1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ESA1 PROTEIN
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
5EBVA 3DXJF 5E17F 2WV0A 2F2EA 2V1UA 3GZ6A 3KP3A 4OIRF 3D3SA 4MTDA 1ZH5A 3F5BA 3EETA 2G9WA 3PFIA 4L9NA 4RGRA 3T0YA 1CJWA 5K1YA 2E7WA 2GXGA 4CO8A 4HKFA 3F72A 3D2MA 4MI4A 1G3YA 1U5TA 1JHHA 1I5ZA 2OQRA 1S5KA 2Q44A 3H3ZA 1EH8A 3RKWA 1XD7A 2XV4S 1PUEE 2P5LC 2IPQX 2HEOA 3V7CA 3ZN1A 2VI7A 2QWWA 3GW2A 1D8JA 2GA2A 1SFXA 4KNYA 5HS7A 1QO0D 4UHTA 1V0CA 1J2XA 3WTXC 3E6MA 1R1TA 3TOBA 1FYLA 4M3SA 3LWFA 1TW3A 4BHCA 3H3UA 3CXSA 2FNAA 4RGUA 1MJAA 3FZVA 1LDJA 3ERED 1UFMA 3MWMA 1J75A 5K5QA 3IGRA 4IUSA 2PEXA 3P7NA 1FNNA 2DQRA 1P4NA 1OKRA 2RDPA 3V8LA 1KYWA 1BN5A 3TE4A 3KLNA 3K1MA 3T90A 3OOPA 3WGGA 1BI2A 2FA5A 3RIRA 4G8XA 1YW7A 5K5OA 1EV7A 4H89A 4JQFA 1AOYA 3HRMA 2Z11A 4G7OF 5E8IA 1IN6A 4WWCA 3OV8A 1HW2A 5F64A 1RI7A 2A4NA 2P4WA 2P6SA 2ESNA 2D4PA 2XAHA 1S7KA 2ZJ2A 3LQQA 5HLHA 5E18F 3I0TA 4BH9A 2XASA 3RTRA 1G4DA 3G8WA 1T39A 2UWMA 2F5IA 3IWGA 1SD6A 2VQYA 2VZYA 4CRZB 1LJ9A 1ZHFA 3UY5A 4H6UA 2QQBA 5E20A 4E8OA 3WGHA 1IICA 1QSNA 2LF7A 2ZXJA 4AVPA 3RYRA 2ZW7A 4GYIA 4RAYA 3T1BA 4R79A 4HOBA 1V3FA 1TNTA 1K7AA 5TJJA 2P6FA 5DUKA 4IHSA 2B3VA 1ZGAA 1XF8A 2H09A 3GYHX 2EB7A 2R7DA 4N9IA 1S7OA 3J81K 2L4AA 5F49A 3C7JA 1XGNA 4KDPA 3SZPA 2H27A 5LBQA 1WK4A 2IRFG 4MY3A 2FU4A 4AVBA 5EEGA 1PU9A 2DXQA 4RB1A 3JUWA 4XPKA 3EXNA 3HSEA 3FM5A 4BXUA 2NS0A 3D2PA 2HKXA 4MHGA 2LSOA 3FRMA 3HSFA 3O2PE 1GVJA 3SXYA 3EFAA 4OADA 2RGVA 4A5MA 1W5SA 3U9GA 1W7PB 1MKMA 1JHFA 5L3FA 1LRZA 3FIXA 3FYNA 4HW0A 1G3TA 1W5TA 4OU0A 3TDUC 2B58A 3J7AO 2FE7A 5GCNA 1U2WA 2FRHA 4MQ9F 4HNXB 2FL4A 4L0ZB 4XLPF 4ESJA 3FXRA 2FQ3A 4K30A 1TQIA 2GWRA 1OZPA 2ZFWA 3LAPA 3VFZA 3PZJA 4HV6A 2HWVA 1HKTA 2PMUA 4OMZA 3LSTA 2TDXA 1SMYF 1ZGJA 1XMAA 4HAMA 3M9AA 4ZYEA 1S7AA 2EV6A 4CICA 2WPXA 1BC8C 4BNCA 1VHSA 2RQPA 4A0ZA 2L54A 2XGXA 3R60A 3B02A 2L02A 4RI1A 2HYFA 3K1NA 2COMA 3GYAA 3DDDA 3DR8A 2VODA 3T8TA 1Z9CA 1T6SA 5FO5A 4QLCU 2VOOA 3CO7C 1YK3A 3S6GA 1KUXA 1B6AA 4HQEA 3JAMZ 4A12A 2VC0A 1XSVA 1I27A 4RS8A 5DWNA 1HXDA 3ZP5A 3FM3A 3GVAA 3KFWX 3WTTC 3HSRA 3F8NA 3S6KA 4UXNA 2CNMA 3KEQA 1FBUA 2IA2A 3MZYA 2M5WA 4ONUA 4MQVA 1HW5A 4PK3A 4HZFA 2CNTA 1TTYA 3CDHA 4Y13A 4PV6A 2J5OA 5H6QA 4XSZF 2YU3A 1IYLA 4LJZF 2P6GA 2VBZA 3EQLF 2G3TA 1P6RA 2PRBA 4OLLA 4HDUA 3CTAA 4NF1A 4HLXA 3G3SA 4KOXA 1ULYA 1F9NA 3IKVA 2ZPAA 4ZH4F 4QB9A 1G3SA 2F5DA 2IJLA 2CQKA 4EGZA 3TO6A 3D5LA 2LDUA 4AVAA 3DP7A 1P0HA 3BWGA 3KE2A 2R7HA 2V79A 2Z99A 3I3GA 4EVIA 1GHCA 5KVRA 4R9MA 1FP2A 3G73A 1HSJA 4R3LA 2XROA 2D1HA 4HQMA 3J80K 2HUZA 3TT2A 4I98B 4R3KA 2AS5F 3SQNA 2CO5A 4KUAA 3KP7A 3WR7A 2HR3A 4UUVA 1S8NA 5L3CA 2OD5A 3I5UA 1YLFA 3KP6A 1RZ4A 4G7HF 3F6OA 4H6ZA 4I0AA 2KRFA 5D4RA 5J8CA 3C3WA 1U6MA 4ZBGA 3GZ5A 3V8JA 2KIFA 1OYYA 3LQRA 1S6LA 3S2WA 2FBHA 3NQOA 2DTRA 2I79A 4LMYA 2YPRA 4XNHC 4RB2C 2FXFA 3ZJ0A 4WX9A 4Y49B 3WU1B 2VZZA 4EM1A 1O3RA 1SFEA 4OIOF 3W6SA 4II9A 2GIVA 3CJNA 3QAHA 2V6CA 2BBYA 3HIFA 4AG7A 4IJAA 4EV0A 4JXQA 1FLIA 3BY6A 2BE5F 2FT0A 3CUQC 3P2HA 3F8FA 2B0LA 1K4JA 1S3ZA 5E96A 2HFHA 3RDIA 3FNCA 3B8GA 1YQAA 2O8XA 4QBJA 1CGPA 2ZCWA 3T5XA 1QNTA 4KOVA 3V7RA 5HOOA 1IN7A 2ZW5A 1Z05A 4OMYA 1GHEA 3I53A 1KZFA 1MD0A 1XDSA 3BPXA 5CVJA 2A6EF 1MJ9A 4PGGA 4MEYF 3ZMZA 4OIQF 1Q2CA 2B4BA 3R9FA 3FXQA 3H92A 2X0LA 3BDDA 3IWZA 4Z2YA 2GE3A 1NHAA 2ZW4A 3FF5A 4M72A 1R22A 3I58A 3GF2A 3JSOA 4ZZLA 1J0RA 2QECA 2BV6A 5EC4A 3FX3A 2M45A 4MBUA 1NMTA 4PK2A 4GGGA 1AWCA 3EY5A 3ABUA 3SHFA 5HLIA 2CY2A 2W25A 4EQQA 1Y9WA 4CS0B 4GO1A 2B3UA 5KTCA 1B59A 3DNSA 2PLYA 4AIHA 3BLNA 1LDDA 2X7BA 3V7SA 4Y17A 2NMTA 3WTVC 3W91A 2D45A 4NXYA 4CYDA 4JWPA 1RUOA 2JZYA 1ZG5A 5E1XA 2YSRA 3GKRA 4A2UA 4JD6A 4ZYDA 5D8LB 1HSTA 2HV2A 2Z3YA 2B5GA 2EVNA 4PCQA 1DDNA 1ZAOA 1FX7A 3P9CA 3WU0A 1QSRA 3WTZA 1U78A 3IRQA 2Y0MA 3WTWC 4L9TA 5DYMA 2DPUA 4IRHA 1GXQA 3CLOA 1ZRDA 2GANA 1I12A 2BL1A 1FOKA 4GCVA 1J5YA 2KJCA 5D5WB 1RUNA 2XKOA 5CLSA 4P5OA 1SD4A 1R23A 5JHUA 2JDCA 1OR7A 1MDMA 1ZN2A 2QYOA 2Q2EA 4KOYA 3WODF 1R58A 3VOEA 5BQTA 1RIOH 2MD5A 3IHUA 4KLVA 4UA3A 1L0OC 2IW5A 2Q7BA 2M1BA 1Q1HA 2EA4A 1R57A 4AIKA 3DR6A 3ML6A 5HDGA 1XSXA 4Q4ZF 2VN2A 5IT3A 2REEA 2NNNA 4AD9A 3RKYA 4YGOA 2VXZA 1YYVA 2IA0A 3R4KA 4FHTA 2VT2A 2HDCA 1B9NA 4IHTA 4U9ZA 4EJUA 3E6DA 2EFNA 2EV5A 4M9SA 2G7UA 1L3LA 3FXUA 3IKTA 2DFIA 1PP8F 3ZMDA 1BO4A 2ZNZA 1ON2A 5HDKA 5JQ4A 3U2RA 4I09A 5BPDA 3BJ8A 5HS9A 2P8TA 2QQAA 4RS2A 4HX8A 2ETHA 2CFXA 1R36A 4RB3C 1E2XA 3P9IA 3FMSA 2V1XA 4BYYA 1MJBA 3VODA 3LA3A 4XSXF 5FFXA 1QPMA 1P4AA 3TFYA 1SD7A 2Y75A 2PN6A 4HF2A 1FBQA 4DNCA 3JVNA 3LODA 5EEHA 1ZREA 2RKHA 1O3SA 1U3EM 2R1IA 4YG2F 2D2WA 5DWMA 1BJAA 5LLQA 4JJXA 2EFQA 3O6BB 1W7PA 2A61A 4HNWB 5IB0A 4M71A 3TO7A 3EYIA 2DU9A 2H6CA 2HYGD 4ESFA 1I1SA 4I01A 3CXQA 3T9YA 3WE2A 1MGTA 3QOPA 5L3EA 5LHGA 4I49A 4ZYHA 2WTEA 4M85A 4UVCA 4R1HA 3BROA 4ON0A 1UFHA 1HKSA 4A5NA 1D8KA 1D3YA 1DUXC 4FX0A 1WQ2A 1K78A 4JBAA 2IVMA 1BOBA 5JVTA 1XGMA 3KLOA 4L9VA 2HOEA 4I7HA 1LQ1A 5C82A 4R8HA 1Y7RA 1IXRC 3I59B 2F5EA 4RAZA 5DCFA 1FY7A 2CYYA 2PMHA 1P2FA 5FB2A 1IB1E 4UV8A 