1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ESA1 PROTEIN
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
1JHFA 2V79A 5E8IA 3EO4A 2XAQA 1BI0A 3F0AA 3ZMSA 4X5KA 4HZFA 3NEUA 3ECHA 4AD9A 2B5GB 2MA3A 2TDXA 1FPQA 1KZFA 4RGSA 1XIXA 4QBJA 1IN4A 1KUVA 4CAWA 5JHUA 5ILUA 2KIFA 4BAYA 3GF2A 3I4PA 1LDDA 3R95A 3BWGA 3Q5FA 3H3UA 2QUFA 2DK5A 3SQNA 3S6FA 5ICFA 3RPUA 3F8CA 3HRUA 3KZYA 4U0YA 4XPDC 1KA8A 2QVOA 2YX7A 1FT9A 4H6ZA 5BPDA 3KFWX 4R3LA 3SHPA 2EFOA 4R1HA 4LX9A 2V9VA 5ILSA 2XAJA 1FYLA 3U1DA 4KOYA 2RDPA 4BXUA 4XNHB 2PG4A 1RZ4A 2VOPA 3I59B 3V7RA 5HS9A 1LB2A 3O3KA 4IJAA 1VKCA 3N97A 1OYWA 4HDUA 4R9MA 2PMHA 2RQPA 4KOUA 3VOEA 3HOTA 3TO7A 4BNCA 2HQNA 2XGXA 1FC3A 3KLOA 3Q9SA 4YFNF 3BOQA 2REEA 1R00A 4U0WA 3D0SA 2HTJA 4BHCA 1H9GA 4B8XA 3GW2A 4QLCU 2M87A 4EGZA 4RB2C 4PK2A 5BS6A 1BC8C 1S7LA 2PR8A 1OZPA 5D6FA 1S7KA 4A0XA 3DP7A 2MD5A 4QWQA 5ED4A 2P5LC 2VEZA 1YX0A 3DR8A 2BSWA 5BPIA 3VB2A 3K9UA 2K4BA 1MDMA 5CNPA 1K78B 3IWZA 1U5TC 3ZMVA 1P0HA 3OOPA 3D8PA 5E8GA 4Z2YA 2JPBA 3H92A 2PI0A 4KVME 2JDCA 2ZMEA 3TOAA 3WTZA 1OR7A 4ENKA 2FE3A 1UFHA 2NNYA 4AVBA 3F21A 2IT0A 3P7NA 1PUAA 4IRIA 4OINF 3RKYA 3K9TA 2DPDA 4MY0A 3KP7A 3WGGA 4UBRA 1UHWA 5J8FA 3TFYA 3KE2A 4XLNF 3CLOA 1JGSA 3FHZA 4P9UA 2VC1A 1XN7A 4P96A 2VN2A 2JPCA 4R3KA 4ESJA 5D8LB 3CXPA 2QYOA 3JAMK 3V8KA 3W6SA 3V7SA 3CXQA 2REFA 3BJ7A 1YIOA 4MTDA 3F8NA 3KP2A 3DPLC 5LHIA 3EQLF 5CYVA 2DAOA 3CO6C 1HW1A 4BH9A 1KYZA 3BP8A 2XHKA 2CY2A 3GLXA 4BMHA 4M74A 1G3WA 2FU4A 4WCGA 1U6GA 1ZYRF 1PDNC 4LB6B 4IHSA 4ESBA 5TRDA 1Z6RA 4FD7A 2GWRA 3BDDA 3RIRA 3WGHA 4S05A 1DPUA 1AOYA 2O3FA 5F48A 2XAFA 2IJLA 4IHTA 4KN7X 4KVXA 2QECA 3T9YA 2QBYB 4RB3C 2YSRA 3EYYA 1XD7A 4EGYA 1ZAOA 1W7PA 1PUEE 2QQAA 2HEOA 2F5IA 5HDNA 2DK8A 1D5VA 3GZ6A 2IPQX 4ONUA 4OIQF 3C18A 2E1NA 2K4JA 4HNXB 4WXHA 1T98A 1B9NA 1O3SA 2F5DA 3E6CC 3DNSA 5A2QK 1KGSA 3GX4X 1JHHA 3L09A 3IKTA 2K02A 2VBYA 1EV7A 2P6FA 1CGPA 2MLKA 4UHTA 3VWEA 4F6AA 2CNTA 2ISYA 2A5YB 3BJOA 2B58A 4MQ9F 3N7ZA 5F47A 2NS0A 4MI4A 5ISVA 3EC4A 4MQVA 3S6KA 2D2WA 2DW4A 4U5YA 3C1DA 2XKPA 1Z9UA 3KEQA 4M6XA 2LF7A 4HF0A 3TTHA 3WG9A 4L5IA 3H4QA 4L9TA 2EJRA 3FXRA 3ZN0A 4CYDA 4HLYA 2A61A 2GQQA 3RPQA 4LJZF 4IRGA 2VBQA 3ZMUA 2GA1A 4M6YA 2WTEA 2HWVA 4FX0A 2FS5A 4MEXF 1TQPA 1QO0D 4CS0B 4UWJA 4KMUX 2EWNA 3BJ6A 5JVTA 3FXUA 1ZRCA 4OMZA 4QVTA 1KU9A 1GHEA 3GFLA 1ZARA 5DCMA 5DCFA 4G94A 4CGZA 1ODDA 3C7JA 2FBIA 3FZVA 3M7GA 1PP8F 5HDGA 4L8AA 2UWMA 5HDKA 3CTAA 4RGXA 5KTAA 2H94A 4O5VA 3LQRA 4B09A 2ADUA 1SD6A 1V3FA 2FOKA 1K78A 2ZXVA 3RYOA 3QU6A 2VXZA 2HFHA 5J8CA 1XEBA 1RUNA 1QSNA 2H09A 2EUIA 4OU0A 2J8NA 1NHAA 2VT2A 3COAC 1R22A 3IRRA 2JT1A 2PFBA 2KJBA 1XCBA 5F1RA 3ISPA 2X4HA 4M71A 2QBYA 2FEZA 1CF7A 2DLLA 5IT3A 2IA0A 2G9WA 1WWZA 4U0VA 4PDKA 2AJ6A 1IXSB 4FD6A 4H6UA 4D0PA 4JXRA 4P5OA 1PP7U 3WTVC 1I12A 2KIUA 3PQKA 2VBZA 5GCNA 2PMUA 5D8KB 4HNWB 4ZZLA 1XCVA 2ZMEB 2P8TA 2OZ6A 1RXTA 1HW5A 4LG0A 2CFXA 4UVCA 5H20A 2FSWA 1XSXA 4I0BA 3W91A 2I79A 1S3ZA 3HIFA 3KP3A 3J81K 4FD5A 3DEUA 3FIXA 4IPAA 1P4WA 3TO9A 2FMLA 4U9YA 2A69F 3JTHA 1FYMA 3LFKA 4WXDA 3ZMZA 5FFZA 5DEQA 3RI4A 2IW5A 3ZJ0A 1J75A 1TLHB 3AAFA 1IW7F 1Y9WA 2BEOA 2VT3A 2AXLA 2YPRA 3J7AO 1O57A 2W85A 2EFWA 4KMFA 1S60A 2CNMA 1LVAA 2J5PA 2P7CB 2JEVA 1U5TB 