CA 3E7LA 3HYIA 3K2KA 1NXUA 1KGSA 2Y31A 2DK5A 4CZZA 2ZEGA 1MKMA 4O5VA 4MNUA 5F46A 4ZX8A 1Z67A 3MKYB 4PXEA 2KIQA 3EO4A 2PEXA 3S8PA 1R3NA 3G3ZA 1RR7A 5EX0A 3SQNA 5HMNA 1QHGA 1ZGAA 3LMSA 2KJCA 2PJ7A 1W7PD 3PRTA 2QQ9A 2EZIA 4NNJA 2QCOA 2DA7A 2CW7A 3TOAA 1BPMA 2KT0A 3HEFA 4IHWA 3FJUA 2FL4A 3RI4A 4GYIA 2CWHA 2NVYJ 3EY5A 2E73A 2ZC2A 1LRZA 2DT5A 1A31A 2KISA 1WFXA 4IPAA 3UNGC 2HZTA 2HGCA 3GFMA 4LG0A 1B72A 2MYSA 4JCVE 2PIZA 3FB3A 3KQXA 2M45A 1D1CA 1F2PA 4CRZB 4QTRA 1ONVA 2HQAA 2IQ6A 4OC5A 4II2A 2V6EA 1JHFA 2O5RA 3D2PA 2ETHA 2LOOA 2OZHA 2F4OB 2XRCA 4QVTA 1LR8A 1LVAA 2V79A 4YFNF 5LHIA 4HDVA 3S17J 4OINF 4XRSA 3WGIA 2XAJA 1I3AA 2W7NA 2CV2A 1V4RA 3FXUA 1WKXA 5GTIC 3FSYA 1GVDA 5EGOB 1XIXA 2NS7A 4OU0A 1OVOA 2FJ1A 1Z3XA 2D45A 2CTCA 1ODDA 1VKCA 2BOLA 1G3WA 4CYNA 2IJZA 1LEAA 4NQWA 4L5EA 3G6EI 1WJ5A 3IWZA 2VQYA 1KYZA 3TO7A 3CMMA 3I4MJ 3C18A 4ZYEA 1FOWA 3RPUD 2DMTA 5H6QA 1TOTA 5CKTA 1HDLA 2W85A 2DW4A 4RGXA 2IA1A 4A32A 2LH9A 3ASNH 4DW6A 3WC7A 1H0MA 1G6NA 2JXDA 2X1DA 4LFUA 2KIFA 2OU2A 4XNHC 3CJTB 2ID6A 2EZKA 3U21A 3C2GA 4NUBA 1EJ9A 1ZRCA 1SAXA 3W2AA 2R92J 1QSMA 1UWYA 1AHDP 1Z7UA 2JW6A 4UCMA 3UFFA 1J7KA 3MEKA 4EM2A 2CUEA 1IRFA 2GE3A 2UUZA 1BC7C 1MNMC 2DMNA 3HRSA 4R9MA 3WR7A 3BROA 2V4JC 1VHSA 1TZLA 5HS8A 1FYMA 1TP4A 3RQ4A 2L8EA 3L2QA 1AUGA 2CQNA 3CO7C 4PXCA 3ZPLA 3FXOA 3AG3H 5ED4A 3KZYA 3H5ZA 2KDZA 2FIAA 2NXNB 4DJLA 1KQ0A 4G6DA 1GXPA 2CMPA 1WKMA 5ICEA 5IP9J 2ANPA 2VZZA 3I9SA 4X8IA 2XC7A 2HR3A 3HHHA 4B4CA 4F91B 2BVLA 4FUUA 3OIPA 1MGTA 3PFIA 2Z99A 3T0YA 1O3RA 2G9DA 2PR1A 3B3CA 4HX4A 1JQGA 4UFXA 1ZR4A 3HOWJ 1ZN2A 2F4IA 3DQVC 4ZY2A 5H6RA 4XBFA 3LWUA 2BE5F 2HUZA 4UHTA 3CDHA 1PUEE 1S72I 3X2QH 3BQYA 3I58A 4MCRA 5IV0A 4OIQF 1SAUA 1MNDA 4H0EA 4B5PA 3A0HC 3ZXSA 4FQGA 2R7VA 3PP9A 4C7HA 2DPUA 4CAEA 2DKVA 3QRFF 3D5SC 2E7XA 5DCFA 4RBOA 2OH1A 5EDNA 2F48A 5F27A 2O7OA 3AFHA 3V7CA 3GW2A 4WWCA 1PDNC 2CNSA 3D7DA 1SANA 4G6TB 1QGPA 1ULYA 4M6HA 2JVGA 2K9NA 1QBJA 4TWEA 1V3FA 2A05A 3S2HJ 2XPVA 5FUVA 2ZELA 3IU1A 1UCRA 3P7NA 3TO6A 5TGTA 4CH7A 2N8GA 5DD8A 4E0AA 4MFEA 2L01A 1CGII 1U6GA 3FEEA 1W0TA 2DEAA 2HWVA 1GDTA 1L0CA 1VIXA 2H27A 2W57A 3ZOBA 1IB1E 3QPLA 1ULNA 3GKRA 3GCMA 5HVQC 3TT2A 1VQMI 1ON1A 4BEHA 3I3LA 3LNQA 1JKOC 1E3PA 2IMOA 1KU2A 2ELJA 3RZOJ 2BY1A 1MW7A 3FK6A 2REEA 2KPMA 2KIUA 2R7UA 1FTTA 2POKA 3HSEA 4NC7A 2X9DA 2V26A 4NXYA 2R7QA 2R7TA 5FGMA 3SXOA 3FZVA 1Z9UA 1W5CC 3QPHA 2ELIA 1LFWA 1S7EA 5IP7J 2D4PA 2EK8A 1Y0NA 3FBNB 3LSJA 3BG6A 4OWRB 4KUBA 5GAGJ 3CUQC 2BXZA 2J5OA 3IH2A 4GFBA 2A69F 3M1EA 1KQ8A 2Y69H 4QPQA 3NWTA 1Z8WA 3ESWB 2L0KA 2LKSA 4JK1X 2PJ3A 3H8EA 2R7OA 4KT6A 1GVJA 3VSLA 4C2ZA 2BBYA 1VDDA 4OOIA 1KU7A 4HBLA 1X4SA 1X4PA 1ZK8A 4O3MA 4JX6A 1MMAA 3CUQB 3VYTB 4MFDA 2E60A 2M0MA 4MHNA 4HX8A 4RLFA 1IN5A 4UUSB 1WHUA 3GF2A 3CC2I 2PMZN 1XCVA 4KJZA 1TL8A 3EUHC 6CPAA 2ZCWA 3K4BA 4UB8C 3HOTA 1P7IA 4Z65A 3H36A 4XRFA 1HBXG 1J4JA 1WVRA 3IAS2 3SI1A 4LOCA 2Q4YA 4IHMA 3WG9A 3B3SA 1ARLA 3PQJA 2HKOA 3FF5A 3A0BC 2WAFA 4A37A 4UV8A 4C7IA 4FBEA 3OYJA 1FP2A 1SGQI 1IN7A 2DDAA 3E6MA 2K85A 4AC0A 5CCMA 1CM0A 4AM3A 3FXKA 1OR7C 3S9NA 3K9TA 1FOYA 1W36D 2OOTA 3JRBA 1OCOH 4ZYHA 4FD5A 4EMEA 4MJ8A 3QAYA 1M4IA 3LSKA 3CCEI 1TIQA 4HPSA 1TC3C 2EV6A 3E0JB 3TC8A 3CLOA 4RMNA 4XICA 2JK3A 2HYFA 5AIPA 4HNWB 3BPXA 5E3OA 2MC4A 2OZGA 1J75A 1RO5A 1YX5A 3DTEA 2FA5A 2NU0I 2OQRA 1YOVB 1Y39A 3GZ6A 5EGOA 1WJCA 4M6GA 4PJ0C 2E36A 