3W6JB 2K27A 4WXDA 3IL2A 3HTSB 3RPUA 1BC7C 3TDZC 1KYZA 2FIAA 1YO5C 5CNPA 2B4DB 3NEUA 1IN8A 1FC3A 1KUVA 4FT8A 3KP5A 1DPRA 4U88A 3GO5A 4ASNA 4ETSA 4EJWA 4NSQA 5IX3A 4KN4X 4EVYA 2HKOA 2OA4A 1QSOA 2VE8A 1STZA 4R87A 2O61A 4XNHB 4WXHA 2O28A 2L01A 2VXKA 2KJBA 4IF4A 1XEBA 2XUBA 2W24A 4L0YB 3R0JA 2LNBA 2D1VA 4MNUA 3F8KA 4HF1A 3GLXA 3ULQB 4E70A 4U5YA 1VKCA 5D5XB 5D5UB 3P2FA 3WTYC 2VBYA 2KKOA 4L89A 1TNSA 1T98A 5HLGA 4UBRA 1XN7A 2W85A 5DD8A 1OYWA 4HF0A 5BPIA 4ENKA 5ISVA 4HLYA 1IW7F 3C1DA 1S60A 3E5XA 5ILUA 1S7NA 3QU6A 2QMLA 2FE3A 3LA7A 5LEJA 4YFXF 5IV0A 4ENNA 1QBJA 5A2QK 3D8PA 3GFJA 3WTSC 5C88A 1PP7U 2B4DA 4LB6B 4KOSA 1IN5A 1U6GA 2F5CA 3ELKA 4UWJA 1SD5A 3CUQA 1PUAA 5KTDA 1FYMA 3RPQA 5HH1A 1Y0UA 5HVQC 1HQCA 5LEKA 3NE7A 1O7LA 2H94A 4BQAA 1EH6A 4EJOA 1K78B 2K86A 5E8GA 3E97A 2XAQA 1R1UA 3W6KB 4KUBA 4IF5A 1BOAA 4E2AA 4KVME 3B73A 1BI0A 3EO4A 4LGWA 4QC6A 2Z9OA 2FMYA 1ZLJA 3T8RA 1IAWA 4AVCA 2J8NA 1K79A 3GEZA 5TRDA 1SAXA 1YR0A 1YVOA 2G0BA 1TW2A 4MY0A 1RXTA 1XMTA 5F48A 2OAZA 2DK8A 4N9HA 2VC1A 4KUMA 3R9GA 3SXNA 4PZJA 4YFNF 5ICEA 2H6BA 4A0YA 3MGDA 4XBFA 2VBQA 1F1ZA 3SZTA 2ZO4A 1FYKA 4B5PA 1REPC 5ILSA 4KZTA 4P9UA 2CW0F 5BMZA 1JGSA 2MBFA 2BGCA 5J8FA 1KA8A 1NSLA 4PSXA 2Z0ZA 4HDVA 2B5GB 2VBXA 4F6AA 3JAMK 1Z7UA 2NYXA 1I1GA 4BHPA 2FCKA 3BJ7A 3FB3A 1L0CA 4LB5A 3FHZA 4O5VA 2JTVA 5D4SA 2UZKA 2HQNA 3SXOA 5F46A 3K2ZA 4RGXA 1XDUA 2ZKZA 6PAXA 4GXOA 3F21A 4YFJA 4OINF 3REOA 3ROUA 1IRFA 3BP8A 3HHHA 4LG0B 5H20A 3S6HA 2AXLA 2ACJA 3R6SA 1SQHA 4OOIA 4LUAA 1J4JA 1Z91A 3R96A 3ZMUA 3HHGA 2XAFA 1UCRA 5CVRA 2ESHA 3FMQA 3ZQ7A 1XCVA 1MK4A 3ZZIA 3ZMSA 4B5PB 2O03A 4ENJA 2FF4A 3TOAA 2L3DA 3HRTA 4CDGA 1LNWA 3P9KA 1SFUA 4EM0B 2P6EA 4KORA 4M74A 3HRUA 3QU3A 3K69A 3F23A 3BOQA 2R7FA 1LEAA 2JPCA 2HZTA 1IYKA 2H5MA 4JLYA 1FSHA 2DBBA 3RI4A 2WC2A 2NAZA 2Y48A 2QVOA 3E6BA 3DQVC 3QRFF 1CF7B 3HTUA 2XRNA 3LFKA 1YLEA 3K0LA 4E0AA 1QZZA 3J80Z 4KYWA 2J8MA 1R1VA 1B6BA 2OQGA 1IUYA 2PDOA 4JXRA 2VONA 4FD7A 1J59A 5ICCA 1BIAA 1QGPA 4CAWA 4DQ2A 5FFZA 2HGCA 4U0YA 2Q4VA 5H86A 2ISYA 3ZMVA 3ZN0A 4Y49C 3GX4X 1FT9A 3IRRA 4MJ8A 4QUSA 2RC4A 3KP2A 2FIWA 3GUDA 1G6NA 2QM3A 2P5VA 2EUIA 3OWCA 1P4WA 2F5FA 1U5TC 1KQ8A 1M4DA 4PSWA 1WI9A 1KU9A 3MZHA 4ESBA 4UVBA 1QSMA 2XAJA 2HTJA 4N0BA 3QPTA 5CVUA 5KK1A 3C26A 1S3JA 4GYGA 3MEXA 2ZMEB 4P96A 2Z10A 5K5RA 2PQ8A 2X4HA 2RV8A 2G7HA 2BYVE 3F8CA 4B8XA 3DSBA 3N7ZA 1EH7A 4U9YA 2XKPA 3QB8A 5FVJA 1YW8A 2UXXA 3CUQB 2Z33A 2RNJA 3CO6C 1B4AA 2CG4A 4QVTA 3V8IA 2O6GE 1P4XA 3PP9A 4UNOA 2DK5A 1IZ1A 2R98A 3V4GA 2EFOA 4EJTA 1W4MA 3M8FA 3F3XA 2ZW6A 3KZZA 2YX4A 4F0YA 2V9VA 1FWZA 2A6HF 2QUFA 1WRJA 1RO5A 2CSOA 3TKYA 1ZRFA 2FSWA 3BPVA 4P55A 3TGNA 3HOTA 3L7WA 3KEOA 3CUOA 3HOSA 2FEZA 4FD4A 1TLHB 5JR3A 1WWZA 1LVAA 1H9GA 1FBSA 3WE3A 3I4PA 4KA4A 4KOTA 3ISPA 3BJOA 5LGUA 3AAFA 5DDGA 1KQ9A 5FLXK 2MH9A 4CXFA 1ZARA 1Q2YA 1ON1A 5H6RA 2Q4YA 5I0CA 3M7GA 3LD2A 2OZ6A 4CHUA 2DAOA 4LLGF 1BIBA 2PC1A 4HYEA 4L5IA 1T2KA 4K2EA 1FP1D 2GQQA 1M44A 4F7ZA 3BZ6A 3DEUA 1N71A 4XLNF 4LX9A 5F6FA 4Q5SF 1OMIA 5JPHA 3W6XA 2LF8A 2VBWA 4JK1X 2ZMEA 5AIPA 3PQJA 2VEZA 2P6TA 4L18B 4MTEA 2K4BA 1T38A 1I21A 2G3AA 1T0FA 2WWYA 1G3WA 2PR1A 4KLWA 2EJRA 1UB9A 1YVKA 1QSTA 4LLLA 2DPDA 4AWXB 2A69F 2Q04A 2M87A 2JDDA 2CNSA 5FD5A 4G6QA 5KTAA 1USTA 1J7KA 2L4MA 3R0AA 1WSUA 5CYVA 4KN7X 1ZG3A 1UHMA 2MA3A 2NNYA 2K4JA 3VEPA 1CF7A 2ATRA 1W7PD 4O6JA 1GXPA 4B5OA 3KKWA 1XB4A 1BBYA 5FGMA 2DT5A 3CXPA 3COAC 2JSCA 2MH2A 3HRSA 2UXNA 2BEIA 4IPAA 3MQ0A 5LRSA 1YW9A 4L5JA 1CM0A 1XE4A 3I9SA 2FSRA 4S05A 3EUHA 4M6YA 3M1EA 2XVCA 3GFMA 3I54A 3K1PA 3EYYA 3QP5A 1Q2DA 2A07F 2VOPA 2XHKA 4PGHA 2JRTA 4ZZDA 5HMNA 5L3DA 4KOWA 4D0PA 4MGRA 4Q47A 1WKMA 5L3GA 4KIFA 1P92A 3C18A 2DW4A 4M9ZA 5DUIA 3F0AA 1R7JA 4G6DA 2Q0YA 2EV0A 2PI0A 1S29A 1YIOA 4ZYGA 3HYIA 2OB0A 2GXBA 3GWZA 2NRAC 4MHDA 3L09A 5DCMB 4J3GA 2O3FA 4I0BA 3J81Z 2JPBA 3DV8A 2QZ8A 2QENA 3FWEA 4KMFA 1J9IA 1Z4EA 1IXSB 2WPWA 2HQYA 4M6XA 2EFWA 3WTUC 2LKPA 2GA1A 2JT1A 3R1KA 2GAUA 4KVOE 4AIJA 4HNYB 2FBKA 2QQ9A 3E3VA 3PQKA 5E1WA 2RN7A 1YS6A 4NQWA 1LB2A 4KIGA 5F47A 3SHPA 1B1BA 2M8EA 4B09A 4S04A 2HQRA 3Q9VA 4L8AA 3GFIA 5BS6A 2RVCA 1I6XA 2E1NA 4FX4A 2QLZA 5JFRA 1E17A 4Q48A 3L00A 3E0KA 1R5GA 2CGPA 3DPLC 3WGIA 1YX0A 3DKWA 1DP7P 3GXOA 2E7XA 2IA1A 1XGOA 3RYPA 3R61A 3ECHA 4KICA 3U1DA 4IRIA 4U0WA 4L9JA 2QBYA 2DLLA 2OU2A 4KOUA 1USSA 1ONVA 2PG4A 1SMTA 2VE9A 4AG9A 3PGPA 1O3QA 2D4OA 3L2CA 4QWQA 5LHIA 4ORFA 4CRYB 1XCBA 2ISZA 1IIDA 1BM9A 2W84A 2BUEA 2A68F 1V4RA 3IWFA 5H84A 4WXCA 1KGSA 2C27A 1KU2A 3KZYA 2IL4A 5JI6A 4EMSA 4A6DA 2JEVA 5ICFA 1PDNC 1FZPB 1D5VA 3ZMTA 1OYIA 3RKXA 1IXCA 4CGZA 1IF1A 3V8KA 3WG9A 4WK8F 2PFBA 2OH1A 3JSPA 1BI1A 4GS4A 3KCCA 1ZLKA 3L9FA 3ZPLA 3S6FA 2YR2A 4KFCA 3FBUA 4KIBA 1KUYA 3R95A 1DPUA 4LK0F 2P7VB 1QQIA 3ECOA 3GY9A 2KIUA 4IRGA 1KQ0A 4XRFA 1JE8A 4UWIA 4OAEA 1TQPA 5D6EA 5A2QZ 4XPDC 4R57A 3FMRA 5D5VB 3NRVA 3EC4A 1O3TA 1TQMA 1O7FA 4LK1F 3G3ZA 2XAGA 4PDKA 1WWXA 2KCWA 4U0VA 1Z6RA 4I02A 1BI3A 1HKQA 3LA2A 2MC3A 1JXSA 5HDNA 3DF8A 5ICGA 4YIFA 4NCZA 3N4MA 1O57A 2HTSA 2W57A 5D8KB 1S7LA 1YTYA 2FNPA 