3R0JA 2Q7BA 5EEGA 5CJ9A 3F6OA 3SXNA 1KYWA 1HBXG 1V0CA 2DQLA 5KK1A 2GE3A 1TIQA 3E6DA 3BJ8A 1BI3A 2F5EA 2WV0A 5LGUA 1TQMA 4G6DA 1J9IA 3DV8A 1R57A 3F8BA 2FSRA 2DFIA 3WTTC 3DPTA 4HV5A 1IIDA 3LD2A 1GHCA 1BIAA 1IZ1A 2EA2A 1Y9KA 3B8GA 2FRHA 1I1GA 1IB1E 4OIPF 1XE4A 1J5YA 4A5NA 3MFKA 5HMNA 2CO5A 4HX4A 1LRZA 1SFXA 4GYIA 4Y49C 1S3JA 4UNOA 1Z7UA 4AG9A 2Q2EA 2B3UA 3WGIA 2H27A 5CVIA 1ZRDA 4EJVA 3FXQA 1F4KA 3VWDA 3KEOA 5DWMA 3DQVC 2Z0ZA 5ICGA 3P9CA 5LLQA 5LGNA 2YU3A 2VE9A 3NRVA 1D8JA 3R96A 4K2EA 5KVRA 4ENNA 4BHPA 5JR3A 4B5PB 2STTA 1MJ9A 4YIIA 1P4NA 1J2XA 4S04A 5LHGA 2H5MA 1G4DA 4LK0F 2FA5A 2ZW4A 4HDVA 2J5OA 3BROA 2XUBA 1J59A 4QB9A 1QNTA 3L9FA 3W6KB 4HQEA 2CQKA 3SZTA 2KKOA 5F46A 4GO1A 3TO6A 3DXJF 3OWCA 5CVJA 4TV7A 2HUZA 1M44A 3M1EA 3HTUA 2ZFWA 4B5PA 4PSXA 4Y49B 1Z1DA 3P2FA 4YFJA 1HKSA 1XGMA 4JBAA 4HKFA 2L3DA 3K69A 3I54A 1YW7A 2EA4A 3ERED 3VODA 3GFJA 2CYYA 4R87A 4UA3A 3VFZA 4FHTA 1MGTA 2W24A 2Z10A 4ZBGA 4WXCA 3EYIA 5FGMA 2RN7A 2WPXA 3LAJA 3RKWA 5L3BA 2G7UA 4E8OA 2K86A 3GZ5A 2NYXA 2VXKA 2HQRA 2BUEA 1XGNA 4N9HA 1LDJA 4ENJA 2OAZA 5C88A 5E1ZB 3HHGA 4LLNA 2VE8A 2Y75A 2W84A 1LEBA 4EVIA 4IUSA 4QC6A 1PU9A 2ARHA 4EJUA 1XGOA 3T8RA 4ZYDA 2CW0F 3KKWA 3I58A 1I21A 3IKVA 1USSA 3TDZC 2W25A 4DQ2A 4J3GA 1MJAA 2DTRA 3LAPA 1FZPB 1S7OA 3FX3A 3ROUA 2GANA 2D1VA 4JK1X 2E1CA 4N0BA 2BGCA 1IYLA 2QMLA 2DXQA 3GKRA 1KQ9A 2NNNA 3VEPA 2O28A 1YLEA 2Q0YA 2PJPA 5AONA 1QZZA 1UHMA 2HYGD 4GGGA 4JD6A 2Z33A 1YR0A 4YRHA 4NHJA 1JE8A 3FMRA 3WE3A 4L9NA 1WKMA 1MD0A 3E6BA 2CWEA 5DWNA 1FX7A 2K5TA 3R9EA 1MDMB 2EFPA 1MK4A 2Y0MA 1GXPA 2QQ9A 3KP5A 1U6MA 3KP6A 2QZ8A 2B4BA 4A6EA 2OZHA 3V8LA 3HRSA 1S7FA 2D45A 1MJBA 2M1BA 4NQWA 1IICA 2BYVE 3I3GA 4MNUA 3TQNA 1XDSA 2JLMA 3FF5A 3B73A 4HV6A 2XAGA 2RGVA 3HRTA 4IXAA 1B1BA 3QAHA 1XMKA 2XRNA 2L54A 3ELKA 2NMTA 2ESHA 4GS4A 4R57A 4ZYHA 4ETSA 3R4KA 1YK3A 4MTEA 1WK4A 1W7PD 1IXRC 3FWEA 4AIHA 2KJCA 4JJXA 5DDGA 4YFXF 3MAJA 2GAUA 2WC2A 2XROA 2EK5A 5BMZA 2W57A 4DNCA 2CNSA 5HLHA 3JVNA 1S29A 1H0MA 2HDCA 5FLXK 4KIBA 1A04A 2NAZA 4KVOE 3RTRA 1D8KA 4CO8A 4KNYA 1T39A 4LFUA 1FLIA 2M30A 5JFRA 3RDIA 1L0CA 1I27A 4AVAA 3REOA 1FBUA 2V6CA 3WTUC 2ETHA 2V1UA 3UY5A 3GVAA 1RNLA 3DDDA 1F1ZA 1GVJA 4HBLA 2ZXJA 3I64A 2RVCA 1OKRA 4A5MA 3MCZA 2OH1A 4G9YA 2UXXA 2P5KA 3GYHX 3R9GA 2B4DA 3ABUA 1FBSA 2EV5A 3K1PA 3W6JB 1P92A 1I1DA 2L4AA 3LSTA 3JSOA 5H6QA 2WWYA 2A4NA 1ONVA 5JQ4A 3H3ZA 1NE9A 1NSLA 3ZZIA 2VONA 4O3MA 4XPDB 1K7AA 3CUQC 2ELHA 4I09A 1IAWA 1Z91A 2E7XA 1KUYA 2OD5A 2BV6A 2RKHA 1G3SA 4Q47A 3O2PE 2OZGA 3MEXA 2OA4A 1N71A 2OBPA 1REPC 4N9IA 2JZYA 2M5WA 1YYVA 1YGHA 1OYYA 4HA8A 2Y48A 3DKWA 4HYEA 5HLIA 1EH8A 4RGUA 1I1SA 4Y15A 3F3XA 4LUAA 1I5ZA 1S7AA 5E1WA 1VHSA 1K4JA 2R1IA 3DFGA 5L3GA 1YVKA 4KLVA 2R7DA 4ZZDA 2HV2A 4A0ZA 4XRFA 2P4WA 4I98B 3GY9A 4CICA 2FF4A 2O03A 3D3SA 2B0LA 2Z3YA 2A6HF 4RB1A 5JPHA 1Z4RA 3L2CA 3TT2A 2QENA 3PP9A 2D1HA 3QB8A 4RAYA 1SMYF 1W4MA 3P9KA 4RAZA 3J80K 2XV4S 2PN6A 6PAXA 2IVMA 3CUQB 4IVNA 1UB9A 4CZZA 2KIMA 3WE2A 1XGSA 2LF8A 1LJ9A 4EJWA 3D2PA 2VBWA 4XPKA 1R58A 1TBXA 3JTGA 3IWFA 4L9JA 4KT5C 5HS7A 4CDGA 4H0EA 1QQIA 4BHBA 1Y0UA 1YG2A 3LA7A 3NE7A 1HSJA 5IV0A 1FP1D 5LHHA 1U3EM 4BYYA 4RGRA 2B3VA 2KCWA 5KTCA 3T1BA 2JRTA 4A12A 4KUAA 3BZ6A 3FYNA 4KLWA 2Z5UA 