1IGNA 3VDPA 1Z0XA 4DYCA 3JRFA 3JRCA 2ZSIB 4L5IA 2QLZA 4V2FA 5HODA 5D4RA 1TW3A 2JQ7A 1S7LA 4R3KA 3VODA 1DDNA 2BEIA 3SI2A 3DBRB 2WPXA 4XSZF 3WE3A 1YX0A 4A3JJ 4MXUA 3SGBI 3WTSC 1IDZA 4IL6C 1JHHA 3S3OA 1BR1A 2ECCA 3V7ZA 1K4SA 1XA6A 4QUSA 2A6TA 3S9MA 1MT1A 2GFQA 1X19A 3IP4B 4GS4A 3OVOA 2X6YA 3FC3A 3D5RC 4BQNA 3TJQA 2QF7A 5BOXA 2PJRB 5D5WB 4S0HB 2NU4I 2ATRA 3VARA 2M8GX 3I0TA 4B3XA 4H6UA 3OIOA 1T39A 1FSEA 2GWRA 5CVIA 3HG9A 2ARHA 3V8JA 5GTHC 1RXTA 2OAZA 4LG3A 2ZFUA 1XB4A 4AIKA 2Z2SB 1UJ8A 1VZ0A 3TTHA 2MGQA 2X48A 1N78A 5G21A 2F8HA 2Y2ZA 4PZJA 2V1NA 4HNTA 1HLVA 2E2HJ 1Q2YA 1MBFA 4KN4X 5IT3A 1M8BA 4AMLA 3QU3A 5K8OA 1KUVA 4NJQA 1CF7B 4A93J 3NEUA 3OXFA 2EFWA 4E7KA 1SGEI 4ETSA 1U5TB 2GLFA 1F1ZA 3KE2A 3ABKH 3DEEA 1YW4A 3ZQIA 3DU5A 3TP0A 4UVCA 4RAGA 2CH0A 4EATA 2GKRI 4B12A 2NMTA 1RI7A 3D8PA 5AONA 3FVLA 3JCUC 2CF4A 2FT0A 1QSRA 3PGPA 4NJRA 2M5WA 4OMEA 4KOUA 1BR4A 1T8IA 5I0CA 4EM1A 3KGQA 2VONA 4C2YA 1G59A 2EV0A 5B1BH 2R0QC 1DP7P 3GUXA 4CAWA 4IRIA 1X12A 3Q3SA 4XPKA 1PP8F 2QYOA 2GXAA 3D4UA 4OIPF 2ISZA 1QSTA 1UUCA 1YGHA 4KSIA 1KYWA 3KZWA 1IXCA 3K7AJ 1FYBA 2L54A 4B09A 2QMLA 4UCNA 4JYKA 4AUXA 3HH2C 2D2WA 2M1BA 1RESA 1Y56A 5J6XA 5HNHA 1CE3A 5ELYA 4WF2A 5HDGA 1X1DA 2XHKA 2K4BA 2M7AA 3DNSA 4IXAA 1QPMA 2W1OA 5A2QK 2XF7A 1I6HJ 4PV6A 1LANA 1STZA 1MH3A 2H8WA 2IW5A 2QWWA 2ZNYA 5F64A 1FAQA 3E6BA 1BJZA 1WZ2A 2QQBA 2V1CC 3KKWA 3CCUI 2TCTA 2E1OA 4BXUA 1M1EB 3GO5A 4U88A 5LLQA 2AJ6A 4Y17A 5IYDJ 1MH4A 1QPIA 1IO2A 3D0SA 4BGDA 2ZXHA 4JOMA 2QSHX 2G3TA 2BXYA 4CA0A 2QQAA 1SVOA 3ONQA 3BDDA 3CZ6A 2O8XA 4C2XA 4BKXA 1TLHB 4BD9A 1IIDA 2EFPA 1LKXA 1HEVA 2ZJ2A 4MHGA 1U9OA 2PI0A 3P2HA 3SHPA 5JM6A 2ORVA 2HC9A 3KR5A 2JA1A 4E7HA 2ME6A 2CS3A 1YFHA 1UFHA 4E6KG 4A24A 3HHGA 3ISXA 2RFHA 3LODA 2DYSH 2V6CA 4DZPA 3B35A 5G20A 3QP5A 1YX3A 4HSTA 4P9FA 1LR9A 3HRMA 2HQ5A 4AIDA 3UGIA 2H5MA 4L89A 2GVIA 1R9TJ 3CUQA 2A5WA 3DWLE 3WG7H 1VHOA 1Z6TA 4RN7A 4UUSA 3FXMA 2XROA 1ERDA 1YIOA 2EBIA 5D8NA 3G1OA 4ITVA 1ORKA 1Y6IA 2KZVA 2NS0A 4MIMA 3OYBA 2CSOA 2WV1A 2YUUA 4A38A 1DGWY 1K6YA 3K1MA 1Y0RA 4CAVA 1YG2A 5LHHA 2ZMEC 1A6QA 2O6GE 4U0YA 3IRQA 1I6XA 1FZPB 2N52A 1QZYA 2E34A 4BY7J 3R6SA 4OIDA 5FKOA 1DU0A 4JZ0A 2EH3A 5D29A 4X3RA 5D5UB 1XGOA 3UOEA 1W5SA 4HF2A 3MKZA 3EQLF 4LLNA 3EUHA 2ZMEB 3FHNA 1TWCJ 5DS9A 3CCYA 3QQAA 1WJAA 3GX4X 1P0HA 4MHPA 1ETVA 4C30A 3CMAI 3D00A 2ZEMA 2Q2EB 2JLMA 5DM6F 2KDOA 2LRDA 1R58A 2XGDA 5KK1A 2ZJQF 1FYKA 2XRNA 1TBNA 1Z6RA 3L00A 2LB7A 2PJ4A 5IB9A 4LLGF 3GBGA 5ERIA 4M3EA 4UF4A 4UFWA 2OD1A 4M72A 4G12A 1FTZA 1OMUA 4AVPA 1OR7A 1R0RI 2BCOA 1YVKA 3LAJA 1HC8A 2VL1A 4KORA 3FXTA 4RI1A 2D1HA 3CXPA 1FMWA 2PJ6A 1IN8A 1SMYF 3J80K 4J01A 5E3QA 4FD6A 4Q47A 2CFXA 2TRTA 1HCRA 1OBRA 3IV5A 2ZOFA 2G0BA 2V8DA 5E1ZB 2Z3PA 1YK3A 3OV8A 3OOPA 4RB0A 1LFBA 4UUVA 2PVWA 2MBFA 3FMCA 2L4AA 4IAVA 1RR8C 3ECHA 3BR1A 1WJEA 3I54A 2FMLA 1X10A 2IRFG 3PB4X 4LQ6A 1P92A 1FX7A 1GUUA 4A39A 3ZQQA 5F0FA 1F57A 2EBJA 1D0YA 4MEYF 3JVNA 3EYYA 2VBQA 2ZEOA 4R87A 3SZTA 4EJTA 3G1LA 2Q8KA 3T8TA 5K5RA 3BR0A 2V8GA 5AGEA 4P4DA 4XORA 2R7RA 3FKJA 4E2AA 4IZZA 1XBTA 2M9HA 2GU2A 3C2BA 3CJRB 2PJRA 1IF1A 1R7JA 2K9QA 3H1CA 3JAMK 4A33A 1XSXA 2XAFA 4MBUA 3BCAA 1U0JA 4AVZA 4FASD 2XAQA 3J81Z 2QYVA 3PZJA 5LRKA 3OYAA 4MY3A 4LX9A 1PVEA 4FD7A 4NEXA 2VC1A 3BR6A 5BNGA 2LLKA 4C9YA 4CYCB 3I56I 1YQEA 4I99C 1Z7LA 4MPIA 2A68F 5CVUA 4G1PA 1UMQA 2K3FA 4NGRA 5M5XJ 3AKZA 