4X5KA 3E6CC 4KVXA 4LFUA 4CZZA 2CWEA 1ZRCA 1UHWA 4NHJA 1H0MA 1YG2A 5CVVA 5LGTA 2DO7A 4IXAA 5IT9Z 1Z1DA 2R3SA 4WF2A 1RNLA 2J5PA 2MLKA 4LD5A 3FXTA 2EFPA 4A0XA 2AJ6A 4Y15A 1ZYRF 2Z5UA 3EDPA 3D0SA 4YIIA 2FS5A 1QZYA 3E5QA 4U7BA 2A5YB 3R9EA 3TCVA 4BAYA 4LLNA 1YFHA 4FD6A 4IVNA 4UV9A 2MLGA 1IRGA 5LRRA 1TBXA 4EGYA 5CVIA 2M30A 2FXAA 5AONA 5ILVA 2P5KA 4BHBA 3KETA 3QPHA 1R00A 4TV7A 1HBXG 3BJAA 1B9MA 2O0YA 3MAJA 4G94A 5ED4A 3JTGA 5FD6A 2BSWA 3F8BA 1FPQA 2FBIA 3BJ6A 3I59A 2P0WA 3GFLA 1M4IA 2ZXVA 4KMUX 1ODDA 2Q8KA 3K9UA 2STWA 2K02A 2XIGA 3M8EA 1XSDA 3ABTA 4A6EA 1X3UA 3VWEA 4M9XA 1MZBA 2OZHA 2FOKA 1B87A 2PBIA 5FLXZ 4XPLA 5IT9K 2JLMA 3SFZA 2J8RA 2PR8A 3I71A 1H9TA 1A04A 5F1RA 2QBYB 3LAJA 3QP6A 3TTHA 2OZUA 1VTNC 4P9FA 1K6OA 1OPCA 5DCMA 4LG0A 1ON0A 4KT5C 2GZWA 2I00A 5DD4A 3MCZA 1ZG1A 1Z9UA 4I2OA 3DFGA 5DEQA 4EJVA 4WCGA 3N97A 3O3KA 4RB0A 4M73A 2ZNYA 2OZGA 2DI3A 2OBPA 5J6XA 1XGSA 4AB7A 2ELHA 2VT3A 5E1ZB 3TO9A 3JTHA 2IP2A 4ENMA 1YS7A 3Q9SA 2PSWA 1HW1A 1U8RA 4HX7A 5LGNA 1NE9A 2Q0OA 1MDMB 2STTA 3IC7A 1TIQA 4EM2A 4G9YA 2C6YA 1S7FA 2EWNA 3VWDA 4HX4A 1IN4A 4HV5A 3Q5FA 4UVAA 3HUGA 2V1DA 4NEXA 2IT0A 3DPTA 3TQNA 5ERIA 1I1DA 3F6VA 1Z4RA 1LDKB 1M1DA 3F8MA 4BMHA 2A3SA 1F4KA 2EA2A 2REFA 2KIMA 3VB2A 2DQLA 3F22A 1YREA 4YFKF 5HS8A 2ARHA 3MFKA 1KU7A 3JW4A 2BEOA 5BOXA 2R8VA 4RGSA 5LHHA 2PJPA 4CAVA 5CJ9A 1U5TB 4HBLA 2ADUA 5AIQA 2AE6A 2QIRA 1C0WA 4O3MA 4HA8A 4U7DA 5L3BA 3I64A 2K7LA 4OIPF 3KP4A 4FD5A 4CAXA 2YX7A 4XPDB 4MEXF 4YRHA 3H4QA 1XMKA 1M4GA 4G7ZF 1YGHA 1XIXA 3RYOA 3RJPA 2P7CB 2EK5A 2HS5A 1LEBA 4NB5A 1F5TA 1FSEA 1R5HA 2E1CA 4H0EA 1Z6TA 1KU3A 3K9TA 2K5TA 5DV5A 2ZBKA 1Y9KA 5D6FA 2FMLA 3E5UA
chains in the Genus database with same CATH superfamily
5EBVA 4XICA 3DXJF 3G1OA 5E17F 1YRNB 2WV0A 2F2EA 3K4NA 2V1UA 3GZ6A 2OV7A 3KP3A 4OIRF 2LTPA 3D3SA 4MTDA 2JA8J 1ZH5A 3F5BA 3EETA 1MBGA 2G9WA 3PFIA 4L9NA 4XRSA 3ZCOA 4B4CA 4RGRA 4XRMA 3T0YA 1AA7A 1CJWA 5K1YA 3ZRGA 4DJLA 2E7WA 2GXGA 3KY9A 4CO8A 3BTJA 3WU2C 1OFCX 1TWAJ 4HKFA 3F72A 3D2MA 4MI4A 1G3YA 4Y4RA 1U5TA 5IOYA 1JHHA 2JBKA 1I5ZA 3LSGA 1D1AA 3CD6I 2OQRA 1DP3A 1TBQR 1S5KA 2VJIA 3SJMA 3H3ZA 2Q44A 1EH8A 2WADA 5GPCA 3RKWA 3Q0WA 4CCOA 2KMOA 1XD7A 2XV4S 3HOVJ 1PUEE 5IOZA 2P5LC 4ZI6A 2IPQX 1M4LA 2HEOA 1X10A 3V7CA 3ZN1A 2VI7A 2QWWA 3GW2A 1D8JA 2GA2A 4IL6C 5C3EJ 1SFXA 4PXDA 4KNYA 2DYRH 5HS7A 1QO0D 1GUUA 4BBHA 3HGYA 4UHTA 1V0CA 1J2XA 3WTXC 1NG7A 3E6MA 1R1TA 3TOBA 1P7JA 1FYLA 3OL4A 5CBMA 1DU0A 4M3SA 3LWFA 1A6IA 1TW3A 4BHCA 3H3UA 4SGBI 2ABZA 3CXSA 3HEFA 1ORKA 2FNAA 1VI0A 3DTEA 4MMOA 3KX2A 2VL1A 4UUTA 5F04A 2I10A 4BQQA 3VE5A 2QPOA 4Q36A 4RGUA 1MJAA 4TWEA 4IZZA 2N52A 3GTPJ 3FZVA 5E3RA 1LDJA 1ZO0A 1MNMC 3ZXSA 3WC5A 3ERED 3AG2H 1UFMA 4CCNA 4EATA 3MWMA 4XMYA 4CGLA 2LY9A 1J75A 2DA7A 5K5QA 3IGRA 4IUSA 2FD5A 1Y39A 1AU7A 2ZEPA 2PEXA 3P7NA 1FNNA 2DQRA 1MMAA 4HEA2 4CYQA 1P4NA 1OKRA 2RDPA 1EJ9A 2PJ8A 4MFKA 1MBFA 2BY3A 2I8DA 3V8LA 2POKA 2JVGA 1KYWA 1BN5A 3FXMA 3TE4A 3KLNA 2OR4A 1IV6A 3ABLH 5LRJA 4ONWA 4ZY0A 3K1MA 2D5VA 3T90A 3K4KA 2HPMA 3L2WA 2AFUA 3OOPA 3PNVA 3WGGA 4FUUA 1BI2A 2FA5A 3RIRA 2PX9A 1ULKA 2LD5A 4MCRA 5AG7A 3UOEA 3NE8A 1FIPA 4G8XA 1WJ5A 2QQDA 1YJ9I 3G1LA 2LREA 5J3LA 1YW7A 5K5OA 4F8ZA 1EV7A 5CQGA 4NGTA 3S9LA 4H89A 4CH7A 2C6PA 2L9SA 4JQFA 3U1KA 5B66C 2R5YA 3UFFA 4R76A 3BG6A 1ULMA 1Z8XA 1AOYA 1W5CC 1JKQC 1D1BA 3HRMA 2Z11A 4CGOA 4G7OF 2V8VA 1Z21A 5M3FJ 2EBJA 2NU3I 5E8IA 1IN6A 4C7IA 3NARA 3A01A 4WWCA 1J09A 1H88C 4PUSA 3OV8A 3H5NA 1HW2A 5F64A 1ZG7A 3D4UA 1RI7A 1KONA 3QOEA 2JA6J 1IUFA 2ELJA 2IGMA 1VHEA 2A4NA 2P4WA 3ERMA 1O4XA 2P6SA 2ESNA 1CT0I 2D4PA 1PUFA 2HB6A 3D7HA 5BWAB 2CMPA 2V26A 2XAHA 2CUJA 1X4SA 3QTLD 1S7KA 2HXIA 4CAEA 1KWMA 2ZJ2A 3LQQA 4S0HB 2VJ5A 1HOMA 3M8JA 5HLHA 1IRXA 1WJAA 1PJUA 5E18F 3I0TA 4BH9A 1TZLA 5C4JJ 2XASA 5KAIC 3RTRA 1G4DA 1H0ZA 4UIBA 5AG6A 4CGPA 3CCEI 3G8WA 1T39A 2UWMA 2F5IA 3A0HC 2L5QA 4Y3OA 3IWGA 2SGPI 1SD6A 2VQYA 2VZYA 3HLPA 2JEWA 5K7FA 4CRZB 3HOXJ 1LJ9A 3H9GA 2R7TA 5IY5H 4ZC3A 1ZHFA 3IWEA 4OC1A 3UY5A 4H6UA 2QQBA 5E20A 1DU6A 4A3BJ 4I76A 4E8OA 3V38A 3WGHA 1IICA 1JKPC 3K70D 1QSNA 2LF7A 1R71A 2ECCA 2ZXJA 1XX5A 2O7OA 4BJTA 4AVPA 4P4EA 2UUZA 3IAS2 2PJ9A 3RYRA 4A94A 2ZW7A 4GYIA 2GKTI 4RAYA 3T1BA 1ZR4A 1VDDA 2P6AC 1IV8A 1T33A 1Y6IA 1QRYA 3LSRA 2YUUA 4R79A 4HOBA 1V3FA 2L7XA 4P6YA 1TNTA 1K7AA 5TJJA 2P6FA 5DUKA 4IHSA 2B3VA 1ZGAA 2CW7A 1XF8A 4MCQA 1IDYA 2GFQA 2KDOA 2H09A 3GYHX 2K85A 2EB7A 4UXJA 1K83J 2R7DA 3FKJA 4AYBN 4N9IA 4BQNA 4XIDA 1S7OA 3J81K 2L4AA 5F49A 2NS7A 3C7JA 3DCFA 1XGNA 4KDPA 3SZPA 4IOAF 5LBQA 2H27A 1WK4A 2WSAA 1YX3A 3VDXA 1BL0A 2IRFG 1ITYA 4MY3A 3M07A 1WPKA 2FU4A 2XEFA 4AVBA 2E19A 2OTJI 1D0YA 5EEGA 1PU9A 2DXQA 4LQGA 4RB1A 3KYLA 2X3TA 2LEOA 3JUWA 4XPKA 3EXNA 3HSEA 3FM5A 2M34A 1FIAA 4C2XA 2FJ1A 4BXUA 2NS0A 2VQHA 5EGOA 3D2PA 2HKXA 4MHGA 5F27A 4IO9F 2LSOA 3FRMA 5LYFA 1SGNI 5EX0A 2Z3PA 3HSFA 3O2PE 1E0EA 4ZY2A 3S8PA 1GVJA 4MLOA 1ETWA 3SXYA 3EFAA 4OADA 2RGVA 3FXLA 4A5MA 2H8WA 4B48A 1IW4A 1LR9A 1FTZA 1W5SA 3HJEA 2PJAA 2NS8A 3U9GA 1QVUA 3MVPA 1W7PB 1MKMA 4E1PA 1JHFA 3IO1A 3ABMH 