5K5RA 3WTSC 3U2RA 2J8MA 2HR3A 1IN7A 3E5QA 4WF2A 3MZHA 3E5UA 1RO5A 2R8VA 3EUHA 4MEYF 5D5VB 4KORA 4ASNA 4LMYA 4K30A 1AWCA 1BI2A 4HOBA 4P9FA 4AIJA 2ZCWA 3CJNA 2Z11A 4KA4A 3SZPA 3I71A 3HTSB 3G3SA 3SHFA 2ATRA 4HX7A 2M8EA 4AIKA 4AVCA 4GXOA 2X7BA 4U7BA 4KIFA 3K0LA 1O7LA 2OB0A 2L01A 3M8FA 3RJPA 4JQFA 3QOPA 2ZO4A 3LODA 3HRMA 2R98A 2C27A 3FNCA 5LEJA 3GYAA 5CVRA 3QP6A 5L3FA 5DYMA 4MGRA 2A3SA 1EH6A 4EM1A 2XAHA 4KN4X 4WX9A 2YX4A 1KQ8A 2P0WA 3V8JA 2H6CA 1IRGA 2VI7A 1DDNA 2K27A 5ICEA 4KYWA 4EM0B 2HKOA 3EFAA 2ZW6A 4UXNA 2O61A 3C3WA 4ON0A 1VTNC 3F5BA 3IRQA 4CXFA 1H9TA 1QBJA 5K5QA 1SAXA 1TTYA 3D2MA 1R1TA 3QRFF 4KOTA 4HW0A 2L02A 4I02A 3J80Z 2HTSA 4XPLA 5F64A 1IF1A 1IN5A 2EVNA 5DD8A 1B4AA 2K7LA 1WSUA 4EVYA 4M9ZA 3IGRA 3M9AA 5ERIA 3TGNA 1FSHA 2MC3A 4PZJA 3F8MA 3JSPA 1YS7A 3HHHA 1CM0A 5H6RA 3HSFA 3F22A 5D4RA 3WR7A 1R7JA 1ZLKA 1UCRA 2H6BA 3E6MA 3FMSA 5FD6A 3I53A 3ZP5A 2LNBA 5E18F 4M73A 1YLFA 2BBYA 1RI7A 3F6VA 1GXQA 1WQ2A 3GWZA 4L89A 1QSTA 4U88A 1V4RA 3MZYA 4OAEA 3PFIA 3NQOA 4R79A 3R60A 1BO4A 4PGHA 5DV5A 3GFIA 2X0LA 5KTDA 2FNAA 2ESNA 5EBVA 2QLZA 1BIBA 4HQMA 1T2KA 2A07F 5K5OA 2FIAA 2PRBA 4KOSA 2QWWA 3OV8A 2QM3A 1ZRFA 4KFCA 3IL2A 2GXGA 1ZGJA 2VODA 4KIGA 2AS5F 2ZKZA 3EY5A 3V4GA 3FM5A 1ZH5A 3FBUA 3PZJA 2HYFA 2HGCA 2JSCA 3QPTA 3ULQB 2O6GE 2DPUA 5DCMB 1BM9A 2XIGA 2EFNA 2ZNYA 2JTVA 2GIVA 1IUYA 1R1VA 2F5CA 1O3RA 1R5HA 2EB7A 1W5SA 3MGDA 2EV6A 2R3SA 3BY6A 3R6SA 1U8RA 5LRRA 1XF8A 3S2WA 2P6TA 3KETA 4ZYGA 3J81Z 1K79A 1KU2A 1YREA 3T5XA 3TOBA 4A0YA 3IHUA 3I5UA 4HF2A 1F5TA 1E2XA 4IRHA 3TE4A 2V1DA 2P6GA 4L5JA 4E0AA 3LQQA 2ZJ2A 4KDPA 5L3EA 4I2OA 1RIOH 3K2ZA 1ZG5A 2GXBA 4F7ZA 3CDHA 3T90A 1O7FA 1C0WA 3WODF 2UXNA 1FYKA 1QZYA 1USTA 1P2FA 5HOOA 4XNHC 1E17A 4GCVA 2DU9A 3PGPA 4XBFA 4KOVA 4LLLA 2Q8KA 1KUXA 3GFMA 4JXQA 1QSOA 3G73A 2HZTA 1K6OA 1JXSA 4MJ8A 3FXTA 2BL1A 3KLNA 1Y7RA 1I6XA 4EMSA 2EFQA 1WI9A 3JUWA 4OLLA 1XB4A 4Q5SF 1M4GA 1ON1A 4G7OF 3N4MA 1BBYA 3C26A 4HLXA 4OIRF 1QGPA 4HF1A 1XMAA 1DUXC 2MH2A 4A2UA 3I9SA 2MH9A 2VBXA 2DO7A 4CRYB 3L00A 1HXDA 2CGPA 1Z05A 4KICA 2Z9OA 2JDDA 2ZNZA 4Q48A 2XVCA 4G7ZF 3R9FA 4NSQA 4EQQA 1ON0A 3ZQ7A 5IT9K 1R36A 2G7HA 1TW2A 1MZBA 1R5GA 1W7PB 2Q4VA 4NF1A 5LGTA 4PK3A 2ACJA 4FD4A 2ZW5A 2IA2A 1U2WA 5D6EA 1QPMA 4OIOF 1LNWA 3R1KA 3T8TA 2FXFA 1SFUA 4L0YB 2I00A 3QU3A 2D4PA 2FBHA 4R8HA 3R0AA 3F23A 2HS5A 3ZPLA 1ZG1A 2HQYA 1Q2CA 1SFEA 1YVOA 5E1XA 1Q1HA 3RYRA 3ML6A 2FL4A 2FIWA 2AE6A 1HKQA 4RI1A 4WK8F 5LEKA 1FOKA 3ZMDA 2P7VB 4FT8A 4JWPA 3WU0A 1IN8A 2FQ3A 2ZBKA 1P6RA 3F72A 5AIQA 4UVBA 3WU1B 4WWCA 1IXCA 1HQCA 4EM2A 1M1DA 5C82A 1CJWA 4AG7A 1EH7A 2V1XA 2GZWA 5AIPA 3DR6A 5E17F 4KOXA 1B87A 2RV8A 5ILVA 5CVUA 3QPHA 3BPXA 5L3DA 4UWIA 2PBIA 2RC4A 2ISZA 5IX3A 3E97A 4HX8A 4RS8A 5BQTA 1ULYA 2LDUA 4CHUA 5HH1A 4LK1F 4PCQA 3L7WA 4RB0A 5EEHA 2B5GA 2O0YA 1FSEA 4NB5A 5CLSA 4U7DA 1FWZA 3TDUC 1B6BA 3HYIA 2CSOA 3SXYA 3JAMZ 1BJAA 2P5VA 1SD5A 2DQRA 2QQBA 2J8RA 1J4JA 5E20A 3BLNA 3QP5A 3IWGA 1SQHA 4L18B 1KU7A 3EDPA 2FMYA 3DSBA 3SFZA 3CXSA 2IP2A 1TNTA 1M4IA 5H84A 4B5OA 2VC0A 1WWXA 4HAMA 4AWXB 5L3CA 2G3TA 2KRFA 3FB3A 4Y17A 1XMTA 1STZA 2VQYA 4OADA 3CUQA 5D5UB 2E7WA 4PSWA 1UFMA 2M45A 3JW4A 1B59A 4UUVA 3T0YA 3BPVA 3ECOA 1FBQA 4P55A 4YGOA 4ZYEA 2XASA 5F49A 