3TEDA 1XGNA 3BTIA 3JRHA 2WPWA 2ZEEA 2QKMB 4U7BA 5J40A 2F2EA 4II3A 1BMOA 1EH8A 2VXKA 3H5AA 1CF7A 3ZR8X 3VE5A 3VB2A 3CMYA 3H9QA 1VQ7I 1TQPA 1U5TA 1UG0A 2DN0A 4BS9A 3FIWA 1ZKGA 4F3QA 1H89C 2A6EF 4HNYB 5BMZA 1VQOI 1K83J 4F0YA 1SD5A 1N25A 2OV7A 2XV4S 3UEYA 2YGWA 4GGGA 3D68A 4QSHA 4B13A 1P4AA 5EBVA 1XTAA 3M3YJ 2DOFA 4AYBN 2DJIA 3OSGA 4U0VA 4I2OA 4PSXA 3I64A 3OYIA 4MCPA 3PB8X 3V42A 4J3GA 3OYHA 1XJOA 1XFOA 2LYCA 3PL8A 3SDGA 1JI8A 4NGNA 1MMGA 1P9GA 3Q9VA 1UVFA 4I09A 4G7OF 2EILH 1MZBA 3FIXA 1I5ZA 3KR4A 2YR2A 1SGYI 2LG4A 2QQ8A 4AG7A 4D7NA 2KIMA 1O4XA 2ZO4A 1WRJA 3FISA 5JHUA 3OWTA 3IO1A 2ZEDA 4QC6A 1EE3P 5KTAA 3PDNA 4RM3A 2PJ1A 2YNCC 1BN5A 4A6DA 2LDUA 3BJOA 4Q5SF 3G8WA 2NOJB 1SFUA 3O6BB 3SDBA 1VQ9I 2GOXB 2Z3MA 2C6PA 3VWEA 2VLAA 4HLYA 8CPAA 3QOEA 1D0ZA 4M6YA 2XUBA 4IHTA 3HOSA 3LSPA 1XX5A 2WV0A 2WAQA 2QECA 4B6DA 2E35A 1E2XA 4NGPA 3LSMA 1KUYA 4KLWA 1OMIA 3RSNA 2RIJA 3DKWA 3RKWA 1O3TA 2C1CA 1XD7A 2L9VA 4F55A 1V1IA 3NH5A 1BI0A 4EJOA 3CDLA 3F6OA 3D1NI 2V1CA 2Z9OA 3BR2A 4CGMA 2JMWA 1NG7A 2KRCA 4IF4A 3OYNA 1T08B 3CCQI 4HF1A 2XSDC 4OIRF 2JRMA 2X6OA 1ULMA 1M4DA 3PNYA 2WVJA 3T1BA 2QEXI 4L18B 1Y1CA 1H8AC 2WC2A 3ZMTA 3MRUA 4FETA 3B3TA 4OC1A 4PPZA 2FIWA 1W0UA 4ASNA 5BPDA 2WYRA 2FBHA 2HYJA 1MMDA 1Z91A 2M7BA 2K40A 1WTJA 5FO5A 1G3SA 1QO0D 4CCLA 4HNVA 2JPCA 4KOYA 4GO1A 2ACJA 3F8KA 4B47A 4QBJA 1Z77A 2F5VA 3VWBA 3R5DA 1P2FA 4L9JA 1OLTA 2P5KA 2GA2A 4P5OA 1IOFA 3OYFA 3WGHA 2L7FP 1ZQ3P 5CCLA 3AG1H 2C6CA 4CGNA 5IX3A 3GUDA 2Q7BA 1A2ZA 3H8GA 3BJAA 2VBZA 1MNEA 3CP8A 2PCUA 1JXSA 1TUSA 3ZMZA 1B1BA 4CGLA 1OZPA 2BZTA 4IQ4A 2M3AA 5LYDA 1KA8A 2ZMEA 1MK4A 4BDYA 2V9VA 4L9VA 4U9ZA 5DWMA 2LF7A 2VQHA 2QZ8A 3BTLA 3LSIA 2DA2A 5FKMA 2CTBA 4R79A 2Q2EA 2CNTA 1N75A 1HSTA 1PTRA 1WGXA 1GYTA 1JT6A 3GTPJ 1W3SA 2COMA 4NHJA 4G8XA 3QYBA 4I76A 3L1PA 1IXSB 4LD5A 3N4MA 1HKQA 2K3PA 3R96A 1Z21A 1TXRA 2CW8A 1RUOA 3FXJA 2DAOA 2FXAA 3LSRA 1HKTA 3FSXA 1E3HA 4PJJA 3W6KB 1XMBA 4M6XA 3HOYJ 1VTNC 2R7HA 2XPUA 2CXAA 4UEEA 4FISA 2XASA 3B73A 3PQKA 5JR3A 1SD6A 3K4KA 1AU7A 3FHZA 1IYLA 2IGMA 2EV5A 4WXCA 1IU8A 2M4GA 3GTMJ 2PFBA 4QLCU 2BL1A 3EC4A 1FBQA 3COAC 4AYBA 2Y0MA 2FU4A 3H5RA 3V4GA 3W6JB 3S3MA 1V0CA 3U9GA 4A12A 5TRDA 3GZNB 3FBUA 3GLLA 4XKWA 4PXDA 1YSJA 3QYEA 5JLXA 4MFLA 3U1KA 2CWEA 3U2RA 1HW2A 3HOUJ 2H1LA 5FUXA 4YWYA 3DXJF 3ABLH 1DU6A 1ZARA 5FFZA 1VGYA 4MI4A 4NCZA 4HPQA 1Z2LA 1BO4A 3FMRA 5KHDA 4O23A 2K86A 5CJ9A 5E8IA 4IX7A 1HQCA 2JZYA 1FC3A 2IEKA 4RB1A 3GIUA 3V38A 3E0KA 1HW5A 4AU7A 2BO9A 2Y75A 4A69C 1XMAA 1F36A 2F5CA 1NUBA 2GZWA 4CYCA 1LQ1A 1BIBA 1F9NA 2OQGA 4P55A 1JTYA 2HV2A 2AFMA 4N9IA 3Q0WA 3HRTA 2IAIA 1YTPA 3L2UA 2ENNA 3BT9A 2OTLI 3FWEA 1T6SA 3M7GA 5KAIC 5H2FC 4FX0A 1VQ8I 2P8TA 4F7ZA 1DQUA 1N71A 2Z3KA 2IXSA 2GOMA 1B9MA 3KCCA 3KX2A 4E4HA 3PUFA 1R6RA 4M9XA 4QWQA 4HLXA 1LAMA 1IOIA 2VJJA 3PBBA 2WCYA 1O57A 4OP4A 4UWIA 1H9GA 3TFYA 3LACA 2DCEA 2Y0SA 3DSBA 2DU9A 5CVRA 4IO9F 1M1DA 1M4GA 2LK2A 5HLTA 3QWLA 2R7WA 2C6GA 3F6VA 3HUVA 1NG6A 2DBBA 2G7UA 2VQCA 1Q2DA 2FNAA 3N5FA 2V7FA 5BWAB 4B1RA 3KEOA 2AQEA 2ZEFA 2JA8J 4AG9A 3K1PA 2EIJH 4EVIA 2L9NA 1YO5C 2VQLA 1YW6A 5FRMA 4IOAF 3DEWA 3CP2A 2DODA 2EQRA 4J00A 1Y1VJ 1ETKA 4ONWA 1W7PB 1FOKA 2R7XA 1I27A 3GFLA 1YJ9I 2IP2A 1QA6A 4RB2C 3LQRA 2ZEHA 1JWQA 3OL4A 1TKJA 3D7GA 1ZYRF 4AD9A 2MLGA 3B02A 5C44J 3E59A 1IICA 2AFWA 4OC4A 4UFVA 5HVGA 2BW3B 2M30A 3IAM2 4YGOA 4M6IA 3K6GA 5FROA 