4RAFA 5L3FA 1LRZA 3FIXA 3FYNA 2ANPA 4HW0A 1G3TA 1W5TA 3JRHA 4OU0A 3TDUC 4M3DA 1Z5RA 2B58A 3J7AO 1NSAA 5GTHC 1XBTA 2CV2A 2FE7A 5GCNA 1U2WA 2FRHA 4AM3A 4RDUA 4IHMA 1GV5A 2CUFA 4OC3A 3K4BA 4MQ9F 2KMRA 2PIZA 4HNXB 2A5WA 1QPIA 3L1PA 3HOYJ 3IIBA 2FL4A 4L0ZB 4F9UA 4XLPF 4ESJA 3FXRA 2PIYA 4DIQA 2ZEMA 4NFRA 5E79C 2FQ3A 4K30A 4G1PA 3B4VC 1TQIA 2DDBA 2GWRA 4HNUA 3FSYA 1OZPA 3FXJA 2GKVA 3RQIA 4J19A 5IYBJ 2ZFWA 4XM3A 3LAPA 1SVMA 1X1CA 3VFZA 1HDPA 5HQ8A 3WHBA 3ZOBA 2XGDA 3PZJA 4HV6A 2HWVA 1VQ7I 3CPXA 3CCVI 1HKTA 2PMUA 2KZGA 4OMZA 1R49A 2XRCA 1OBRA 1T8IA 1TWFJ 3LSTA 4B14A 2R7SA 1QU3A 4MFLA 3EUKL 2VRWB 2TDXA 1SMYF 1MW7A 3H5ZA 2DPTA 1ZGJA 1XMAA 4HAMA 3M9AA 4ZYEA 1S7AA 4MHNA 2EV6A 4MRIA 4CICA 3SI1A 4CZCA 3T8WA 2WPXA 1BC8C 1UAAA 4BNCA 1VHSA 2RQPA 3H36A 4F0XA 4QTRA 9WGAA 2CV1A 2DFHA 2L54A 4A0ZA 2XGXA 5KAFC 2AFZA 3R60A 3LL7A 3B02A 3CLQA 2F4OB 2L02A 4RI1A 4L5EA 2HYFA 2ZJQF 2AXTC 3K1NA 4MIMA 2COMA 2KZVA 3S2DJ 2PJ2A 3GYAA 4B43A 2WAEA 1JUSA 4EWTA 3DDDA 3DR8A 2VODA 2DF5A 3T8TA 1Z9CA 1QHHD 3I55I 1PJRA 1T6SA 5FO5A 3S9NA 4QLCU 4XNFA 3GLJA 2PJ1A 5H2FC 2VOOA 3CO7C 1W3SA 1YK3A 5EZGA 3S6GA 3BR3A 1KUXA 2ROWA 1IO2A 1B6AA 4HQEA 3S3MA 3MN8A 3JAMZ 4PQAA 4A12A 1QA6A 2VKEA 2VC0A 4U87A 1XSVA 2LB7A 1I27A 2YNDA 3IU2A 4IX7A 4RS8A 2KQRA 1HXDA 2X1CA 2VQLA 3ZP5A 3FM3A 5DWNA 3GVAA 3KFWX 3WTTC 1Z67A 1JT6A 3HSRA 2JQ7A 4FE4A 5M5WJ 3F8NA 3S6KA 4UXNA 4XLHA 5EF6A 2HQAA 3KEQA 2CNMA 4NGMA 1MSFC 1FBUA 2IA2A 3MZYA 2M5WA 4ONUA 4MQVA 1HW5A 4E7HA 1TWHJ 1AKHA 4PK3A 4HZFA 2CNTA 1TTYA 5E3LA 4CYPA 2Y2ZA 4CSWA 2OCEA 1Y0YA 3CDHA 4E7SA 3PBBA 4Y13A 4PV6A 4DZJA 3W3CA 3FDYA 2EZKA 2CU7A 2J5OA 4QSHA 4ZJZA 2Q51A 1JWQA 4XKWA 6CPAA 5H6QA 4C2TA 1TWCJ 4XSZF 2J87A 3RZAA 4OAZA 3LSKA 1WCMJ 2PMZN 2YU3A 3OYCA 4P4DA 1IYLA 1S5LC 2QYVA 3JRAA 2ZEHA 4LJZF 1FT7A 2P6GA 2VBZA 3D1NI 3EQLF 1N25A 4MFEA 2G3TA 1P6RA 2PRBA 4OLLA 1M8CA 1YI2I 4HDUA 3CTAA 5J40A 7CPAA 4MHZA 4HLXA 4NF1A 3G3SA 4KOXA 4AUXA 4ZY1A 2VJJA 1ULYA 1F9NA 2XGEA 3UEYA 3IKVA 2ZPAA 4UEEA 1G2HA 4XOTA 4ZH4F 4QB9A 1G3SA 2F5DA 1NXUA 1POGA 1VQ8I 2IJLA 1I3AA 2CQKA 3RQ4A 3PIOF 2I3CA 4EGZA 2ZEFA 3TO6A 3D5LA 1F2OA 2LDUA 2KMPA 4OIDA 4AVAA 3DP7A 1P0HA 3KZWA 3BWGA 3KE2A 2DKVA 2R7HA 2V79A 3FXOA 1TT0A 2LFBA 2Z99A 2V8DA 1ACIA 3I3GA 4EVIA 1GHCA 2OD1A 5KVRA 4R9MA 3QYBA 2HC9A 1FP2A 3LMMA 3G73A 1IG7A 1CSOI 3D00A 1HSJA 1M8BA 2AFWA 2UZ3A 4R3LA 2XROA 1YITI 2D1HA 4HQMA 2A20A 3J80K 3SFIA 3K6GA 2KPMA 2K3FA 2HUZA 1YIJI 3TT2A 3S3OA 4I98B 4R3KA 2C6GA 2EILH 2AS5F 3SQNA 2PJ3A 1R3NA 2CO5A 1I39A 3KP7A 4KUAA 2F4IA 2IBDA 3WR7A 2HR3A 2DA6A 4UUVA 5F09A 1S8NA 5L3CA 2OD5A 3I5UA 1YLFA 1KBFA 1DGWY 1R5ID 3KP6A 3SGBI 1RZ4A 4G7HF 3F6OA 3HBLA 1YE9A 3KQXA 3AG1H 4I0AA 4H6ZA 4M3EA 4MFZA 2KRFA 3JCUC 5D4RA 4D9JA 1HDUA 2IS2A 5J8CA 1TBRR 1ETXA 2DDAA 3C3WA 1U6MA 1V5FA 5FRNA 4ZBGA 3GZ5A 3V8JA 1SGDI 2KIFA 1OYYA 3IWWA 3BTIA 3LQRA 4PJJA 1S6LA 4UCMA 3S2WA 2FBHA 3NQOA 2DTRA 1D1CA 2I79A 4DOZA 4LMYA 3QQAA 2C1CA 2YPRA 4A33A 4XNHC 3MD2A 3RSNA 4RB2C 3RKQA 2FXFA 4YWYA 3ZJ0A 3AL0B 4WX9A 3MEKA 1SFOJ 4TNUA 2MC4A 4Y49B 3L2RA 2EH3A 3BG3A 2CQQA 2BVLA 3WU1B 1B8IB 1YU6C 2VZZA 4EM1A 1O3RA 1SFEA 2PJBA 4OIOF 2O5RA 3W6SA 4II9A 2GIVA 3CJNA 3QAHA 1LE8A 2V6CA 2BBYA 3HIFA 4B44A 4BJ5C 4AG7A 2W82A 4IJAA 4EV0A 4Z65A 1EE3P 4A3DJ 4JXQA 1PCAA 4MCSA 4A3KJ 1FLIA 3AG4H 4DYCA 1PYVA 3BY6A 2BE5F 2FT0A 3CUQC 2GIZA 3TMOA 2BHYA 5IPAA 3D68A 1B8IA 3QWLA 4FISA 1TWGJ 3P2HA 4HRIA 3F8FA 2B0LA 1F36A 1N13A 1K4JA 1S3ZA 5E96A 3WC6A 2HFHA 3RDIA 4P10A 1I50J 3LOCA 3FNCA 3P5JA 2EQRA 3CP8A 3B8GA 1YQAA 2BVMA 4KSAA 4NGRA 2O8XA 1DS2I 4QBJA 1CGPA 2ZCWA 2ZMEC 3T5XA 1IY5A 1QNTA 1VQ4I 3OYFA 3V7RA 4KOVA 2M5XA 2F5VA 3VYUB 3CMAI 5HOOA 1S72I 1IN7A 3PB4X 2CQ7A 2ZW5A 1Z05A 2X48A 1WJFA 4OMYA 1GHEA 2EK9A 3DEWA 3I53A 5AG4A 1KZFA 1MD0A 3OYKA 1XDSA 3BPXA 4BE1A 5CVJA 4CYCA 1RR8C 2V8HA 1W0UA 2A6EF 1MJ9A 4PGGA 4MEYF 1TT5B 3ZMZA 5JHFA 3OY9A 4OIQF 1AYEA 1Q2CA 2B4BA 2XEJA 3FXQA 3R9FA 2TCTA 3H92A 2X0LA 5IYDJ 3GUXA 3HM5A 3BDDA 3SDBA 4PXBA 3PFEA 2GLOA 4YRVA 3CXLA 3IWZA 4Z2YA 3JRDA 1QMUA 1R6RA 3BG5A 3TEDA 1NHAA 2QGUA 2IS6A 2GE3A 2ZW4A 2NVUB 3FF5A 4M72A 2OTLI 1YRNA 4X6AJ 1R22A 3I58A 2JVHA 3GF2A 4FQGA 3JSOA 4ZZLA 1J0RA 2WA0A 4BS9A 1Z0XA 5LD2C 2BV6A 2QECA 2WUUA 3R5CA 2CQXA 5EC4A 3FX3A 4IHVA 2M45A 3VH9A 4CCLA 3LWUA 1NMTA 4MBUA 3KR4A 2ZXIA 3BG9A 2NU1I 4PK2A 1RKWA 4GGGA 5G21A 1AWCA 2V1CA 3GZNB 3EY5A 2KFDA 3ABUA 1SAUA 3HL2A 1Y0NA 3SHFA 1LVKA 1Z2IA 5HLIA 3TP0A 1VIXA 4KJZA 1ZK8A 1CE3A 2CY2A 2W25A 4EQQA 2WAFA 2V77A 3OL3A 3PSIA 2EZIA 3HPHA 5GAHJ 4BJ6C 4GO1A 3FXKA 3HPGA 1R79A 1RTQA 4CS0B 1A5JA 2B3UA 2BY2A 3KHXA 5KTCA 1B59A 3DNSA 2PLYA 4NJQA 3QYFA 5CQEA 4AIHA 3BLNA 5EGOB 1TKFA 3HOWJ 4IK2A 1LDDA 2X7BA 3V7SA 4Y17A 2NMTA 1M1EB 3N05A 3WTVC 4A95A 2PJRB 2X6XA 4D7NA 1UZCA 1ZELA 1AMPA 3W91A 4XR6A 2D45A 4NXYA 4CYDA 5A28A 3Q0UA 4XORA 2GLFA 2FVGA 4JWPA 2K3PA 3IAM2 2KRHA 2QQCA 1RUOA 2JZYA 3V42A 1ZG5A 1OCOH 3FIWA 5E1XA 3VDUA 3GIUA 2YSRA 7WGAA 3GKRA 1U0JA 4B12A 4A2UA 4WP4A 4JD6A 4ZYDA 5D8LB 1HSTA 3OYMA 1W4RA 1TOTA 2HV2A 5D8NA 3OYDA 2Z3YA 1SVLA 3GCMA 3GTKJ 2B5GA 1V54H 