4LB5A 5FVJA 2A6EF 3GXOA 3P9IA 1KQ0A 1LQ1A 4II9A 1D3YA 2RNJA 1MKMA 1RUOA 5JI6A 2PLYA 4NEXA 4G6QA 5E96A 1Q2YA 4UV8A 2YR2A 4AVPA 2VOOA 2DBBA 1IRFA 4KUBA 5LRSA 1BI1A 3ABTA 2F5FA 1ON2A 5FB2A 2P6EA 2QIRA 4PGGA 1TW3A 4EJTA 2FXAA 2PEXA 4L0ZB 3F8KA 2IA1A 1S8NA 3MQ0A 4U9ZA 5DD4A 2R7HA 2ZPAA 2ZW7A 1OMIA 1J7KA 3GEZA 2A68F 1ZGAA 1HKTA 1SMTA 1L0OC 5A2QZ 1J0RA 4A6DA 2OQGA 5FLXZ 3HSRA 2FT0A 1WRJA 4FX4A 5F6FA 3Q9VA 4I0AA 1OYIA 3PQJA 2GA2A 2WPWA 3CUOA 3FM3A 4ZH4F 5IT9Z 4G7HF 1FNNA 4BQAA 1TQIA 5H86A 3G3ZA 4Y13A 2LSOA 2Q44A 3V7CA 1F9NA 4MY3A 5D5XB 1ZHFA 4HNYB 1BOBA 2IL4A 2DT5A 1XSDA 4GYGA 2OQRA 1M4DA 2EV0A 2PDOA 4UVAA 1KU3A 3TKYA 4H89A 3B02A 1YO5C 3FMQA 2F2EA 1YFHA 4ESFA 5BOXA 1R1UA 1P4XA 1ZG3A 3BJAA 2FBKA 1YS6A 5D4SA 3HOSA 1IYKA 2PR1A 4MHDA 4MHGA 2DI3A 2P6SA 4YG2F 1U78A 3W6XA 2Z99A 1HSTA 2NRAC 4RS2A 3KCCA 3V8IA 1R23A 1FY7A 5HS8A 4EV0A 5IB0A 4M9XA 5HLGA 4XLPF 1YW8A 4G8XA 4CAXA 1G3TA 1G3YA 2HOEA 3WTXC 4KOWA 4PV6A 1L3LA 4XSZF 1QSRA 4I49A 2Q4YA 1DP7P 4KZTA 3KZZA 2VZYA 2G3AA 1X3UA 1LDKB 3D5LA 3ZN1A 1O3QA 2CG4A 4F0YA 5TJJA 4M85A 4AB7A 3I0TA 5DUKA 4I01A 4UV9A 4M9SA 4IF4A 4YFKF 2MLGA 3IC7A 3S6GA 3E0KA 2IRFG 3FRMA 4YIFA 2OZUA 3EXNA 3WTYC 3E5XA 1Z9CA 2PQ8A 1Z6TA 1O3TA 3LA2A 3RYPA 1XDUA 3E3VA 1FP2A 3I59A 3ZMTA 1YQAA 4E2AA 1YW9A 1S7NA 1S5KA 1ZN2A 5D5WB 4OOIA 1U5TA 4OMYA 2STWA 5FO5A 3KP4A 2COMA 1ZLJA 2LKPA 1P4AA 4O6JA 1T6SA 2Q0OA 1QSMA 5J6XA 4QUSA 2XKOA 2UZKA 4NCZA 4LG0B 3RKXA 4CRZB 1W5TA 4Q4ZF 1G6NA 1BOAA 1SD4A 1XSVA 5ICCA 5LBQA 2D4OA 2O8XA 3F8FA 4IF5A 4L9VA 4M3SA 2HKXA 3EETA 3MWMA 4LD5A 3G8WA 1CF7B 3O6BB 3CO7C 1NMTA 3HUGA 2BEIA 1B6AA 3R61A 1T0FA 2BE5F 2PC1A 1LEAA 5DUIA 1IN6A 1DPRA 4XSXF 2MBFA 3LWFA 3WTWC 1SD7A 3U9GA 3DF8A 4EJOA 5EC4A 3GUDA 3GO5A 1B9MA 3TCVA 4ENMA 5FD5A 5CVVA 1TNSA 5HVQC 4ORFA 4LLGF 2L4MA 1BN5A 1ZREA 2FNPA 3K1MA 1T38A 1S6LA 2R7FA 4JLYA 2OU2A 2Q04A 1Z4EA 3SXOA 5I0CA 2VZZA 4I7HA 1YTYA 4MBUA 3K1NA 3M8EA 2B4DB 1OPCA 4CAVA 4NXYA 4M72A 2G0BA 3HSEA 5K1YA 1Q2DA 2PSWA 2FCKA 4E70A 2FE7A 4KUMA 1BC7C 5FFXA 4LGWA 3P2HA 3S6HA 3LA3A 2C6YA 1HW2A
chains in the Genus database with same CATH superfamily
1IRZA 1JHFA 2V79A 5E8IA 3EO4A 2XAQA 4C2TA 1BI0A 2PIZA 3F0AA 3ZMSA 4X5KA 4HZFA 3NEUA 2G9DA 3KYCB 4ONWA 3ECHA 4AD9A 4B48A 3MKYB 4UF4A 2B5GB 2ZEHA 2MA3A 4F9VA 2TDXA 2HC9A 4NGPA 5FROA 1FPQA 4HG2A 1KZFA 3OL4A 8CPAA 4NC7A 1UMQA 1TL8A 4RGSA 3OYDA 1XIXA 4QBJA 1IN4A 1I3AA 1KUVA 4CAWA 2PJ8A 5JHUA 4CGMA 1UVGA 2L2OA 4BE2A 5ILUA 2DA1A 2KIFA 1WJAA 4IZZA 1K7TA 1KONA 4KS9A 4BAYA 2KISA 4BE0A 1CX8A 2VL8A 2VKEA 3GF2A 3I4PA 1LDDA 1NXUA 3BWGA 3R95A 3Q5FA 3H3UA 2IBDA 2QUFA 4P4BA 2DK5A 1ORKA 1W36C 2PJRB 1SANA 1WJEA 4XL9A 3SQNA 1YJWI 2CJSC 4A37A 2LC2A 5ICFA 3RPUA 3F8CA 1MMDA 1DE4C 3S6FA 4OIWA 3HRUA 3KZYA 3HGGA 4U0YA 4OC0A 1FAQA 4XPDC 1KA8A 2QVOA 2YX7A 3OYCA 1FT9A 3VATA 2WAQA 2SGQI 4H6ZA 5BPDA 1OLTA 3KFWX 1ZG7A 4R3LA 3SHPA 2VUMJ 2DOEA 2W7NA 3IV5A 3TP3A 1A35A 1X10A 4A3DJ 2EFOA 4R1HA 2XPWA 1PCEA 4LX9A 2V9VA 4XN3A 5ILSA 2XAJA 1FYLA 3U1DA 3LSKA 4KOYA 1TF8A 1IGBA 2RDPA 1RFHA 4BXUA 4XNHB 1QQ9A 3A1YA 3JREA 2PG4A 1Y1CA 4CAFA 1RZ4A 2VOPA 4N4NB 2NOGA 3B3VA 3I59B 3V7RA 5HS9A 1LB2A 3O3KA 3K4MA 4IJAA 5C82A 4KSIA 4R76A 2R7XA 3ZR8X 3K70C 2QJ8A 2QVPA 1NH3A 1VKCA 4NC6A 3N97A 