1CP7A 4UA3A 4C68A 1YRNB 2ZW5A 2CQQA 2FF4A 1DPRA 2GKTI 1OYWA 1YLOA 4QB9A 3ISPA 5CNPA 3KLNA 5JGFA 1YMEA 2XKPA 5L3DA 3V7SA 3I59B 3A01B 2RDPA 2QSFX 4NFRA 1LFUP 4MFZA 2YNCA 1ELMP 3FNCA 4PGHA 4CUGA 4UUTA 1VQ6I 1BOAA 3IWWA 2DA5A 5LGNA 1H88C 3C26A 1XMXA 2DA3A 2JT1A 3VOEA 3FEDA 4P45A 3WTYC 4N4NB 1Y7EA 2ENZA 1A5JA 2I79A 4EEFG 3JRGA 3A03A 1NTCA 3OMYA 4XKVA 2PE3A 4B6ZA 1KWMA 4HX7A 3MWMA 3B6CA 2PQ8A 2JJ7A 1R79A 2A20A 2R8VA 2R7ZJ 1I1DA 5E17F 1IRZA 5J1QA 2VOOA 5E8GA 2CUZA 3K1NA 4MMOA 1U8BA 3LSGA 2KMQA 3VYSB 1R23A 4PJMA 1BBYA 2EJRA 3CMEI 3ZQ7A 4OMYA 2NYXA 4YEJA 4E1PA 3JRDA 5FD6A 2PN6A 1IY5A 1MJAA 2HZDA 1XE4A 3IGRA 2QKLB 1O3SA 1OCCH 2V1XA 3TDZC 4MTDA 4ANJA 2BUSA 3K4LA 4OMZA 1S9HA 2LREA 5IYCJ 5C4XJ 1R5HA 3JW4A 4P4EA 1TWGJ 1FBUA 2L9RA 3A1YA 3B3VA 4ENNA 1P9QC 5FUWA 4F0XA 1MMNA 5M5YJ 1IDYA 1MJ9A 3FX3A 3G1MA 3F8CA 3FXRA 2VN2A 1HW1A 5EZHA 3TO9A 4YIFA 4IRGA 3H0DA 4XLEA 1K7AA 3MKWB 1UHAA 3KASA 4KVXA 3CDIA 5J4VA 2L7XA 4FX4A 3GTGJ 3LFUA 3RYPA 2BVMA 3TBIA 2DQLA 1LB2A 3HLPA 2EVNA 2WSAA 2K4JA 3BG7A 2OZUA 3GTOJ 1ZG7A 4C2UA 4ZDPA 4K2EA 2HDCA 1Z4RA 1I39A 4DBQA 4AWXB 1WWZA 3PO3J 4EVYA 3R61A 3FBIB 5M3FJ 3LWFA 3S1QJ 3PB7X 2LC2A 2X4HA 4M85A 3OXGA 3WHCA 3FM3A 4ZTFA 4XOPA 2WGCA 1RPWA 4HOBA 2VBXA 1Z8LA 5DTDA 3WC6A 3SJEA 1WPKA 3M9AA 2JSPA 1SFEA 3IKVA 3OYDA 1IC8A 5D4SA 3BC8A 2NU3I 2Z3OA 2DOEA 4UVAA 5J1RA 5LD2C 2ZNZA 5DCMB 3IC7A 2ZOGA 1EA3A 1ETXA 1GHCA 1PYVA 3QYFA 2YPRA 4KLVA 5EC4A 3CPXA 3OR1C 1L3LA 1Z9CA 2C27A 3MVPA 2R1IA 3QWPA 4MHDA 3H0GJ 3JRAA 1VQLI 5IPAA 2FBIA 4GCVA 3KP5A 4BXFA 3KP4A 2IS1A 2N17A 4A2ZA 3JSPA 4MCQA 5E79C 3BQZA 2XGCA 3DLJA 2CIJA 4U5YA 5HXDA 5C88A 3ZQLA 1BIAA 4V19K 3O8GA 1VQNI 1XEBA 5E1XA 2HPIA 4UNOA 5F49A 5CPRB 2V9PA 2A3SA 3G71I 4BBSJ 3HPHA 1F43A 2CUFA 1Z7KB 3LSTA 4HSRA 3SI0A 5D6FA 4GYGA 1YJNI 2ZW4A 4EJWA 3J7YJ 2V77A 1TQMA 2HXOA 1TTYA 2MFZA 3CTAA 5B1AH 5HNFA 3F22A 4HNUA 3VATA 3TCVA 5DM7F 2GLOA 4HZFA 3TQNA 3FH4A 4LQGA 3Q0VA 4BU2A 3FMQA 4C2TA 3C7JA 3E2IA 4EFDA 4ZY1A 5D6EA 5LYLA 4RAYA 1G3YA 1MMSA 4ZGYB 5CYVA 3FDYA 5HS9A 3SEZA 3HDDA 2NU1I 4AVCA 1S6LA 2QVPA 2EB7A 3PSIA 5B66C 3DPUA 3RZDJ 4AXVA 4W1UA 4CXFA 1XS9A 4CYQA 3LA3A 5GPAA 3CD6I 2PR8A 4Y4RA 3WU0A 2KLOA 2CG4A 5L3GA 5FLXZ 3AG4H 4R57A 3EUKL 2BUEA 3DDDA 3PEIA 4F92B 3BWGA 1YI2I 2GBYA 2CQ7A 1M44A 3REOA 2OUMA 4MY0A 4ZDOA 4CCNA 4P4FA 4A31A 1JUSA 3RZAA 1C0WA 2CV0A 2Z5UA 1TF8A 2ZKZA 1W7PA 4N0BA 4RGUA 4LB6B 2M5XA 2VT3A 2JBJA 4MHZA 3CCVI 1IG7A 1WGCA 1BW6A 1S7KA 4FE4A 3DBHB 1W36C 2P5LC 4BQAA 3PNTA 2WY7Q 3OYKA 3BOQA 1S20A 2VRWB 2BW3A 4IUSA 4OC2A 2JA6J 3T8WA 3M8JA 2EA2A 1YRNA 3UY5A 4F93B 4M3GA 1ZGWA 4WK8F 5L3CA 3D7HA 1USTA 4JYWA 4KZTA 1PCEA 3RBUA 2F4MB 4KOSA 1DS3I 4L8AA 1WH7A 3FX6A 5GPCA 3I59A 3A01A 2R93J 2DQRA 4MHYA 4NC8A 2FOKA 2AXTC 1TNTA 2W00A 3P9CA 3CPAA 2DLLA 3F72A 4A3BJ 2B4DB 2AXLA 2PVVA 1JJ8C 3S9LA 4IEJA 4I0BA 1U5TC 2OA4A 4NBQA 1LNWA 2WTEA 4BUPA 3MD2A 3ZMUA 1ON0A 3TKYA 3SJFA 5F47A 4DUKA 3UR3C 1Q7LA 2IS2A 2Z10A 2XPWA 2GANA 4OKOA 1R36A 4A95A 2RKHA 4OIOF 2VXDA 4ZYQA 5TJJA 4YELA 1B6BA 5FKNA 1SD4A 2TDXA 3RPUA 3VPRA 4Y33A 4KS9A 2P6GA 3RNZA 4MQVA 2W4SA 4KIBA 1EH7A 4NB5A 2PBIA 4XQFA 4BYYA 4PGGA 2L7MP 2I10A 1T2KA 1LPQA 4RUHA 2QPOA 4UXJA 3NH4A 9WGAA 2HDWA 2H6CA 3D66A 1R1VA 2E19A 2MSYA 2NS8A 3FF3A 2DT7B 2P6TA 1CX8A 2KZGA 5C82A 1R5ID 4F8ZA 4A0ZA 3DR8A 5IP6A 1LUJB 2YU9J 1Q1HA 4K3NA 3M07A 2CWGA 2CQKA 1ZG3A 5K5OA 3L2NA 3R9FA 