1X2NA 2EVNA 3QNVA 5M3MJ 4UF4A 4PCQA 2E5RA 1DDNA 4NGPA 1HEEA 1DGRM 1ZAOA 2IMOA 5IYCJ 2E60A 1FX7A 3P9CA 3WU0A 1QSRA 2F48A 3SJXA 2CUEA 2R5ZB 2E36A 3WTZA 1U78A 5JLWA 3IRQA 4W97A 4MPIA 4UCPA 2Y0MA 3BTCA 2HZDA 4L9TA 5DYMA 3K4CA 3CJRB 5B1AH 3WTWC 2DPUA 1B72A 4IRHA 1GXQA 3CLOA 1PPFI 2ENNA 1ZRDA 4NGNA 1Y8RB 2EIJH 2GANA 1I12A 3NA6A 3UEJA 2L8EA 2M7AA 3NH8A 2BL1A 2V4JC 3PFYA 3IP4B 4GCVA 1FOKA 3B35A 1ULNA 1J5YA 2KJCA 4ZTJA 2M4GA 5D5WB 1RUNA 1UVFA 3E1SA 3CESA 4XQFA 3DTKA 2XKOA 4BU2A 4NGSA 5LYIA 2OVOA 1D5YA 4UCNA 2JMWA 5CLSA 2DA1A 3RO0A 1Y1VJ 4P5OA 1SD4A 1R23A 1LFBA 5JHUA 2L7ZA 1UG0A 1HA8A 2NVQJ 4BXXJ 2JDCA 1OR7A 1MDMA 1ZN2A 2E5NA 3OYLA 2QYOA 2Q2EA 5KCMA 3B6AA 4KOYA 2X9DA 3WODF 1R58A 4UEFA 2M9HA 3VOEA 5BQTA 2EIMH 1RIOH 2MD5A 3IHUA 4KLVA 4UA3A 2M3AA 1L0OC 2IW5A 1WH5A 5IP7J 3FC3A 2M1BA 1Q1HA 2EA4A 2MW8A 3S93A 1V1IA 2Q7BA 5FKOA 3D7DA 3S1QJ 1IRZA 1R57A 4AIKA 1UMQA 4XL9A 3D5SC 2PJCA 3DR6A 3H1CA 3ML6A 4FETA 1CHOI 1RC9A 5HDGA 1XSXA 5E3MA 5J4VA 4Q4ZF 1CP6A 4ABZA 2BUSA 2VN2A 5IT3A 2REEA 3KPHA 2NNNA 3SJFA 4AD9A 3CCJI 1D0XA 3CF2A 4D5FA 3MKZA 3RKYA 4YGOA 2VXZA 1YYVA 2IA0A 3R4KA 4FHTA 3SJGA 2VT2A 5DTDA 4NDLA 2HDCA 1B9NA 5E3QA 3LSIA 4IHTA 4U9ZA 5JM6A 2NU0I 2OF7A 2JW6A 4EJUA 3E6DA 2EFNA 3QODA 2NVXJ 2EV5A 4M9SA 2G7UA 1L3LA 3HB9A 3FXUA 3IKTA 2Q7SA 2LBFA 1HJAI 2DFIA 1PP8F 5J1QA 1A31A 3ZMDA 2V7FA 4UXHA 1BO4A 5E3PA 5HNHA 3KHZA 3CC4I 2ZNZA 1ON2A 5HDKA 3KASA 5JQ4A 3U2RA 1U5KA 4AC0A 4JX6A 2Q4ZA 4I09A 2OCCH 1LPQA 1ETQA 5BPDA 2YU9J 3B3SA 3BJ8A 5HI7A 4OC2A 5HS9A 3JTKA 2P8TA 2QQAA 2X85A 4RS2A 3VSKA 4HX8A 2ETHA 2CFXA 3S2HJ 4BEHA 3PSFA 3FX6A 3IU1A 1T08B 1R36A 2DA4A 4RB3C 4MHPA 2Y30A 1E2XA 3B2YA 1E3OC 4D7MA 3P9IA 2R7RA 2ELIA 2CWFA 2B0UC 3FMSA 2V1XA 4BYYA 1MJBA 2R7ZJ 2J9RA 4RAGA 3VODA 3GTMJ 3R5BA 3LA3A 4XSXF 5C44J 3CCUI 2E2IJ 3J7AY 2LBFB 5FFXA 3ONQA 1FTTA 1QPMA 3CF5F 1P4AA 1P9ZA 2QQ0A 3NFZA 5ELYA 3TFYA 1SD7A 2M8GX 2Y75A 2PN6A 4HF2A 1MMGA 1FBQA 4DNCA 2Z3KA 2AQFA 3JVNA 3LSHA 3HG9A 4JOMA 3LODA 5EEHA 3MKLA 1ZREA 2RKHA 1O3SA 1U3EM 2R1IA 4YG2F 2D2WA 3B3WA 5FUWA 5DWMA 1BJAA 2X1DA 5LLQA 1JGGA 4JJXA 5LRKA 1Y1BA 2EFQA 1QVTA 1PTRA 3O6BB 3HH2C 1W7PA 3UR3C 3ZGKA 3WG7H 4UIAA 5FKNA 2A61A 4HNWB 1ETKA 5IB0A 1FOXA 4M71A 3TO7A 4YELA 3EYIA 1WI3A 3R5DA 2DU9A 2H6CA 2G0EA 2HYGD 4RLQA 1OQYA 2KIQA 2LC2A 1XPXA 4ESFA 1E3HA 2Y0SA 4I01A 1I1SA 3BZKA 3LSPA 3CXQA 1FOWA 2PCUA 3IFEA 3WE2A 3T9YA 1MGTA 3QOPA 1SGYI 3CT9A 5L3EA 2O8KA 5LHGA 4I49A 1Y8FA 3FJUA 4ZYHA 2ORWA 2WTEA 3IH4A 2ICWG 4M85A 2ECBA 3BR6A 4R8FA 4UVCA 4R1HA 4BEHB 2PJ5A 1NUBA 2XSDC 3BROA 4ON0A 1UFHA 2ZJPF 2Z1DA 1CT4I 3EPZA 1HKSA 1X4PA 4A5NA 3K70C 1D8KA 1X19A 1YW6A 1D3YA 3S16J 1DUXC 3K4JA 3L2UA 1LUJB 4FX0A 4ZDOA 1WQ2A 1K78A 3UGIA 4WJBA 4JBAA 5K8NA 2EZHA 2IVMA 1OCTC 1BOBA 5JVTA 1XGMA 1W0TA 2GM4A 3KLOA 4L9VA 1WJCA 5F0HA 2HOEA 4A32A 4I7HA 4PXCA 1LQ1A 2GOXB 5C82A 5HVGA 4R8HA 1Y7RA 4OC0A 1IXRC 3I59B 2F5EA 4RAZA 5DCFA 2OUMA 1FY7A 2CYYA 2Y9ZA 4HGUA 1JKOC 1Q1VA 1N75A 2PMHA 2ZC2A 2CF4A 1P2FA 5FB2A 1F2PA 1IB1E 4UV8A 3W6JB 2K27A 4WXDA 4A24A 3IL2A 3RPUA 1BC7C 4XKCA 3HTSB 1X74A 3H8GA 5LYDA 3TDZC 1KYZA 2FIAA 4CGMA 4C9YA 1K7UA 1YO5C 3W2AA 1KMAA 1BR2A 2IGKA 5GAEJ 3J7YJ 3NEUA 2B4DB 5CNPA 1IN8A 3CCYA 1FC3A 1KUVA 4FT8A 2VB6A 1DPRA 3KP5A 3GO5A 4U88A 4ASNA 4ETSA 5DM6F 1Z7LA 5EZHA 4EJWA 3GTOJ 3CC2I 2BZTA 3OYJA 1RRJA 2V6EA 1XOVA 3CPAA 4NSQA 5IX3A 4KN4X 5CKTA 1HDLA 4EVYA 2HKOA 1OJLA 2KMUA 2OA4A 4UUSA 1QSOA 2VE8A 1STZA 3HXLA 2O61A 4R87A 4XNHB 4WXHA 2O28A 2XDVA 2L01A 2VXKA 2KJBA 4IF4A 1XEBA 2XUBA 3AL0C 1YMEA 2W24A 2UV1A 4F93B 4L0YB 3DBHB 3R0JA 2LNBA 2D1VA 4MNUA 3F8KA 4HF1A 3HGGA 2LY2A 3GLXA 3FECA 4M3BA 3ULQB 4E70A 1G59A 2HI3A 4U5YA 1VKCA 4XRSG 5D5XB 5D5UB 3WTYC 2VBYA 4DGWB 3P2FA 2KKOA 4L89A 4B10A 3CCQI 1TC3C 4X2TA 1TNSA 4BD9A 2XPWA 1T98A 3JREA 5HLGA 3JRCA 5IP6A 4UBRA 1Y56A 2MYSA 1XN7A 2W85A 5DD8A 1OYWA 4HF0A 5BPIA 4ENKA 2QJ8A 5ISVA 3QWPA 1MBEA 3BR0A 4BKXA 1YSJA 3WHCA 1IW7F 4HLYA 3C1DA 5K7ZA 2PE3A 1S60A 4AIDA 4C2ZA 3HKZN 3E5XA 5ILUA 2R7XA 1S7NA 2AFMA 3QU6A 2CW8A 3MMYB 2QMLA 1JTYA 3IUOA 2FE3A 2DN0A 3LA7A 2KDZA 3S14J 4B3AA 2X52A 5LEJA 1JUMA 4YFXF 2R7QA 1WZ2A 5IV0A 4ENNA 2FQ4A 4F91B 1QBJA 4II3A 5A2QK 3D8PA 3GFJA 3WTSC 5C88A 1OISA 1PP7U 4P4BA 2B4DA 3A4CA 1X3ZB 4LB6B 4KOSA 1IN5A 1U6GA 2W4SA 3PDNA 3FSXA 2F5CA 3ELKA 2DA5A 5GADJ 1WJEA 3CJQB 3AG3H 3SEKC 2CTBA 2RREA 1SD5A 3CUQA 4UWJA 1PUAA 4XLAA 5KTDA 1FYMA 2WGCA 4DZPA 3RPQA 1QQ9A 5HH1A 1TF8A 1VF9A 1E3PA 3BR5A 4HPQA 1TBOA 1Y0UA 2IEKA 1WGXA 4A3LJ 5HVQC 4MFDA 1HQCA 5LEKA 3BCBA 3NE7A 1O7LA 4LQ6A 2H94A 4BQAA 4A69C 2WB1A 2CV0A 1H8LA 1EH6A 4EJOA 3F0CA 2HOTA 3OYBA 4PJNA 1K78B 2K86A 4XN3A 4D5CA 2PJRA 4KISA 5E8GA 3FBNB 3DLAA 3IV5A 4O23A 2F6CA 3E97A 3A1YA 1EF4A 3LSMA 5GPAA 2XAQA 1R1UA 3W6KB 3FK7A 4KUBA 4IF5A 4RM3A 1BOAA 4E2AA 2DMQA 4KVME 3B73A 1BI0A 3EO4A 4LGWA 4QC6A 2DA3A 2Z9OA 4BE0A 2FMYA 2JA5J 1ZLJA 3T8RA 1IAWA 2ZOGA 2JRMA 4AVCA 2J8NA 2BOLA 3AFHA 1K79A 1UHSA 3GEZA 5TRDA 2ZSIB 1SAXA 1CQTA 3FKIJ 1YR0A 1YVOA 2G0BA 1TW2A 4M3FA 1GVDA 4MY0A 4Z6YA 1RXTA 4YIRX 1WVRA 2X6OA 1XMTA 4ZX9A 3RZOJ 5F48A 