3DEWA 3UR3C 1OYWA 5F0CA 3FKJA 2K3FA 4HDUA 1W3SA 4CYCA 4R9MA 2PMHA 2RQPA 4KOUA 3VOEA 3HOTA 1S5LC 3FMCA 3FXKA 3CCSI 1YI2I 3TO7A 4BNCA 3UGLA 5AGEA 2HQNA 1JKRC 2XGXA 3FC3A 4A32A 4G1PA 1FC3A 1SGYI 1Y7EA 5IB9A 3ASNH 3KLOA 4DJAA 4DOZA 3Q9SA 4YFNF 3BOQA 3E1SA 4FTHA 2REEA 1QHHD 1R00A 4IHXA 4U0WA 3SI2A 3D0SA 3JRHA 1X1BA 2HTJA 4BHCA 3DLAA 1H9GA 2L5QA 2CQQA 4B8XA 3J7YJ 2GVIA 3PB8X 3GW2A 4QLCU 2M87A 3Q0VA 3I56I 4EGZA 2EPFA 4RB2C 2KCXA 4PK2A 1R79A 5BS6A 1BC8C 1S7LA 3ONQA 1OZPA 2PR8A 5D6FA 1FT7A 1S7KA 3QNVA 4A0XA 3DP7A 2DEAA 2MD5A 4QWQA 1JUMA 5ED4A 4GXHA 2P5LC 1TGSI 4K3NA 2VEZA 1YX0A 2M8GX 3B3SA 3H5NA 3DR8A 3WU2C 1DGWY 2KL4A 3AFHA 3DGVA 3LOCA 4AYBN 3FDYA 2BSWA 1EKEA 1UG2A 5BPIA 3VB2A 3VSLA 2VL1A 2QEXI 3K9UA 2K4BA 1MDMA 1OFCX 1Z77A 3HOZJ 1K78B 3IWZA 1U5TC 2L7FP 3ZMVA 1P0HA 3G1OA 5CNPA 1MSFC 2AFMA 2XEGA 3OOPA 3D8PA 1YIJI 5E8GA 4EEFG 3BR5A 3ZQLA 5M5YJ 4Z2YA 4MPIA 2QQDA 2JPBA 4QSHA 4BQOA 1VI0A 2JBJA 2MGQA 2YU9J 1SAUA 3H92A 1IY5A 3L2UA 2PI0A 4KVME 1JKQC 2JDCA 1WH5A 2ZMEA 3TOAA 3WTZA 3IH4A 1Y39A 1OR7A 1OYVI 2Z3LA 4ENKA 2FNFX 3IC1A 3FX6A 4R6TA 2FE3A 4AM3A 1UFHA 5E3LA 5FRNA 1BPNA 2ZENA 2JSPA 4XKVA 1GT0C 2E35A 2NNYA 4B44A 4AVBA 3F21A 2IT0A 4MIMA 4MO7A 4CCMA 3P7NA 4L9MA 3OR2C 4XORA 1PUAA 4IRIA 2BY3A 2OPTA 3G71I 1ETQA 4MFQA 2HQ5A 1FARA 1ZR2A 1YX3A 4OINF 1PTRA 3RKYA 3K9TA 2DPDA 4MY0A 3KP7A 4HEA2 3WGGA 1IY6A 2WUUA 4UBRA 2BW3A 1UHWA 2ZFUA 5J8FA 3LNQA 3B7IA 3AG2H 3NFZA 4HNUA 3TFYA 3L2RA 1XJOA 2DFHA 3KE2A 3O8GA 4XLNF 3CLOA 1A2ZA 3IEHA 1JGSA 3SEZA 1HOMA 2IQ6A 2YUSA 3S1QJ 3FHZA 1X3ZB 1N13A 4P9UA 2NXNB 2KMPA 2AXTC 2VC1A 1XN7A 4P96A 3BR6A 2QQCA 4BEHA 3PB6X 3WT4A 2VN2A 3CCJI 2A5WA 2W48A 2R5ZB 2JPCA 1AMPA 4R3KA 4ESJA 3FISA 4RLFA 5D8LB 3CXPA 2QYOA 3JAMK 2BXYA 3V8KA 3W6SA 1E3PA 4M6GA 4OKOA 3V7SA 3CXQA 5AG7A 2REFA 4G6TB 3RQ4A 2ICWG 3BJ7A 5LRGA 1YIOA 3M1CA 4MTDA 3F8NA 4XK4A 3KP2A 5F08A 5EEAA 3DPLC 5LHIA 3EQLF 5CYVA 3SJFA 2DAOA 3CO6C 2N17A 1VQOI 3GOXA 1HW1A 2V8VA 4BH9A 4IO9F 1KYZA 2AO9A 2XHKA 3BP8A 3DPUA 2M34A 5F04A 2CY2A 5AG6A 1E3OC 3GLXA 4BMHA 4M74A 2E5RA 1G3WA 1NG6A 2FU4A 2KMUA 3Q3SA 4WCGA 3IU2A 3QAYA 4F8ZA 2PJ5A 4A31A 1U6GA 1ZYRF 4GFBA 3BTIA 1PDNC 1Y0YA 4LB6B 4IHSA 4ESBA 5TRDA 4CYOA 1Z6RA 4FD7A 2GWRA 2J87A 3BDDA 4HNVA 3RIRA 3WGHA 4S05A 1DPUA 1AOYA 2O3FA 1D0XA 2XGEA 5F48A 3SI0A 2XAFA 2IJLA 3QPSA 3OYLA 2H1KA 4IHTA 1VGYA 4KN7X 3DBRB 4KVXA 1K6YA 2NU3I 2V53A 1Z8XA 2QECA 3T9YA 2QBYB 4RB3C 2YSRA 3EYYA 1XD7A 2BY1A 1ZAOA 1W7PA 1OR7C 2KRHA 4EGYA 1PUEE 1BA5A 2QQAA 3H5ZA 2HEOA 2LR8A 3QODA 2F5IA 5HDNA 2DK8A 2K85A 4RDUA 4AMLA 1D5VA 3GZ6A 2IPQX 4ONUA 4OIQF 2KIQA 3C18A 2E1NA 2K4JA 3V42A 5K8NA 4HNXB 4WXHA 1T98A 1WTJA 1B9NA 3TC8A 1O3SA 1PPFI 2F5DA 2TCTA 3E6CC 3DNSA 4F93B 5A2QK 1KGSA 3GX4X 1JHHA 2FOWA 3L09A 2BZTA 3IKTA 2K02A 2K9QA 4JCVE 4ZTJA 2VBYA 5DS9A 1EV7A 2P6FA 1CGPA 5JHFA 3CF5F 2R4GA 1RTQA 2MLKA 4UHTA 3PFEA 3VWEA 3KYDB 4XONA 2LY9A 4F6AA 2CNTA 4XQFA 2ISYA 2DFEA 2F4MB 2A5YB 1W0UA 3BJOA 5KAIC 1IY7A 2B58A 2IMOA 3H5RA 1Y1BA 4MQ9F 1H89C 3N7ZA 5F47A 2NS0A 4MI4A 3RBUA 5ISVA 2HU9A 2ZEPA 3EC4A 3TBIA 4MQVA 4I6ZA 3S6KA 2D2WA 3F0CA 5IYBJ 4XLEA 1OQYA 1UWYA 4IQ4A 2LK2A 4UCPA 2DW4A 4U5YA 3C1DA 3DKYA 5LRKA 2ENNA 2XKPA 1Z9UA 1WHUA 3KEQA 3QYFA 2PIYA 4M6XA 2IEKA 2LF7A 