1R4MB 1ZLIA 4IHSA 4Z2YA 5JQ4A 1L0OC 4DNCA 5J4YA 1J59A 2F5IA 3SJMA 3VDUA 2B5GB 2JDDA 1YW9A 3ROUA 4CCJA 5AG5A 1QSNA 2VC0A 1MD0A 2HDDA 1Y1WJ 3RO0A 1T95A 4LK1F 2JUCA 1F5TA 2FEZA 5FLVA 1EF4A 1YU6C 1ARMA 2QA4I 2ME0A 3K4JA 1R4NB 1QMUA 2DMQA 2Y9YA 2NVTJ 2UVOA 2B8TA 1IV8A 3BJ6A 1XMKA 4XN0A 1PU9A 3IU2A 3WABA 3QP6A 1H9TA 3IIBA 2BHZA 1TF9A 3WTTC 1CPSA 3S16J 4E7IA 1RKWA 1XSVA 1Y0UA 2CYYA 2O0YA 3R95A 2JSCA 3K69A 1S5LC 1ZG1A 4EM0B 2LVSA 5H20A 2JA2A 4XR6A 1P4NA 3OXLA 4HA8A 2L5QA 3GZ5A 3I71A 1R71A 1FPQA 3C2HA 1R49A 1AOYA 1XG1A 2O3FA 2V8HA 4IHYA 1UFMA 2DMUA 5EG0B 2HKXA 1TQIA 2ZFWA 4W9YA 1Y9WA 1V5GA 3OS2A 2O03A 3HL2A 1PUAA 2O28A 2ZENA 3O8HA 2WWYA 1E17A 4U9YA 3SFIA 4UBRA 2VE9A 7CPAA 1ITYA 2VOPA 1I3QJ 1R57A 3GVAA 5LRGA 2J9AA 2Y9ZA 2MG4A 2X6WA 5HVFA 4D1QA 2PJ9A 4KUAA 1MBGA 1ETYA 4A3MJ 1QZZA 1IJWC 3GLJA 3BJ8A 3ERMA 3FECA 1TT0A 4D5FA 4Y52J 4XPLA 1RRJA 1DPUA 4KVOE 4F6AA 4MTEA 2ID3A 4LITA 2VB6A 2X1EA 5HVHA 4BE0A 3G3SA 2STTA 1Y0YA 3DBLB 1ZG9A 5H84A 2PLYA 1WGTA 2KMRA 2QSGX 2GLJA 3LD2A 4HNXB 1DGRM 2HTJA 3GMEA 1YTYA 4R7MA 3K70D 3FYNA 5J8CA 3C3WA 4I49A 4CYOA 5LHGA 2XAGA 1EH6A 1FIPA 1X1BA 1U8RA 4XMYA 2Y30A 3GOXA 2L2OA 2WAQN 4P6YA 3Q5FA 4Y49B 2CUJA 3CUOA 3E5QA 4DIQA 4S05A 2WADA 4KFCA 2B0UC 3L2RA 1BI2A 2H6BA 3MCZA 4O6JA 2CWFA 3DR6A 1D1BA 4ZY0A 4N9HA 1QHHD 1Y8QB 3F21A 2Q51A 1Z5RA 1ETOA 2R4GA 1OJLA 3L2CA 2DB6A 1TKHA 1IXRC 3EYIA 2PMHA 4HYEA 1GLNA 5CLSA 3ZQHA 5LGUA 1NK2P 3IJ3A 1FP1D 1CBXA 3ZN0A 3OY9A 1ELLP 3CCJI 3R1KA 4B5OA 3B6AA 3MN8A 4XONA 2RQPA 2QGUA 3CJNA 2MH2A 2FOWA 3VYRB 2KQRA 3H3ZA 2EFOA 1CGPA 4BY1J 3BG5A 4OAYA 2H94A 3O3KA 3QPTA 2MW8A 1JJ6C 2DOAA 4UCPA 2AS5F 2F7VA 4JWPA 2PJAA 3E97A 1W4MA 4EGZA 4UV9A 3CESA 2MH9A 1SD7A 2RNJA 3VSKA 1LVKA 3CCLI 3R5AA 4NDLA 1OCZH 1R5GA 4IQJA 2B3VA 3OYMA 3CLQA 2Y48A 5EX3A 3Q9SA 1AYEA 2Q4VA 1N77A 4ENKA 4A0XA 2DTRA 4GXHA 5HS7A 3R4KA 2Z3NA 3DPTA 3TDUC 2R7FA 2OTJI 1KONA 2BY3A 2HU9A 3HOXJ 3SZGA 2LFBA 4FE7A 3IWEA 3N05A 3B2YA 4Q48A 5K7FA 4IKFA 3KETA 2B58A 2B9SA 2DTZA 5FKLA 1V1HA 4M71A 4E70A 4KOXA 1DE4C 2B4DA 3KQZA 2M2EA 3KEYA 3BCBA 4BE1A 2Z0ZA 5F0HA 1T38A 5AIQA 3OYEA 3ABTA 5E20A 1BI1A 3D7FA 1WJDA 1PTQA 2DPSA 3HTSB 2M8EA 5E3NA 1Y1BA 2V9KA 1D0XA 4A3LJ 1UAAA 2LKPA 2O9LA 5IT9Z 1Y7RA 3QNVA 5K5QA 2XAUA 1W5TA 2LD5A 1SQHA 4ENJA 1K7UA 2QIRA 3S3NA 5CVVA 3UKGA 4DQ2A 2OJED 2LY1A 5H86A 1XN7A 4C2MJ 4N4OB 4IK2A 5KVRA 2P6SA 2HOEA 4A0YA 3HSFA 5D5XB 1S7NA 6PAXA 2JEWA 3S6HA 1Z3YA 2PX9A 3TOBA 4XLNF 1WI3A 1D5YA 1KQ9A 1AA7A 4IOCF 3HM5A 4ON0A 2WBMA 3IL2A 4W97A 4G94A 3B3WA 3K10A 1TKFA 1XDSA 2AQFA 4YFXF 3LFKA 4EGYA 2AFUA 2PJCA 2QQEA 2VKDA 2Z16A 3HRUA 4LG0B 2B5GA 3BI1A 2VQGA 5FJ8J 2XGEA 3S1NJ 3LA7A 1A04A 2JYYA 3WHBA 5JI6A 3D5LA 1DS2I 4NGSA 2DFEA 1A6IA 2KHMA 2KRHA 2Q0OA 4BH9A 1JKRC 2H1KA 3ZP5A 1VQKI 1SFOJ 2DFHA 1QSOA 4F52A 2ZSHB 4P96A 1M8CA 2HPMA 4CHUA 4NGTA 4D9JA 4P44A 1XGMA 1OCPA 2Q1ZB 5F0CA 2ESHA 4BBRJ 3KZIC 1HOMA 3KZZA 3EFAA 5G22A 1JT0A 2WY8Q 2X85A 3KP2A 3CF2A 2UWMA 2E2IJ 5LYIA 3PB9X 2IA0A 3GWZA 4GM5A 4XLHA 3BZCA 1TGSI 3KHXA 1ZGJA 2W0TA 4PK4A 2IA2A 3K2ZA 2ZXWH 2YX7A 2AO9A 4I02A 5CVJA 1OCTC 2LF8A 2HEOA 2NOGA 3QAHA 3QOPA 4IRHA 4XLAA 1PUFB 3R5BA 3TE4A 1Z1DA 3H5NA 3KEQA 5EG0A 5E3LA 3A02A 1UHWA 5BQTA 2HTSA 3CC7I 2Q7SA 2Y0SN 1VNDA 1RFHA 1TBXA 2DIPA 1HA8A 2YNEA 1MBJA 5DS0A 3DKYA 3NH8A 1RZ4A 1IY6A 1QQ9A 3ZJ0A 4ZJZA 2ZXJA 3A9LA 1HKSA 1S29A 5ICCA 3RPQA 2I5UA 1AN1I 4B8XA 