2WV1A 3ASOH 2OAZA 2DK8A 1VQKI 3I4NJ 1SGQI 4UFVA 3TC8A 4N9HA 2R7VA 4B6DA 1HDDC 3ZQLA 2VC1A 1HPTA 3ISXA 4A30A 4KUMA 4M3GA 3TBIA 2M0CA 3R9GA 4I99C 5FKKA 3K2AA 4PZJA 1TGSI 4YFNF 3SXNA 5ICEA 2XF7A 2H6BA 2ID3A 4BL0B 1VQ6I 2WAQN 1NG6A 2DJNA 4A0YA 2V53A 2JYYA 3MGDA 5F0CA 4XBFA 2VBQA 1F1ZA 1SGRI 1FMVA 5KHDA 2ZXHA 3SZTA 4OIWA 3Q3SA 2ZO4A 2DEAA 1FYKA 1I3QJ 4B5PA 1REPC 5ILSA 3R5AA 4KZTA 4P9UA 2CW0F 5BMZA 1Z3XA 2CTCA 1JGSA 2MBFA 2BGCA 2RNGA 5J8FA 4C2YA 5LYLA 1KA8A 1NSLA 3HOUJ 4XOPA 4PSXA 2Z0ZA 1RESA 4HDVA 2B5GB 2VBXA 4F6AA 3JAMK 3GLLA 3W2VA 2OOTA 1X3WB 1Z7UA 2NYXA 1I1GA 3H35A 4BHPA 2FCKA 3E59A 3BJ7A 3FB3A 2IQ6A 5DM7F 3G71I 4W9YA 3HKZA 1L0CA 1RPWA 4C30A 4LB5A 3FHZA 4O5VA 2YS9A 4ZTFA 2JTVA 2VKHA 3TW6A 2HQNA 5D4SA 2UZKA 3SXOA 5F46A 3K2ZA 1Z8LA 2DMUA 2KT0A 3RBUA 4RGXA 3FH4A 1XDUA 3BQZA 2ZKZA 3CQZJ 1OMUA 6PAXA 2WVJA 4UFWA 4GXOA 4XONA 3QYEA 1TXRA 3F21A 2O9LA 4OINF 3VYSB 1TBNA 1Y7EA 3PL8A 3REOA 4EEFG 2R93J 4YFJA 3ROUA 1IRFA 3BP8A 3HHHA 4B47A 4LG0B 2HNHA 5H20A 4BGDA 2X6WA 1S20A 2ZEOA 5CPRB 3PFOA 3S6HA 2ID6A 2AXLA 1RETA 2ACJA 3R6SA 1SQHA 2ORVA 3D5RC 3PO2J 5EG0A 4OOIA 4LUAA 1J4JA 1Z91A 3R96A 3ZMUA 3HHGA 5CCLA 2XAFA 1UCRA 3O8GA 2K40A 5CVRA 2ESHA 2RQQA 4GDFA 3PB7X 3FMQA 3ZQ7A 1XCVA 4HPSA 1MK4A 3ZZIA 5DS9A 3ZMSA 2K9HA 4B5PB 3H0GJ 2XAUA 2O03A 4ENJA 2FF4A 3TOAA 2L3DA 4ZYAA 3HRTA 3K4LA 4CDGA 1LNWA 3P9KA 5GP9A 4EM0B 1SFUA 2EO8A 2P6EA 2ZEGA 1QZEA 4KORA 4M74A 1GLNA 1UELB 3HRUA 3QU3A 3E2IA 3K69A 3F23A 3BOQA 2R7FA 1LEAA 1LR8A 5GTIC 4NNJA 2JPCA 2HZTA 4YU9A 1FAQA 1IYKA 2H5MA 4JLYA 1FSHA 2DBBA 1X1DA 3RI4A 3OS2A 2WC2A 3K7AJ 1WJBA 2DMPA 2NAZA 2Y48A 2QVOA 3E6BA 1MBHA 3DQVC 2ENZA 1G8XA 2EIKH 3QRFF 4H2KA 1CF7B 3OYAA 4OC5A 2R7WA 1FYBA 4ZYQA 1ENHA 3HTUA 2XRNA 2ZSHB 3LFKA 1YLEA 2CFOA 3K0LA 2W00A 2DMNA 3LFUA 4E0AA 3PBEA 1QZZA 2M4KA 3J80Z 4KYWA 2J8MA 5EJCA 3OR1C 1R1VA 1B6BA 5CPAA 5JVGF 2OQGA 2NOGA 1IUYA 3UGDA 2JJ7A 2PDOA 2DFFA 3TP3A 1WGTA 3OIQA 5LRGA 4JXRA 2VONA 1PCEA 4FD7A 2HDDA 4FWUA 1ETYA 3ZQQA 2WB1N 3JRFA 3BI1A 1J59A 5ICCA 1BIAA 1QGPA 1GYTA 2PJ7A 4CAWA 1LFPA 2H8RA 4DQ2A 4LIUA 2LMDA 3A01B 5FFZA 2Q43A 2HGCA 4U0YA 1ZKGA 2HXOA 2R7UA 2V9KA 1U9OA 2Q4VA 5H86A 2ISYA 4DW6A 3ZMVA 3ZN0A 4Y49C 3GX4X 5FJ8J 1FT9A 2CH0A 3IRRA 4MJ8A 4QUSA 3OYGA 1ARLA 4P4FA 2RC4A 1MNEA 3KP2A 3HDDA 1XJOA 3GUDA 3SGQI 2FIWA 1G6NA 2QM3A 3OSFA 2P5VA 1UVGA 2GBYA 3OYNA 4NGQA 2EUIA 2LKSA 2IAIA 2VKVA 2BW3A 3OWCA 3FHNA 1P4WA 3GTGJ 2I5UA 2F5FA 4IOCF 1U5TC 4NC7A 1KQ8A 4PSWA 1UG2A 1M4DA 1WI9A 3H5AA 1IC8A 1SANA 3SI2A 5HVHA 4DYOA 1KU9A 3A0BC 3MZHA 3H9JA 4ESBA 2QCOA 4UVBA 2CXAA 1XMXA 1QSMA 2XAJA 2KMQA 3OYEA 2MG4A 2HTJA 4N0BA 2EWBA 2HPIA 3QPTA 5CVUA 4HG2A 5KK1A 1S3JA 4GYGA 3C26A 3MEXA 4ZGYB 2ZMEB 4P96A 2Z10A 4DJAA 4PFPA 5K5RA 4I6ZA 2PQ8A 3FVLA 1XMBA 2DCEA 2X4HA 2RV8A 2AQEA 2BYVE 2G7HA 2JA2A 2WZNA 3WABA 1BR1A 2ERWA 1EA3A 3F8CA 4C7HA 3AKZA 3KZIC 4B8XA 3DSBA 4OKOA 3H3VK 3QPLA 1EH7A 3N7ZA 1BW5A 2V9PA 2RFHA 1UHAA 5CCMA 4U9YA 2XKPA 3QB8A 5FVJA 1R4NB 1YW8A 2UXXA 3CUQB 2Z33A 2RNJA 2QVPA 3CO6C 1B4AA 3CDIA 2CG4A 1TF9A 4IKFA 4QVTA 1OLTA 1A6QA 2QF7A 4E7ZA 3OS1A 4UEZA 3I4MJ 2L9RA 5B3SH 3V8IA 3BR2A 2O6GE 2XPVA 1HF0A 2GVIA 1W36C 1P4XA 4FCYA 3PP9A 4MHYA 2RIJA 4UNOA 2E71A 2BY1A 2DK5A 1JKRC 1IZ1A 3DLJA 4GFBA 1HLVA 2R98A 2E73A 2PVVA 3V4GA 2EFOA 1NTCA 3PNYA 4EJTA 3K10A 2GKRI 1W4MA 3M8FA 3F3XA 3CMEI 2XEGA 1CT2I 5F0FA 3KZZA 2FOWA 2YX4A 2SGQI 2ZW6A 5G20A 4C2UA 1VGYA 3H0DA 3KR5A 3CMYA 4F0YA 1MMNA 2V9VA 3BI0A 3UKGA 4LOCA 1FWZA 1XS9A 1BLLE 1BPNA 2A6HF 2NXNB 4V19K 2Z3MA 2QUFA 3OIOA 1BAVA 1WRJA 1MBJA 1XC5A 1RO5A 2CSOA 2VI6A 1K7TA 3TKYA 3VYTB 1ZRFA 2FSWA 3BPVA 3FMCA 2NYQA 4P55A 3TGNA 2RB7A 3NH5A 3PUBA 3HOTA 1VQ5I 4B6ZA 5HNFA 3L7WA 3KEOA 4NUBA 1EKEA 3CUOA 1U9NA 3HOSA 1UUCA 4CCKA 2FEZA 4FD4A 1IU8A 1TLHB 5JR3A 1WWZA 3G1MA 2PMZA 3HC7A 2DXIA 3BR1A 1LVAA 1LAPA 4AVZA 1H9GA 3FEDA 4YEJA 1FBSA 3WE3A 3I4PA 2ZENA 3ABKH 5HXDA 4KA4A 1WTJA 1AUGA 4F3QA 2CWHA 3ISPA 3BJOA 5LGUA 4KOTA 4CYNA 3DBRB 4UUSB 3W6VA 2NU2I 3AAFA 3ZQCA 1IY6A 5DDGA 3OWTA 5FKLA 1XX6A 2M2EA 1X1AA 1KQ9A 2IXSA 3DKYA 5FLXK 2MH9A 4CXFA 2L9VA 1OVOA 3BG7A 1ZARA 2DIPA 1CBXA 3PNTA 4PJMA 1ON1A 5H6RA 1Q2YA 2F3CI 2Q4YA 3CCMI 5I0CA 5EX3A 4OMEA 3M7GA 3H8EA 2LOOA 2OZ6A 3JRUA 3LD2A 4P45A 4HSTA 2OC6A 1DTDA 1YHQI 4BINA 2ME0A 1VQNI 4ITVA 4W1UA 4C2MJ 4CHUA 5G1ZA 3C2GA 1NK2P 2DAOA 1XBUA 4LLGF 1BIBA 3HZJA 2SGFI 3B6CA 2HOAA 2PC1A 2DOEA 5D29A 3PJRA 4HYEA 4L5IA 1JJ8C 3IC1A 1T2KA 5EEAA 1LFUP 1UJ8A 3S1RJ 3X2QH 4K2EA 1FP1D 2GQQA 3QPSA 1M44A 4F7ZA 3BZ6A 1NH3A 5K7HA 2YNCA 4A39A 3DEUA 1N71A 2DPSA 3GB0A 2X51A 3BZCA 4XLNF 4PJ0C 3W2WA 5B5EC 2ZOFA 4LX9A 5F6FA 4Q5SF 1OMIA 3DU5A 5JPHA 3W6XA 4FE7A 2LF8A 2VBWA 2VKDA 2EZLA 1K4SA 5M5YJ 1PUFB 3FF3A 2LRDA 4B13A 1W36D 4JK1X 2ZMEA 2ODFA 1ZTRA 5AIPA 4A3CJ 2XB5A 1DS3I 3H9QA 1Q9BA 3NWSA 2Z16A 3CCLI 3PQJA 3ZQIA 3FK6A 5FUXA 2N71A 2VEZA 2P6TA 4L18B 4MTEA 2COBA 4Y7NJ 5M5XJ 1LKXA 2K4BA 1T38A 1N78A 3L2QA 4FKDA 1I21A 2G3AA 1T0FA 2LP0A 1VQPI 2WWYA 4CYOA 1G3WA 2PR1A 3BQYA 4KLWA 2XSJC 4KS9A 1LAMA 2EJRA 3TX8A 1UB9A 1YVKA 2PJ6A 4IHWA 3RAMA 1QSTA 4LLLA 