4HF0A 2X6WA 3WG9A 4L5IA 3LSMA 3TTHA 3H4QA 4L9TA 2EJRA 3FXRA 3SEQA 3ZN0A 4CYDA 4HLYA 2A61A 2GQQA 1Z21A 3ASOH 4LJZF 3RPQA 2MG4A 4IRGA 2VBQA 3S3MA 1BUSA 3ZMUA 2GA1A 4M6YA 2EQRA 2WTEA 1ERDA 2HWVA 4FX0A 2M4KA 3LSRA 2DN0A 3BG7A 1K4SA 2FS5A 4MEXF 4LIUA 3OYHA 1TQPA 1JUPA 2JA6J 3B3TA 2WZNA 2V9KA 1QO0D 1VFCA 4CS0B 2W4SA 5HNHA 3VSKA 4LG3A 4UWJA 3P5JA 4OWRB 4A69C 3OXGA 4FASD 3OY9A 3GLLA 4KMUX 2EWNA 3BJ6A 5JVTA 3FXUA 5B3SH 3L1PA 3BJIA 2DB6A 5FKOA 1ZRCA 4UFXA 4OMZA 4QVTA 5EGOB 1KU9A 1TIHA 4ZX9A 4ZYAA 1TP4A 4B10A 1GHEA 4DYQA 3GFLA 4XOPA 5EG0A 1ZARA 3WHBA 2FX0A 3PNYA 5DCMA 4E7KA 5DCFA 1VQ4I 4G94A 3FJUA 3KASA 1U5KA 3FSYA 3CDIA 2LD5A 2DFFA 2L7KA 3S93A 4CGZA 1ODDA 3C7JA 2FBIA 3FZVA 3M7GA 1OCCH 1PP8F 5HDGA 4L8AA 3D5RC 2UWMA 5HDKA 2DMNA 4LQGA 3CTAA 4BKXA 3ERMA 4RGXA 1FNOA 2M3AA 5KTAA 2H94A 4UFVA 4MHNA 4O5VA 3I55I 3LQRA 3GBGA 2J9AA 4B09A 3BHXA 2ADUA 2PJBA 3ZGKA 3M3YJ 1SD6A 4OMEA 1V3FA 2CJJA 2FOKA 1K78A 2ZXVA 3RYOA 2WADA 3QU6A 3R5BA 2AFWA 2VXZA 2HFHA 4DW6A 5EGOA 5HVFA 1PUFB 2HYJA 1MW7A 2HXIA 4A3FJ 2BO9A 5J8CA 1XEBA 1BMOA 4JYWA 3AG1H 1RUNA 1QSNA 2H09A 2VASA 2EUIA 3HBLA 1YQEA 5J40A 2F6CA 1Z5RA 4OU0A 2ECBA 2J8NA 1XMXA 4TNUA 5F46A 3PL8A 3MN8A 1TWHJ 1NHAA 1MT1A 2VT2A 2V1NA 3ABLH 3S9MA 3PEIA 3COAC 1DU6A 4BXXJ 1R22A 3IRRA 2WAQN 5F27A 2E5NA 3R5AA 3CCRI 2JT1A 2PFBA 2B9SA 2E73A 2Y0SA 4CYQA 2KJBA 4OAZA 1XCBA 5F1RA 3UEJA 3ISPA 2X4HA 4M71A 3AG3H 2LOOA 3BR2A 2AQEA 2FEZA 1CF7A 2QBYA 2DLLA 2WV1A 5IT3A 2IA0A 4PPZA 3HOVJ 2G9WA 5EG0B 2BUSA 2Q1ZB 2QSHX 1WWZA 1YSJA 1RR8C 5G1ZA 4U0VA 1CSOI 4PDKA 2WBMA 1ZGWA 3HOYJ 2AJ6A 1IXSB 3KHZA 3KR4A 4FD6A 3A4CA 4IAVA 2HI3A 4MMOA 4H6UA 4D0PA 1U8BA 5K8OA 4JXRA 1LFBA 4P5OA 3WTVC 3OS2A 1PP7U 1I12A 2ZXHA 4UEFA 2KIUA 3PQKA 2VBZA 1Y1WJ 1VHOA 5GCNA 2PMZA 1V1IA 1RR7A 2PMUA 2EH3A 5D8KB 4HNWB 3VPRA 4ZZLA 1XCVA 2V77A 2ZMEB 2P8TA 2OZ6A 1RXTA 4CZCA 1HW5A 4LG0A 2CFXA 4B6DA 4W1UA 4IL6C 2WA0A 4UVCA 5H20A 5EX0A 4AXVA 2DXIA 2FSWA 1XSXA 4PJJA 3E59A 5J3LA 4I0BA 1JT0A 3W91A 1UUCA 1S3ZA 2I79A 3HIFA 3CJTB 3KP3A 4XRSA 2Q7SA 2RFHA 3J81K 4FD5A 3DEUA 2QQ0A 2PJCA 3FIXA 4IPAA 1P4WA 1WKXA 3TO9A 2GOMA 2FMLA 4U9YA 4NC8A 2A69F 2M2EA 1VQ7I 1W5CC 3JTHA 2DA3A 1HDPA 5GP9A 1FYMA 3DLLF 3LFKA 4WXDA 4V19K 4A94A 3ZMZA 1BAVA 3V38A 3DLJA 5FFZA 3OYMA 5DEQA 3RI4A 2IW5A 2Z16A 3QPLA 4KJZA 3ZJ0A 3OIQA 4CCOA 1YE9A 1J75A 1TLHB 3AAFA 1LR8A 1IW7F 1Y9WA 2BEOA 2LTPA 2VT3A 4LITA 2BHZA 1QVTA 2ORVA 2AXLA 5LYDA 3B6CA 2YPRA 2R7RA 1O57A 3J7AO 3KPHA 2W85A 3GCMA 1ACIA 2ZXIA 2EFWA 4KMFA 1S60A 2CNMA 3PBEA 4E4HA 4B43A 1LVAA 1YITI 2J5PA 2P7CB 4UUSB 1JJ8C 2JEVA 1U5TB 3R0JA 4IQJA 2Q7BA 2W00A 3ABMH 4AYBA 3PBBA 5EEGA 5JVGF 5CJ9A 3F6OA 1GV5A 1PUFA 4V2GA 3SXNA 1KYWA 3OWTA 5M3FJ 1JQGA 1HBXG 5TGTA 1V0CA 2DQLA 2EBIA 2E5ZA 5KK1A 2GE3A 1TIQA 4PJ0C 2ID6A 3E6DA 1ZR4A 1WFXA 4HRIA 1BI3A 2F5EA 2PVWA 1EA3A 3BJ8A 2WV0A 4C9YA 4NFRA 5LGUA 2ZSHB 1TQMA 1V5GA 3NAUA 4XLHA 4DUKA 1OCRH 2CUJA 4G6DA 4B4CA 2W1OA 3HXLA 2DODA 1J9IA 3DV8A 3I1UA 2F5VA 2VXDA 4RLQA 2PX9A 1R57A 3F8BA 2FSRA 2H8RA 2WYRA 2J9RA 2DFIA 1X12A 2Y0SN 5J1RA 3WTTC 4P44A 3DPTA 4HV5A 2KLOA 3EUAA 1IIDA 2PJ0A 4FAIA 2LUYA 1GHCA 4XLFA 4F3QA 3LD2A 1BIAA 5THWA 1IZ1A 2EA2A 2CUEA 1W0TA 2COBA 2N71A 1Y9KA 3B8GA 2P81A 2CWGA 1HLVA 2FRHA 1I1GA 2CQNA 