5BS6A 3F23A 2CNMA 5K8PA 3MQ0A 4ZI6A 1X3UA 3H4QA 4WXHA 4E8OA 4HG2A 3IH3A 2RQQA 1HXDA 4D7MA 1CT0I 1LOKA 4P4BA 3WTWC 4DOZA 3BZKA 2I3CA 3H92A 1TT5B 5L3BA 1S60A 1TWFJ 2LMDA 4HDUA 4KYWA 4A3KJ 1GHEA 4B48A 1V54H 1G4DA 1BJAA 2V53A 1T0FC 1O3QA 3MN2A 3PUBA 4GDFA 2J9RA 1YITI 2GKVA 2ISYA 1J9IA 5JH9A 1IAWA 1UHSA 4B14A 4FKDA 1U6MA 3OYCA 2F5EA 3P5JA 1OFCX 3RKXA 1TW2A 2PJPA 3O2PE 5HI7A 4KOWA 3AG2H 1B6AA 2FMYA 2OD5A 1ZLKA 4MFPA 5L3FA 3WE2A 3HKZA 4CCOA 3OL0A 3MGDA 1EKEA 2XB0X 4CAXA 5LRSA 2STWA 3OWCA 4Y3OA 2F3CI 3MZ8A 1HDPA 4MRIA 1VQ5I 1FY7A 4CCMA 1CHOI 3ULQB 2FSWA 3IH4A 4X5KA 4CAFA 2WA0A 1H0ZA 4OVOA 2D4OA 1U78A 2GM4A 1SGDI 2ARPF 3V8LA 4M9SA 3KP6A 3H9GA 3WTVC 4Q38A 3KLOA 4YU9A 4CGOA 4JX4A 1ZTRA 4X1EA 1SGNI 5FUYA 3E1SA 5IYBJ 2DA6A 2GXGA 2EFQA 1KBFA 2PJBA 1IZ1A 3P9IA 1I1SA 4FAIA 5A28A 5EEHA 1O7FA 4LK0F 2VBWA 3H9JA 3I4PA 4PQAA 2B63J 5FVJA 2VJIA 3HUGB 4U0WA 2IT0A 1WJBA 2P5VA 3BLYA 5D8LB 2ERWA 4ZBGA 2VODA 5LEJA 2IVMA 1FYLA 4BXXJ 3BLNA 2N1AB 5F04A 1M4LA 3CT9A 1DUXC 4LIUA 4UXNA 1D8KA 3DP7A 2FS5A 1R43A 2I00A 2EA4A 2WB1N 1ETWA 4L5JA 5A2QZ 5BPIA 1S7OA 1JKPC 5K8MA 5ILSA 2FD5A 2KP6A 4BAYA 2Z33A 4M3BA 2P6EA 4RS8A 4MCSA 4NF1A 2XKOA 3GXOA 2XIGA 2EWNA 5HOOA 4BJ5C 1K78B 2R5ZB 3ZZIA 3L7WA 4UWJA 3W2VA 1J0RA 3NAUA 3ZGKA 4C3JJ 1IN4A 2UV1A 3HBLA 2Z3LA 4KSFA 1SGPI 5A27A 4KDPA 1HDQA 5KTDA 2M87A 1S7FA 3RKYA 1XOVA 4C3HJ 1P7JA 2XF5A 2XGXA 1BR2A 4RGSA 2ODDA 4AVAA 4CS0B 4OC0A 2DDBA 2ZW6A 1AWCA 3S6KA 1JUPA 2ECBA 4ZTJA 3ZMSA 2P7CB 2X3TA 3HSRA 2D1VA 4KT5C 1ULKA 3LAPA 5D5VB 1PP7U 4RA2A 3ZMDA 3H3VK 3HOVJ 2P6AC 2ZJPF 4XLCA 2IJLA 2WZNA 1U3EM 1KMAA 4HW0A 3PFYA 3R9GA 4EJUA 1RIOH 3JRUA 4P1WA 2HOTA 3RCOA 4GRIA 4UIBA 4PUSA 4CDGA 2XRLA 1HDUA 5J1YA 4M9ZA 2R5YB 2PJ8A 2QM3A 5ILVA 3SJXA 2IGKA 3E5XA 1XMTA 2KRFA 3S32A 5THWA 2HYGD 3HGYA 1I1GA 2OZ6A 4Q4ZF 1I50J 1K6OA 3EUAA 3IC1A 5M5WJ 5B3SH 2NVUB 4U87A 2KKOA 5C3EJ 1P9ZA 3B4VC 2LSOA 2FVGA 4KOVA 4WWVA 4FHTA 2PMUA 2OF7A 2DA4A 2I8DA 5F48A 3FK7A 5E1WA 5FB2A 4QPOA 1W1WE 3DEUA 4DGWB 2LBFB 1FSHA 2G0EA 4WP4A 4BBHA 3F8NA 3ELKA 1OKRA 3DTIA 3G2BA 2VUMJ 2X52A 4TNUA 3S1RJ 3N97A 4H6ZA 1TWAJ 4G9YA 3NQOA 2OVOA 5C4JJ 2LNBA 3FXQA 4EWTA 2F6CA 1ETQA 1PUFA 2GQQA 2L7ZA 4LMYA 5J8FA 4KA4A 1OQYA 4XM3A 4ZYGA 3GTJJ 1D8JA 1H8LA 3BJ7A 3HC7A 2CU7A 4D5CA 3CC4I 4RAZA 4OAEA 1AKHB 5LRJA 4EJVA 2R98A 3LOCA 3J80Z 4MO7A 2UXNA 3BR5A 4DBRA 2FXFA 3V8IA 3R60A 4XL9A 3BZ6A 1WI9A 1LEBA 3CDXA 4XPDC 3TMOA 1NSLA 3SYTA 3CXQA 3F5BA 1TBQR 3MFKA 2ADUA 3TGNA 1LCPA 1XF8A 4G7ZF 1WJFA 3SXYA 2HFHA 3SGQI 2GIVA 2JUGA 3K4MA 1B4AA 3DPLC 4G6QA 2VI6A 5D8KB 4HEA2 4CYPA 5CBMA 2OC6A 3QB8A 2EUIA 2FE3A 4BJTA 5EJCA 1BAVA 2PRQA 4XNHB 3V7RA 3KI9A 2VKVA 1RNLA 2FSRA 2K9LA 2XEIA 3JRIA 4E7LA 1K7VA 1B8IB 3D67A 3NA6A 1F4KA 1D1AA 5GP9A 4UIAA 2QQCA 4IF5A 3JSOA 1LDKB 1WH5A 1S8NA 3JAMZ 4BNCA 4EMSA 2QJ8A 3ERED 1USSA 3DCFA 2Q43A 2L02A 2Z3YA 4CO8A 5DAEA 3RYOA 3BG9A 1WK4A 5JHFA 4FCYA 5E3PA 4I01A 1T0FA 2WB1A 4MGRA 4A3IJ 3GLXA 3LQQA 1ON2A 3EDPA 3W91A 4KIFA 2VASA 4L0ZB 2M34A 2JWTA 3NWSA 2BV6A 5JVTA 1X1CA 2KMUA 1X74A 1BPNA 4IVNA 2JRTA 4BACA 3BP8A 4I0AA 4CICA 4JJXA 3D2MA 2BSWA 3VFZA 4TV7A 2VIXA 1SMTA 2PSWA 4FWUA 1S7AA 2A5YB 1K4TA 3K9UA 1RETA 4PK2A 1ZRDA 1Z8TA 1X1AA 4KMFA 1MBEA 2CRGA 3ECOA 1PCAA 3NE7A 4PXBA 4WJBA 1FBSA 2EINH 1X3ZB 1YQAA 1YR0A 5TISC 3F9KA 2MC3A 1YVOA 4FT8A 1ZLJA 1UG2A 4V2GA 3F8BA 2GA1A 4B3AA 4CSWA 2UZKA 5ICGA 4UB6C 3UGLA 