2ELKA 1GV2A 1LE8B 4AWXB 2DPDA 2W1OA 2A69F 4CCJA 2Q04A 2M87A 5EYRA 2JDDA 1FMWA 2R92J 2CNSA 5FD5A 2HQ5A 3PUFA 1IGNA 3N5FA 4G6QA 2VUMJ 1OR7C 4IHXA 2VLAA 4EMEA 2WY7Q 1K61A 5KTAA 1USTA 1HCRA 5FRMA 1J7KA 2H1LA 2L4MA 3R0AA 3MKWB 1WKXA 1WSUA 5CYVA 4AXVA 4KN7X 2KHMA 1ZG3A 3UGLA 4NJRA 4JP0A 1UHMA 2MA3A 3OMYA 2K4JA 2NNYA 3VEPA 4A3FJ 1CF7A 4A2ZA 2ATRA 2YNEA 1CGII 4F55A 1W7PD 2L7FP 2CIJA 4O6JA 1IOIA 2HU9A 1RKTA 1GXPA 2DODA 3SYTA 3BLYA 4B5OA 5JLXA 3KKWA 1XB4A 1GT0C 1IOFA 1APLC 1BBYA 5FGMA 2DT5A 4BACA 3CXPA 3COAC 5K8OA 2JSCA 1V55H 4KITB 2MH2A 2B9SA 3HRSA 5LFAA 2UXNA 5G22A 2YQPA 1CPSA 2BEIA 4IPAA 2N17A 3MQ0A 5TISC 1RR7A 3ISZA 5LRSA 1YW9A 1TP4A 5JHWC 2HYJA 4L5JA 3KQZA 1MMSA 1CM0A 3A9LA 4M6HA 1XE4A 3HUGB 3I9SA 2FSRA 1FJLA 3ASNH 4S05A 3H8FA 3DBLB 2NSMA 1JJ6C 3EUHA 4M6YA 3OXGA 3M1EA 2XVCA 3G2BA 3GFMA 1CGJI 1SGEI 4BY7J 3I54A 1P9QC 2Y9YA 3K1PA 4XKBA 3EYYA 3QP5A 1Q2DA 2G9DA 2A07F 3LMSA 4CPAA 1Z3YA 2VASA 2VOPA 9ANTA 1Y9WA 2XHKA 2DJIA 2VL8A 4B3XA 3EUHC 3K2KA 4PK4A 1V5EA 3CP2A 3S15J 1X2MA 2VXDA 4PGHA 1OCCH 2JRTA 4ZZDA 2WY8Q 5L3DA 4KOWA 5HMNA 2Z3LA 1S7EA 4D0PA 2J9AA 4MGRA 4Q47A 3FEEA 4CGNA 3CDLA 4A3IJ 1Z77A 1VQLI 1WKMA 5L3GA 1F57A 2PVWA 1MSEC 4BDYA 3EUAA 2IGOA 4KIFA 2LKXA 1P92A 3C18A 2DW4A 4M9ZA 5DUIA 2WYRA 1R7JA 3B7IA 1PYTB 4G6DA 3F0AA 1TUSA 4ZDPA 2Q0YA 2L2OA 2EV0A 2PI0A 1S29A 1YIOA 4ZYGA 1OCZH 3HYIA 2OB0A 2AFSA 2N1AB 2GXBA 3DLLF 3GWZA 3J7ZI 3MN2A 2NRAC 3A2KA 4L9MA 4MHDA 3L09A 5DCMB 4J3GA 1ETVA 2O3FA 4I0BA 3J81Z 2JPBA 1LR7A 2E35A 3DV8A 3BT9A 1I6HJ 1IGBA 1FOYA 2QZ8A 1BJZA 1OYVI 4JX4A 4MCPA 2QENA 1ZQ3P 3FWEA 1HC8A 4G12A 4KMFA 2Z3OA 3I56I 2R5ZA 2QEXI 4J01A 1J9IA 3F9KA 1Z4EA 1IXSB 2WPWA 2HQYA 4F9VA 3IH2A 4M6XA 2EFWA 3WTUC 2LKPA 2GA1A 2JT1A 3R1KA 2GAUA 4KVOE 1CG2A 4AIJA 3GTQJ 3S17J 4HNYB 2FBKA 2JUGA 4CUGA 3KEYA 2KRCA 2QQ9A 2R7OA 3E3VA 3PQKA 2RN7A 2W48A 5E1WA 1MT1A 3TJQA 1GDTA 2BO9A 1YS6A 1ZG8A 3DEEA 4NQWA 1LB2A 1RFHA 3S9MA 2NOJB 4KIGA 1KBEA 3BXMA 5F47A 3SHPA 3IH3A 1B1BA 1QHGA 2M8EA 5AG5A 3PEIA 3OIPA 2L9NA 1K6YA 4B09A 4S04A 2HQRA 2L7MP 3Q9VA 1X1BA 1JUPA 4L8AA 4UY8I 1MH3A 2CQNA 3GFIA 5BS6A 4XK4A 4WWVA 3CDXA 5J1RA 5GAGJ 2RVCA 1I6XA 5EMIA 2VPLA 4H4KC 3JRIA 2E1NA 3KIOA 3PB6X 4FX4A 4A3GJ 4LIVA 3ZQFA 1W1WE 2KL4A 2QLZA 4Y33A 4XN0A 5JFRA 1E17A 4Q48A 3L00A 5EDNA 1R9TJ 3E0KA 3WC7A 1XRYA 1R5GA 2CGPA 3DPLC 2E1MB 4OWRB 2A05A 4QIWN 3WGIA 4E7KA 4E1RA 1YX0A 1JI8A 4P4IA 3DKWA 3VWBA 1DP7P 2C6CA 3GXOA 3K4MA 2E7XA 2IA1A 1XGOA 3RYPA 1DE4C 2XF6A 3R61A 3ECHA 4KICA 3U1DA 4IRIA 1BUSA 2MSYA 1WGCA 3RPUD 2ZELA 3GBGA 4V2GA 4K3NA 1ARMA 4U0WA 3UNGC 1ZR2A 2DTZA 2GXAA 2QKMB 4RLFA 4L9JA 4A31A 2QBYA 2DLLA 2OU2A 2OPTA 4RBOA 3WT4A 3BTLA 1XTAA 4KOUA 1USSA 1ONVA 4IAVA 1YJNI 2PG4A 3O8HA 5E3OA 1SMTA 2LYCA 4G6TB 4LG3A 5F1JA 2A6TA 2VE9A 1Q7LA 3PGPA 2MGQA 4AG9A 1O3QA 2D4OA 3L2CA 4QWQA 1OCPA 5LHIA 4ORFA 3SEZA 4CRYB 4C3HJ 1XCBA 2EINH 2ISZA 1IIDA 1BM9A 4UFXA 2W84A 3IEHA 2JWTA 2UVOA 2K9LA 4GRIA 2BUEA 3DU6A 1Y1WJ 2A68F 3VDPA 1V4RA 3KYCB 3IWFA 3CC7I 1IY7A 3IJ3A 5H84A 2XPUA 4WXCA 2K9NA 1ERDA 1Z7KB 4LITA 1P7IA 1LANA 1KGSA 2C27A 1KU2A 4HNTA 2CJJA 3KZYA 2VQCA 2IL4A 5F08A 4C68A 5A27A 4BBRJ 5DS0A 5JI6A 4NC8A 4EMSA 4OAYA 4A6DA 2JEVA 5ICFA 1WH7A 4AU7A 2W7NA 1PDNC 1A36A 4OVOA 1B72B 2HDWA 3BCAA 3GMEA 1Z8TA 2DMTA 2Y0SN 2KCXA 3B3TA 1FZPB 1D5VA 2DOAA 2Y69H 3ZMTA 4C3JJ 2VQGA 1H89C 5IB9A 1OYIA 3RKXA 1K4TA 1IXCA 4CGZA 1IF1A 1ZLIA 3V8KA 3WG9A 1A35A 4WK8F 2PFBA 2OH1A 2BXYA 3JSPA 4FAIA 3KGQA 3A02A 1BI1A 2JUCA 5E3NA 4GS4A 4MXUA 4DUKA 2GREA 4MFPA 1VNDA 3KCCA 1ZLKA 4M6VA 3L9FA 3ZPLA 3G4SI 4RN7A 1ELMP 3DKXA 3S6FA 2B7EA 2YR2A 2BW3B 8CPAA 1ZG9A 4KFCA 2QQEA 3FBUA 4KIBA 1KUYA 3DGVA 1UWYA 4GM5A 1DPUA 3OXLA 2AFOA 4GXHA 2DA2A 3R95A 1P9GA 3V7ZA 1K7VA 4OC4A 2MFZA 5J47A 4LK0F 5IP9J 3JR9A 2ZJRF 2P7VB 2ZB9A 1JTXA 1QQIA 3ECOA 2OJED 3GY9A 4CA0A 2KIUA 4IRGA 1KQ0A 4XRFA 2E2JJ 4FASD 1JE8A 4UWIA 2LK2A 4OAEA 1TQPA 2X1EA 2IS4A 1YX5A 5D6EA 5A2QZ 1OMTA 4XPDC 2K9SA 4R57A 5C4XJ 3FMRA 1VFCA 2EK8A 1TL8A 4A3JJ 2K5CA 2LUYA 2NVYJ 1OCRH 3GOXA 5D5VB 1A2ZA 3NRVA 3I9V2 3EC4A 1O3TA 1TQMA 1O7FA 3H5RA 3PM1A 1TKHA 4LK1F 4JZ0A 3G3ZA 4M6GA 4RM2A 1IDZA 2HVSA 3CMMA 3B3CA 2XAGA 4PDKA 2XB0X 2O4HA 4JYKA 1SFKA 3FBIB 2B63J 4NQWB 3D7FA 1WWXA 4ANJA 1YJWI 2KCWA 4U0VA 2FX0A 5TGTA 1H8AC 2V1NA 3Q0VA 1Z6RA 4I02A 1BI3A 3OR2C 1HKQA 3LA2A 2MC3A 2QKLB 1V5GA 1JXSA 5HDNA 3DF8A 5ICGA 2LH9A 2WAQA 4YIFA 4NCZA 1NK3P 2PJ4A 3N4MA 2F4MB 3VATA 1O57A 2P81A 2HTSA 2L0KA 2W57A 5D8KB 3LNQA 4DBQA 2FNPA 2ZFUA 1YTYA 1S7LA 2GLJA 1U8BA 2AO9A 4X5KA 3BJIA 3GTLJ 2F8HA 4Q38A 3E6CC 4KVXA 1BA5A 2TRTA 4LFUA 4CZZA 2NU4I 2CWEA 4BXFA 2F7VA 5FROA 4P44A 4A38A 5JGFA 2JBJA 5HLTA 1ZRCA 3PO3J 4Y52J 1UHWA 4NHJA 1H0MA 3TL4X 5FUYA 3SI0A 1YG2A 5CVVA 5LGTA 3KI9A 4P4JA 4B11A 2DO7A 4IXAA 4HNVA 4FTHA 1Z1DA 2R3SA 5IT9Z 4WF2A 2V1CC 1RNLA 2E34A 2K9MA 1KZHA 4GI3C 2J5PA 2MLKA 3JRGA 4E7JA 4LD5A 2QSHX 2Y31A 4JCVE 1TKJA 3FXTA 1X4OA 4BDZA 2EFPA 4A0XA 4MFQA 2DT6A 2AJ6A 4Y15A 1ZYRF 4UXIA 2Z5UA 2R5YB 3EDPA 3D0SA 2BOAA 1VQ9I 5K8PA 4PFOA 3MZ8A 4YIIA 1QZYA 3E5QA 1N77A 2FS5A 3C2BA 4NC6A 1X12A 