1U0JA 2IGMA 3NA6A 4PJLA 3KZWA 1IB1E 4OIPF 1JWQA 1XE4A 1J5YA 1ULKA 2MSYA 2AFZA 2D5VA 4A5NA 4LQ6A 2NU1I 5I4MA 5E3RA 3MFKA 5HMNA 5KAFC 5AG5A 2CO5A 2VRWB 4HX4A 4JX6A 3MKLA 3AG4H 1LRZA 3OYAA 1SFXA 4GYIA 5E3PA 5J1UA 2DA7A 4Y49C 1S3JA 2DMUA 1Z7UA 4UNOA 4A3LJ 1HA8A 2JYYA 4AG9A 2XAUA 3RNZA 2Q2EA 3OYJA 2B3UA 3ZQFA 3WGIA 2B7EA 2H27A 5CVIA 1ZRDA 4EJVA 2NU2I 3FXQA 2ROWA 1F4KA 3WC6A 3VWDA 3GUXA 3PFOA 2KT0A 3KEOA 5DWMA 3DQVC 2CWHA 1AN1I 1S7EA 5ICGA 2Z0ZA 4O23A 3K4LA 3P9CA 2HZDA 4JYKA 2PJ4A 5LLQA 1F43A 5LGNA 2YU3A 2VE9A 4B3XA 3D67A 3ZQCA 3GTLJ 4TWEA 3NRVA 4KSFA 1D8JA 2LVSA 3R96A 4K2EA 5KVRA 4ENNA 4DJLA 2IAIA 3F9KA 4BHPA 3CJQB 1N25A 5JR3A 3FXLA 1P7IA 4B5PB 2STTA 5GADJ 1MJ9A 4YIIA 5M5WJ 1BLLE 1P4NA 5GAHJ 2NS8A 3K4KA 2DKVA 2VLAA 1N77A 1Z2LA 1J2XA 2Y9YA 2Z3MA 4CGLA 4S04A 5LHGA 1R49A 2H5MA 3PSIA 1G4DA 4GI3C 1VHEA 2LYCA 4LK0F 2CFOA 2FA5A 2ZW4A 2DJNA 4HDVA 2J5OA 3BROA 2XUBA 1J59A 2Q51A 2KMRA 1QNTA 1WH7A 1SGEI 3L9FA 2KDOA 1I39A 2X6XA 3W6KB 2B63J 4HQEA 2HPIA 2CQKA 5HXDA 3BQYA 3SZTA 3ABKH 1ZLHA 2KKOA 2PMZN 3CCVI 4CH7A 4GDFA 1NG7A 3B35A 4ZTFA 4GO1A 3TO6A 3DXJF 2GM4A 1IDZA 3OWCA 5CVJA 1Y0NA 5IP9J 4TV7A 6CPAA 2Y9ZA 1TBRR 1M44A 1TWCJ 2XDVA 2E2JJ 1K83J 2HUZA 1F2PA 4J19A 2PJ1A 3M1EA 1WI3A 3HOXJ 1V55H 3LSGA 3HTUA 1GVDA 1TXRA 2O7OA 3M4OJ 2ZFWA 2GXAA 4B5PA 4PSXA 1P7JA 3GTPJ 4Y49B 2XGCA 1Z1DA 2FD5A 3P2FA 4YFJA 5EMIA 2Z3KA 1HKSA 3OIPA 4DZPA 3A01B 1XGMA 1LKXA 1IRXA 4JBAA 1EE3P 4HKFA 1SVLA 2L3DA 3K69A 2ME6A 1MNDA 1B8IA 3I54A 4A3KJ 4AC0A 1BL0A 4A3GJ 5CCLA 1YW7A 1G8XA 2V1CA 3FSXA 2EA4A 3ERED 2PE3A 1WGCA 2OTLI 3VODA 3GFJA 2R7UA 2CYYA 4II3A 4R87A 3HKZA 4UA3A 3VFZA 3NE8A 4FHTA 2XF6A 1QZEA 1MGTA 1ETKA 2W24A 2Z10A 2E1MC 4Q7AA 1JT6A 1WGTA 4ZBGA 3SJXA 4BY1J 4WXCA 2X9DA 3OS0A 3EYIA 5FGMA 2RN7A 3PUBA 2WPXA 3LAJA 1MNEA 3RKWA 5L3BA 2G7UA 3DU6A 1UAAA 2OUMA 5IYCJ 3GZ5A 2K86A 1YTPA 2NYXA 3CPXA 4E8OA 1BW5A 4FKDA 3MD2A 4QPOA 2VXKA 3H8EA 2CWFA 2HQRA 2ZJRF 1PTQA 1MBEA 2BUEA 1XGNA 4N9HA 4Y4RA 4MFLA 3PJRA 1LDJA 1A6QA 4ENJA 2OAZA 2R0QC 1FYBA 5E1ZB 3HHGA 5FKNA 1Y8QB 4LLNA 2CTCA 5C88A 3TP0A 2DMPA 2OR4A 2AFSA 1A5JA 1R6RA 2R7WA 3SDBA 2VE8A 2Y75A 1IGNA 2W84A 3BCBA 1LEBA 3FK7A 1Q1VA 4EVIA 4IUSA 2VQCA 4OC3A 3N05A 1RC9A 4QC6A 1RETA 1BPMA 1PU9A 2ARHA 4EJUA 1TBNA 4BINA 1XGOA 4NGRA 2XF7A 4BEHB 3T8RA 3U1KA 3WG7H 4QPQA 4ZYDA 4BBSJ 1HEEA 2CW0F 1M1EB 3KGQA 1G59A 3KKWA 1MH3A 2MYSA 3K70D 1LUJB 3LL7A 1FTZA 3PNVA 3I58A 3S32A 1POGA 1I21A 3S2DJ 3IKVA 3KI9A 1USSA 1V5EA 1SGDI 3TDZC 2W25A 4DQ2A 4ZJZA 1FTTA 4J3GA 1T56A 1MJAA 1LCPA 2DTRA 3LAPA 1FZPB 1S7OA 4CGOA 3FX3A 3ROUA 4C3HJ 2D1VA 4BDZA 2GANA 4JK1X 2E1CA 4N0BA 4Z65A 4DZJA 2KFDA 3PB7X 3DCFA 2BGCA 1IYLA 2QMLA 2DXQA 2ZELA 3S1MJ 3GKRA 2R93J 1KQ9A 2NNNA 3VEPA 3B3WA 2O28A 3I9V2 4F0XA 3A0HC 3GTJJ 2LFBA 4B47A 1HDQA 1YLEA 2Q0YA 2PJPA 5AONA 1QZZA 1UHMA 5M5XJ 2HYGD 2Q2EB 1TURA 4GGGA 3KZIC 4JD6A 3LSHA 3UGIA 2Z33A 4M6IA 2EZHA 4KSAA 2XPUA 4KITB 1Q9BA 3OYNA 1YR0A 5E3QA 2MW8A 2C6PA 4YRHA 2Z2SB 3MZ8A 1Y56A 1JE8A 4NHJA 2UVOA 1E3HA 2QKMB 3FMRA 5KNLA 1LANA 2ZEGA 3WE3A 4BUPA 3LSPA 2R7ZJ 3QQAA 3S3OA 4L9NA 1WKMA 1MD0A 1KBFA 3E6BA 3IJ3A 2CWEA 5G21A 5DWNA 1FX7A 2NOJB 2K5TA 3R9EA 1MDMB 1IV6A 2EFPA 4BXFA 4UUSA 3OYGA 2JMWA 2C6GA 1CT0I 2Y0MA 5EZHA 2HVQA 