4FD4A 2QUFA 5HLIA 2Q44A 2HNHA 3GTLJ 2CQXA 2E7WA 3M1CA 4BDZA 5EZGA 3F0CA 1B87A 3J81K 2NYQA 4A3EJ 3HUGA 3K2AA 1YE9A 2QQ0A 2IL4A 3N7ZA 1KZHA 1RUNA 1K7TA 3CZXA 4M3FA 1VQPI 3NARA 4OLLA 5HLHA 2OPTA 1KBEA 3BTCA 3HB9A 2FBKA 2QQDA 1N13A 4MFQA 4J19A 2V1DA 2FUG2 1ZRFA 2KCXA 3GYAA 4A3DJ 4G7HF 1XX6A 2PC1A 2R7SA 2X51A 2V1UA 3WU1B 3UGDA 5IT9K 4NC6A 4B10A 1FWZA 4OADA 2NVXJ 2N71A 4YRHA 3PJRA 3VWDA 1LDJA 2B3UA 4HF0A 1Q9BA 3CXSA 5JLWA 3CCRI 3DKXA 4RB3C 2E5RA 2PDOA 1WQ2A 4B44A 1K78A 2CJSC 2R5ZA 1CG2A 2AFSA 3HPGA 4YIIA 1UVGA 2GREA 4A2UA 2P7VB 3SZPA 4Q7AA 2XAHA 3ZQFA 3HZJA 1BM9A 5KNLA 3Q0UA 2NVQJ 4A3GJ 1X1PA 5JHWC 4A30A 3IUOA 2LP0A 1UHMA 4I6ZA 4ZZDA 5K1YA 1IYKA 1YREA 3S15J 1PJRA 1OYIA 1O7LA 3OYLA 2DF5A 5FD5A 2P6FA 3M8FA 5ILUA 4KMUX 3R5CA 4YIRX 2KL4A 4U7DA 5GCNA 5LYFA 4KSAA 5AG6A 1U9NA 2QBYB 1XPXA 4H4KC 2SGEI 3DFGA 4BHCA 2CO5A 1IY7A 3BY6A 1FT9A 4E7SA 1MSFC 3W6SA 1HF0A 4BMHA 3LA2A 4MFJA 1FEXA 1OYYA 2E5NA 3F8MA 3FM5A 2YS9A 3AL0C 1CT4I 5DUKA 1R1TA 2XF6A 5DDGA 3SJGA 2R5YA 4JBAA 3OOUA 1FIAA 5L3EA 1SVMA 2IPQX 3AL0B 4A6EA 2YNDA 4GXOA 3TW7A 5M3MJ 4I98B 1FOXA 1NE9A 3IFEA 1LE8B 1IUFA 3QODA 2UZ3A 3HTUA 4RGRA 2W48A 4OIWA 4Z6YA 2DO7A 4A5MA 2NNNA 2VJ4A 4P10A 1CGJI 4JXRA 2J8MA 2COBA 5FLMJ 4F9UA 2LBFA 2JN6A 3WODF 2EIKH 3G73A 3OSFA 1E0EA 4BHPA 1A35A 3BJIA 3B8GA 1REPC 2RB7A 3ABUA 4DJAA 1BOBA 3HXLA 1WWXA 2P0WA 1FT7A 1KU3A 3L2VA 3PFEA 3PB6X 3NRVA 2EZHA 1G2HA 3WU2C 4R8HA 3RYRA 1WCMJ 1KU9A 2PRBA 2L7KA 4KICA 1AKHA 3HGGA 5LFAA 3CO6C 2YU3A 1BW5A 2KJBA 2DXQA 2PJ5A 4KOTA 2H09A 3J7ZI 1OISA 1V55H 3KFWX 2RC4A 2CW0F 3OR2C 3V8KA 2IS4A 2CY2A 2XEJA 1ZO0A 2AFOA 1TNSA 2XSJC 5CQGA 2HB6A 1ZG5A 3L2WA 3W6XA 1IGBA 2UXXA 1Q1VA 1T33A 1ZR2A 4I7HA 1SEUA 2OB0A 2LY2A 2KCWA 1APLC 2PJ2A 2RV8A 1RTQA 2LY9A 2Q04A 4ONUA 5KAFC 1QRYA 2JEVA 5HQ8A 3KPHA 1F2OA 4L0YB 2GXBA 5K7ZA 1IRGA 1KZFA 1B8IA 2E1MC 3BG3A 2K9SA 3BTJA 3FRMA 1OCRH 4HQEA 4KISA 1FLIA 3DU6A 3RJPA 1YS7A 1CT2I 2ZXVA 5KTCA 1YLFA 3W6VA 3F0AA 1J09A 2DJNA 5JVGF 3DGVA 2A6HF 2E1MB 2R3SA 3OIQA 3IRRA 2LKXA 4IHXA 1CSOI 4XKCA 3S6GA 1BLLE 5F09A 3TL4X 3VDXA 2M0CA 4MFKA 1U5KA 3UEJA 2KMOA 3CCSI 3ZN1A 2VKHA 3GTQJ 2H8RA 2EFNA 4CYDA 4NGMA 4NSQA 3G4SI 4AIJA 2FE7A 4ORFA 3DLLF 1TBOA 4R1HA 2E5ZA 3FXLA 3WGGA 4EQQA 3H8FA 4UVBA 2E71A 2ZB9A 2IGNA 2E1NA 1GXQA 4UXHA 3S1MJ 5HLGA 1LFPA 2YQPA 4DYOA 1X58A 2DI3A 1CQTA 1GV5A 1ZREA 3J7AO 4UEZA 5DWNA 1GT0C 4X0GA 2K7LA 2ESNA 5DUIA 2MD5A 2X7BA 3HJEA 3R0JA 2Z11A 3DF8A 3CXLA 2JZMA 1VHEA 2M4KA 4RM2A 3VH9A 2PMZA 5DCMA 2DMPA 2HQNA 4PFPA 5E3MA 1HEEA 5F08A 3DLAA 1RC9A 3KYDB 3HOZJ 2E2JJ 2DFIA 2VKEA 3ZCOA 4WX9A 4A3FJ 1Y8FA 2ROWA 4XKBA 4HKFA 3LMMA 4MQ9F 2ABZA 5EMIA 5IOZA 2P81A 2WAEA 4XRMA 1JE8A 1OPCA 2WUUA 2W24A 2B7EA 1K4JA 1PYTB 4II9A 1YYVA 3W2WA 2KFDA 2NRAC 1E3OC 1OYVI 2AFXA 1ZG8A 5HH1A 3SXNA 1IV6A 1ACIA 2FNPA 1DP3A 3WTUC 4H89A 2SGQI 2IBDA 1ENHA 1ZHFA 2HXIA 3VYUB 2JA7J 1HDDC 2ZEPA 2L9SA 1YIJI 5ISVA 3IKTA 3BHXA 1HSJA 1FNOA 3I1UA 1UZCA 3B7IA 2QENA 1U2WA 3L09A 4Y49C 2X6XA 4FTHA 1TBRR 4H2KA 3CF5F 4QIWN 1Y8RB 4ZX9A 3JTHA 2V8VA 1GV2A 4HV5A 4XLFA 3KY9A 1D5VA 3RTRA 4KUMA 2ZBKA 4DYQA 3CCMI 4B43A 3PO2J 1SFXA 4BE2A 2A4NA 1MIJA 4UEFA 4A94A 3MKLA 2BGCA 2NSMA 4XN3A 4CCKA 4XK4A 2CGPA 3M4OJ 2VXZA 2MLKA 2DFFA 4Y7NJ 5G1ZA 1VQ4I 4GI3C 1VF9A 2VE8A 4B11A 2HQRA 2FRHA 1AMPA 1S5KA 4HQMA 2BY2A 4L9TA 3RIRA 9ANTA 3GEZA 1YHQI 2QBYA 3SEKC 3R9EA 5DEQA 4K30A 4ESJA 2A07F 