1VQOI 1FARA 1X58A 5J1YA 2A5YB 2HVQA 4U7BA 3OVOA 3TW7A 3R9EA 3PB9X 4BAYA 3TCVA 4LLNA 1YFHA 4FD6A 4JX5A 2E5ZA 4II2A 3NWTA 2GOMA 4IVNA 5J4YA 2W0TA 4UV9A 2MLGA 1IRGA 5LRRA 1TBXA 4XKVA 2WCYA 3L2VA 4EGYA 5CVIA 5JH9A 2O53A 2M30A 2FXAA 5AONA 3S32A 5ILVA 3CJTB 4DYQA 4A3EJ 2P5KA 1CP7A 1LCPA 4BHBA 4MFJA 1S9HA 3E0JB 2ARPF 2KLOA 5B1BH 3QPHA 3KETA 1T95A 1Z8WA 2IJZA 1R00A 4TV7A 4J00A 1HBXG 3BJAA 4R6TA 3VYRB 1B9MA 4D1QA 2O0YA 4RMNA 1AHDP 3MAJA 4G94A 3MKYB 5ED4A 4BY1J 3JTGA 1TIHA 5KNLA 3RNZA 3S1MJ 1YLOA 2BHZA 5FD6A 1FEXA 2BSWA 3F8BA 1FPQA 5HODA 2CJSC 2FBIA 2P0WA 3BJ6A 3I59A 1BMOA 3GFLA 3ZQHA 1AN1I 1BPMA 2M0MA 3OL0A 4CYCB 1M4IA 2ZXVA 4KMUX 1ODDA 3SDGA 3M1CA 2Q8KA 3G6EI 4OP4A 1CX8A 3K9UA 4P1WA 3MRUA 1BW6A 2CUZA 2JK3A 2K02A 2STWA 2N8GA 1SVOA 2XIGA 3M8EA 4DBRA 2V8GA 2IGNA 1XA6A 3OS0A 1XSDA 3ABTA 3DTIA 4A6EA 3PB8X 1X3UA 3D7GA 3VWEA 4M9XA 4IQJA 1MZBA 2K9QA 5EG0B 2XC7A 4AMLA 2FOKA 1B87A 2PBIA 4NBQA 1XFOA 2OZHA 3VSLA 4PXEA 1HEVA 3B3VA 2JN6A 1JT0A 1YTPA 5FLXZ 2B8TA 5FUVA 5AGEA 3CCRI 3CZ6A 4XLEA 4XPLA 1R0RI 2Z2SB 2QA4I 1HDQA 2YGWA 3D67A 5IT9K 2E2HJ 2JLMA 3SFZA 2J8RA 2PR8A 1ELLP 2MABA 1VQMI 3I71A 1H9TA 1A04A 1ZGWA 2XRLA 1WJDA 2XGCA 3U21A 5F1RA 2QBYB 2R4GA 2E1OA 2ZXWH 3NAUA 4IQ4A 3OSGA 1VHOA 4N4OB 3LAJA 3QP6A 2YNCC 3TTHA 4E4HA 2DOFA 2OZUA 4C3IJ 1SC7A 1VTNC 4P9FA 2DB6A 1K6OA 1OPCA 5DCMA 3S1NJ 2GU2A 4X3RA 1R43A 4KSIA 5THWA 1Y0RA 4LG0A 1ON0A 1DQUA 3OOUA 4KT5C 4MO7A 2GZWA 2I00A 3HOZJ 5DD4A 2VIXA 2JXDA 3MCZA 1ZG1A 4F52A 1Z9UA 4I2OA 2WBMA 3LSJA 4E7IA 3DFGA 2AHQA 2CWGA 5DEQA 2Z3NA 2XF5A 4EJVA 4WCGA 2ZEEA 3N97A 3O3KA 4XLCA 1ZLHA 3ZQGA 4RB0A 3GTJJ 3CCSI 4M73A 3SEQA 4XLFA 2XEIA 2ZNYA 1T0FC 2OZGA 3KYDB 4PPZA 2R0QC 2DI3A 2OBPA 2VJ4A 1XGSA 5J6XA 5FLVA 4AB7A 2ELHA 2VT3A 3BC8A 3OYIA 4UB6C 1MIJA 5E1ZB 3TO9A 3S3NA 3L2NA 3JTHA 2BY0A 2IP2A 4ENMA 1YS7A 2EPFA 4E7LA 3Q9SA 4N4NB 4A93J 2X6YA 2KP6A 1HW1A 1U8RA 4HX7A 2PSWA 5HVFA 5LGNA 1NE9A 2Q0OA 1MDMB 1AKHB 2STTA 1YW4A 2EBIA 3IC7A 3RCOA 1TIQA 3ZR8X 4EM2A 4CAFA 1ETOA 4EFDA 3D66A 4FBEA 3SZGA 2ZEDA 3I3LA 4G9YA 2C6YA 1MNDA 1D0ZA 2EWNA 1S7FA 1WHUA 4IEJA 3VWDA 4HX4A 3SJEA 2PRQA 4KT6A 1CPXA 1PVEA 1WFXA 1IN4A 1V1HA 3NH4A 4HV5A 4R7MA 3Q5FA 4BUPA 4A3MJ 1MH4A 4QPQA 3OXFA 4PJLA 4AYBA 3KL9A 1MBKA 2QQ8A 4DYRA 1SEUA 4UVAA 4JYWA 3HUGA 2SGDI 1FNOA 4F92B 2M7BA 2V1DA 5FLMJ 2IT0A 3DPTA 3TQNA 3RU0A 4NEXA 5ERIA 1I1DA 3F6VA 1Z4RA 4KSFA 4A37A 1LDKB 3BHXA 2LLKA 1M1DA 3F8MA 1SGPI 1YQEA 4BMHA 2A3SA 3QAYA 5DAEA 2AFXA 1F4KA 2EA2A 2LY1A 4E6KG 2REFA 2IS1A 1MMDA 2KISA 2QSGX 5K8MA 2KIMA 1BR4A 3VB2A 1LOKA 4V2FA 2DQLA 4X1EA 3F22A 4YFKF 1YREA 3PRTA 2Q1ZB 3FISA 5HS8A 4X0GA 2ARHA 3MFKA 3CZXA 3HUVA 2QSFX 2VPRA 1KU7A 3C2HA 1F43A 3JW4A 2ODDA 2BEOA 3I1UA 5BOXA 4IHYA 5FKMA 3PIPF 2R8VA 3A03A 4RGSA 5LHHA 1IJWC 2PJPA 2FUG2 4HSRA 4CAVA 1LFWA 1Y8QB 2YUSA 5CJ9A 1XG1A 1U5TB 2H1KA 4HBLA 2ADUA 3E7LA 2NVTJ 3OYHA 2JZMA 4BQOA 5AIQA 2HVRA 3VPRA 2AE6A 2Q2EB 2BCOA 1TURA 2QIRA 2DT7B 3DPUA 5J1UA 4CCMA 2DYSH 1C0WA 4O3MA 3DWLE 2JA7J 3JRBA 4BBSJ 1JQGA 2HOSA 5I4MA 4HA8A 4U7DA 5L3BA 3I64A 4RA2A 2BXZA 3LACA 2DFEA 2K7LA 4OIPF 1PTQA 4X8IA 3KP4A 2FNFX 4Q7AA 4FD5A 4BE2A 4CAXA 2YX7A 4QPOA 4B1RA 1X1PA 4XPDB 1Y1CA 1Z2LA 1R4MB 2MD0A 4MEXF 4YRHA 1VZ0A 3M4OJ 3H4QA 1XMKA 1M4GA 4G7ZF 1YGHA 1YOVB 1XIXA 2LVSA 4ZDLA 3RJPA 3RYOA 4ZX8A 2EK5A 2HS5A 2P7CB 4RUHA 2CS3A 2JSPA 2L7KA 4UB8C 4NB5A 3RZDJ 1F5TA 1LEBA 2JA1A 1FSEA 1R5HA 2E1CA 4H0EA 2PJ0A 1Z6TA 1KU3A 2E1MC 2LR8A 3K9TA 2SGEI 2K5TA 2CRGA 3M3YJ 5DV5A 2ZBKA 2ME6A 1Y9KA 3VARA 5D6FA 3ESWB 2FMLA 2RAEA 1T56A 2LG4A 5BNGA 4M6IA 3E5UA
chains in the Genus database with same CATH topology
5EBVA 3DXJF 5E17F 2WV0A 2F2EA 2V1UA 3GZ6A 3KP3A 4OIRF 3D3SA 4MTDA 1ZH5A 3F5BA 3EETA 2G9WA 3PFIA 4L9NA 4RGRA 3T0YA 1CJWA 5K1YA 2E7WA 2GXGA 4CO8A 4HKFA 3F72A 3D2MA 4MI4A 1G3YA 1U5TA 1JHHA 1I5ZA 2OQRA 1S5KA 2Q44A 3H3ZA 1EH8A 3RKWA 1XD7A 2XV4S 1PUEE 2P5LC 2IPQX 2HEOA 3V7CA 3ZN1A 2VI7A 2QWWA 3GW2A 1D8JA 2GA2A 1SFXA 4KNYA 5HS7A 1QO0D 4BBHA 4UHTA 1V0CA 1J2XA 3WTXC 3E6MA 1R1TA 3TOBA 1FYLA 4M3SA 3LWFA 1TW3A 4BHCA 3H3UA 3CXSA 2FNAA 4Q36A 4RGUA 1MJAA 1ZO0A 3FZVA 1LDJA 3ERED 1UFMA 3MWMA 4CGLA 1J75A 5K5QA 3IGRA 4IUSA 2PEXA 3P7NA 1FNNA 2DQRA 4CYQA 1P4NA 1OKRA 2RDPA 4MFKA 3V8LA 1KYWA 1BN5A 3TE4A 3KLNA 3K1MA 3T90A 3OOPA 3WGGA 1BI2A 2FA5A 3RIRA 5AG7A 4G8XA 1YW7A 5K5OA 1EV7A 4H89A 4JQFA 1AOYA 3HRMA 2Z11A 4CGOA 4G7OF 5E8IA 1IN6A 4C7IA 4WWCA 3OV8A 1HW2A 5F64A 1RI7A 2A4NA 2P4WA 2P6SA 2ESNA 2D4PA 5BWAB 2XAHA 1S7KA 4CAEA 2ZJ2A 3LQQA 5HLHA 5E18F 3I0TA 4BH9A 4CGPA 2XASA 5AG6A 3RTRA 1G4DA 3G8WA 1T39A 2UWMA 2F5IA 3IWGA 1SD6A 2VQYA 2VZYA 4CRZB 1LJ9A 3IWEA 1ZHFA 3UY5A 4H6UA 2QQBA 5E20A 4E8OA 3WGHA 1IICA 1QSNA 2LF7A 2ZXJA 4AVPA 3RYRA 2ZW7A 4GYIA 4RAYA 3T1BA 4R79A 4HOBA 1V3FA 1TNTA 1K7AA 5TJJA 2P6FA 5DUKA 4IHSA 2B3VA 1ZGAA 1XF8A 2H09A 3GYHX 2EB7A 2R7DA 4N9IA 1S7OA 3J81K 2L4AA 5F49A 3C7JA 1XGNA 4KDPA 3SZPA 2H27A 5LBQA 1WK4A 2WSAA 2IRFG 4MY3A 2FU4A 4AVBA 5EEGA 1PU9A 2DXQA 4RB1A 3JUWA 4XPKA 3EXNA 3HSEA 3FM5A 4C2XA 4BXUA 2NS0A 3D2PA 2HKXA 4MHGA 2LSOA 3FRMA 2Z3PA 3HSFA