3DV8A 3H3UA 4ENMA 2ODFA 1BA5A 3QU6A 1JKQC 3C1DA 1XGSA 2J8RA 3K70C 1T56A 3OYGA 5B5EC 1ZH5A 2L3DA 3NE8A 4CRYB 1UB9A 2K27A 2DA1A 3OS1A 4YFJA 2MA3A 3E3VA 1VI0A 1OMTA 2J87A 1NH3A 3EETA 2XB5A 4YFKF 3JTGA 3IWFA 4R3LA 2QVOA 3E5UA 1HPTA 4PDKA 3QTLD 1X2MA 2XVCA 4JP0A 2FX0A 3OL3A 1QZEA 2BHYA 1IN6A 5EYRA 3RAMA 2VT2A 1TIHA 2FQ4A 1LE8A 1NK3P 1Z8XA 2OCEA 4OC3A 1B9NA 1MJBA 5CPAA 2BEOA 2LEOA 5HDNA 5IOYA 1X4OA 2LTPA 4UXIA 1P4XA 4ZC3A 2K5CA 5J1UA 5KCMA 4BJ6C 4KNYA 2BOAA 2VPRA 4CZCA 1MDMB 3ASOH 3EPZA 3TX8A 2SGDI 2JBKA 2ZXIA 1NMTA 3K4NA 3S2DJ 1XRYA 3E6CC 1RKTA 2C6YA 1XC5A 3SHFA 1QQIA 1SFKA 2XDVA 2P4WA 2HOAA 4YG2F 3S14J 3WTXC 1XCBA 3RKQA 5E96A 1FNNA 2CV1A 4WCGA 3JTKA 4ZYAA 3GFIA 2XEGA 1S3JA 2OCCH 2YSRA 3HKZN 1NSAA 1POGA 4XSXF 3RU0A 2VPLA 3DTKA 2AE6A 3LL7A 3I5UA 3RQIA 4M3SA 2DK8A 3OS0A 2BYVE 4OAZA 4UY8I 1EV7A 5EF6A 1MBHA 1ZLHA 4BINA 3F3XA 4A3CJ 3K4CA 1CJWA 4HV6A 4ESBA 5J47A 5LGTA 2X0LA 4PFOA 3J7AY 3S2WA 2D5VA 4HGUA 3JREA 2F5DA 1TURA 1X3WB 4L9NA 1SGRI 5FRNA 2SGPI 1XBUA 1G8XA 3PNVA 2O4HA 3A2KA 4RDUA 2FNFX 4IJAA 4AIHA 2ZJRF 2JA5J 3MEXA 4LGWA 3H35A 2HOSA 3GY9A 4XOTA 7WGAA 4LLLA 4X2TA 1MBKA 1WSUA 5J3LA 4MEXF 4LB5A 3I53A 1B59A 2ZW7A 5JFRA 4CGPA 2NAZA 2L4MA 1JTXA 3L9FA 1B72B 2NU2I 1QVTA 5F6FA 4R8FA 2W25A 1BC8C 3KHZA 4ZYDA 2B0LA 4XNFA 4PJLA 5FFXA 3WTZA 3E6DA 4Q36A 2DXIA 1J2XA 3T5XA 4Y13A 1JGGA 2K02A 5F1JA 5K8NA 3ZQGA 4P9UA 4C3IJ 3CJQB 2K5TA 2VI7A 3LSHA 3T8RA 5I4MA 2AHQA 2KMPA 3ABMH 1JUMA 2VBYA 5DD4A 2Z1DA 4BHBA 1LR7A 1LAPA 3WT4A 2G3AA 1S3ZA 3KYLA 1KUXA 2JPBA 4XIDA 4RAFA 2B4BA 3ISZA 4AB7A 2MABA 2GAUA 4YRVA 1YJWI 2HVSA 5LBQA 2EZLA 1W4RA 1IRXA 4NQWB 3SEQA 3QPSA 4KVME 1BL0A 2W84A 5ICFA 4ESFA 4DYRA 2K9MA 3PFOA 3FMSA 1A36A 3R0AA 1P4WA 4LJZF 2CJJA 3PBEA 3W3CA 2RVCA 5CQEA 4CGZA 5GAHJ 2HQYA 1VFCA 2PJ0A 2NNYA 5IY5H 3TW6A 2K9HA 4E7ZA 5EEGA 2SGFI 2E1CA 4SGBI 3MZYA 2OR4A 2R7DA 3MMYB 2JVHA
chains in the Genus database with same CATH topology
4AVBA 3BPVA 2JDCA 2JTVA 4JXQA 1IUYA 3P2FA 2O61A 5AG4A 2J8NA 3RDIA 1IW7F 4PK3A 4RS2A 2G9WA 3ML6A 5F1RA 3IWGA 1ZAOA 3MZHA 2A61A 3M8EA 2ZPAA 3T9YA 5E18F 4PCQA 2RN7A 1XSDA 5FLXK 2PG4A 2DPDA 1T98A 2J5PA 2ELHA 1Z4EA 3JUWA 3VEPA 3SFZA 4S04A 1I21A 3AAFA 3KP3A 1YW8A 1QNTA 2EK5A 1R00A 4ZZLA 5LRRA 2Q0YA 4KIGA 4D0PA 3HIFA 4HAMA 5IB0A 1Q2CA 4B5PB 4A5NA 3IHUA 2RGVA 1YW7A 5LEKA 3EXNA 3GYHX 1J5YA 1YS6A 2YX4A 4M74A 1G3TA 1I12A 3K0LA 1R1UA 2F5FA 1XDUA 3T90A 1BI3A 3U1DA 5HDKA 3F8FA 5AG7A 2FCKA 4KN7X 1Y9KA 5DV5A 1NHAA 1R22A 1Z05A 3P9KA 1P6RA 1LJ9A 5JPHA 1YLEA 2G7HA 1K79A 3ZMVA 2VEZA 4JLYA 1MDMA 1JGSA 4M73A 3D3SA 1LDDA 4JQFA 1D3YA 4PSWA 4WXDA 4ZH4F 4JD6A 2VZYA 3S6FA 4XPDB 3KP7A 4LUAA 5DYMA 2OBPA 4XLPF 2REFA 2FQ3A 3GFJA 4Y15A 4EV0A 2DPTA 2HS5A 3I3GA 3MAJA 3HYIA 1KGSA 4CZZA 2DK5A 1MKMA 4O5VA 4MNUA 5F46A 3EO4A 2PEXA 3G3ZA 3SQNA 5HMNA 1ZGAA 2KJCA 1W7PD 2QQ9A 3TOAA 2FL4A 3RI4A 4GYIA 3EY5A 1LRZA 2DT5A 4IPAA 2HZTA 2HGCA 3GFMA 4LG0A 3FB3A 2M45A 4CRZB 1ONVA 1JHFA 3D2PA 2ETHA 2OZHA 4QVTA 1LVAA 2V79A 4YFNF 5LHIA 4HDVA 4OINF 3WGIA 2XAJA 1V4RA 3FXUA 1XIXA 4OU0A 2D45A 1ODDA 1VKCA 1G3WA 4CYNA 1LEAA 4NQWA 3IWZA 2VQYA 1KYZA 3TO7A 3C18A 4ZYEA 5H6QA 2W85A 2DW4A 4RGXA 2IA1A 4A32A 1H0MA 1G6NA 4LFUA 2KIFA 2OU2A 4XNHC 1ZRCA 1QSMA 1SAXA 1Z7UA 4UCMA 1J7KA 4EM2A 1IRFA 2GE3A 1BC7C 3HRSA 4R9MA 3WR7A 3BROA 1VHSA 5HS8A 1FYMA 3CO7C 3ZPLA 5ED4A 3KZYA 3H5ZA 2FIAA 1KQ0A 4G6DA 1GXPA 1WKMA