2HDWA 2QQ9A 1GXPA 1MK4A 3KP5A 1U6MA 3KP6A 4IHYA 2QZ8A 2B4BA 2RNGA 4UXJA 4A6EA 2OZHA 1D1BA 2DA5A 3V8LA 3HRSA 1S7FA 2F48A 2D45A 2GLJA 1MJBA 4P4EA 4MXUA 2M1BA 4NQWA 1IICA 2BYVE 3I3GA 4MCSA 2HVSA 4MNUA 1CQTA 3TQNA 1XDSA 3PB4X 2JLMA 3FF5A 1DTDA 3B73A 4HV6A 2CU7A 1UELB 2XAGA 5CQGA 3OS1A 2RGVA 3K6GA 5HVGA 2VJJA 2E2HJ 3HRTA 2X85A 4IXAA 3FXJA 3LSIA 1B1BA 4X6AJ 1R0RI 2C1CA 5B1BH 3QAHA 3FECA 1XMKA 2XRNA 2L54A 2XEJA 4M3BA 3BZCA 5F0FA 3ELKA 4F55A 4NGSA 3NH5A 1UVFA 2NMTA 2PJ3A 3CP2A 2ESHA 4GS4A 4R57A 4ZYHA 1KZHA 4ETSA 4EMEA 3VARA 3R4KA 1MH4A 2QQEA 1YMEA 5EX3A 1YK3A 4X2TA 3WABA 2I8DA 4MTEA 1WK4A 1W7PD 3CT9A 1IXRC 1D0ZA 4X3RA 3FBNB 1X74A 3FWEA 5EJCA 4AIHA 2KJCA 4UUTA 2K9LA 4MHZA 4JJXA 5DDGA 4A3IJ 1SGRI 4YFXF 3MAJA 9WGAA 4F52A 2L7XA 2GAUA 4OAYA 2WC2A 2XROA 2YNCC 5AG4A 2EK5A 5J47A 2V7FA 3L2VA 2W57A 3CLQA 4DNCA 5BMZA 4V2FA 2CNSA 5HLHA 3HL2A 2JZMA 3JVNA 1D1AA 1IOIA 3S2HJ 1S29A 3IH2A 1H0MA 3HPHA 2X3TA 2QCOA 4X8IA 4MLOA 3X2QH 2HDCA 4A95A 3CCYA 4XR6A 1Y8FA 3VDUA 4C2UA 5FLXK 1DU0A 4OC5A 2XF5A 1HPTA 4KIBA 4PFPA 3IH3A 1A04A 2NAZA 2Z3OA 2DIPA 4KVOE 3RTRA 1D8KA 4CO8A 3OYBA 2WB1N 1YHQI 4KNYA 2P6AC 3HZJA 3OR1C 1SGPI 1T39A 4LFUA 1FLIA 2M30A 5JFRA 2F4OB 3B6AA 1ZELA 2E1MB 3RDIA 1L0CA 1I27A 4MFPA 2CRGA 4AVAA 3CMMA 1VQPI 2TRTA 4KT6A 3REOA 1FBUA 2V6CA 3WTUC 2ETHA 4BDYA 2V1UA 1ELLP 3EPZA 3K2KA 4YEJA 3UY5A 3GVAA 1RNLA 2GKVA 3DDDA 1F1ZA 1GVJA 1U9OA 4HBLA 3DKXA 2ZXJA 2DMQA 2ZXWH 3I64A 2RVCA 1OKRA 2X51A 1T33A 4A5MA 3MCZA 1ZTRA 4BJ6C 2OH1A 4G9YA 3KQXA 2UXXA 2P5KA 3GYHX 3TL4X 1LE8A 2YGWA 3R9GA 3A9LA 2E36A 3CMAI 2LY2A 2B4DA 3ABUA 3JCUC 1FBSA 1DS3I 2EV5A 3K1PA 3W6JB 1P92A 1LR7A 1I1DA 2L4AA 3LSTA 3FKIJ 3TW6A 3JSOA 4JOMA 3E0JB 1WVRA 5H6QA 2WWYA 1XPXA 2A4NA 1ONVA 5JQ4A 3H3ZA 2ELKA 1NE9A 1NSLA 3ZZIA 2VONA 4O3MA 3FVLA 1ZLIA 4XPDB 3BLYA 1JKPC 3H9GA 1K7AA 5M3MJ 3IWEA 2X1EA 4JX5A 1MMSA 1R43A 4HPQA 2LREA 3CUQC 2ELHA 4I09A 1IAWA 1Z91A 2E7XA 3HKZN 2OD5A 3CCEI 2BV6A 1VDDA 2RKHA 1KUYA 1G3SA 2OTJI 4Q47A 3O2PE 2OZGA 3MEXA 4L5EA 5FUYA 2OA4A 4RAGA 1N71A 1MBKA 3D68A 2OBPA 1REPC 2BY0A 2HVRA 4N9IA 1YRNA 2JZYA 2JQ7A 2M5WA 2WVJA 1YYVA 1YGHA 1OYYA 4HA8A 2EBJA 2Y48A 3DKWA 2V6EA 4HYEA 2V8HA 3RAMA 5HLIA 2Z1DA 5GPAA 5FLVA 1VZ0A 1EH8A 4F91B 3CDXA 3I3LA 4C3JJ 3KHXA 4RGUA 5FUXA 3HDDA 2XRCA 1I1SA 4Y15A 3BI0A 3F3XA 4LUAA 1I5ZA 1S7AA 2JN6A 4XM3A 5E1WA 1K4JA 1VHSA 4B6ZA 2WY8Q 2R1IA 3W2VA 1MBGA 3DFGA 5L3GA 1YVKA 4KLVA 2V8GA 2R7DA 4BQNA 4ZZDA 2HV2A 3BG3A 3LMSA 4A0ZA 2DA2A 3CC2I 1PVEA 2P4WA 4XRFA 4I98B 1AKHA 3GY9A 3H1CA 4CICA 2FF4A 5BNGA 2XC7A 2O03A 1P9GA 3D3SA 2B0LA 2Z3YA 4B13A 4ZY0A 2A6HF 2M0MA 1WPKA 5F1JA 5E3MA 1X2NA 2A6TA 4RB1A 1QU3A 2OD1A 5K7FA 1Z4RA 5JPHA 2ECCA 2UV1A 3L2CA 3CMYA 3TT2A 2QENA 3PP9A 4HSRA 4WP4A 2D1HA 3QB8A 4RAYA 1SMYF 2ID3A 1W4MA 3P9KA 2DOAA 4RAZA 1OCOH 3IP4B 3J80K 1T8IA 1M8CA 2YUUA 2XV4S 1CG2A 2PN6A 6PAXA 2IVMA 3CUQB 4BACA 4IVNA 1UB9A 2A05A 2CQXA 4A33A 1T08B 1TT5B 2KIMA 4CZZA 4B3AA 3MMYB 3WE2A 1XGSA 4UB6C 2LF8A 1LJ9A 2AQFA 4EJWA 3D2PA 2K3PA 1X1AA 5LYIA 1NTCA 2VBWA 4C2XA 2PJ7A 4XPKA 3MKWB 1R58A 1I50J 1TBXA 4HNTA 1V1HA 2YQPA 3BQZA 1R3NA 3JTGA 1X2MA 3IWFA 1F57A 4L9JA 4KT5C 5HS7A 4CDGA 1OCTC 1QHGA 4B14A 4H0EA 1QQIA 1CPXA 1Z8TA 4BHBA 2SGFI 5A28A 1Y0UA 2WSAA 1YG2A 3LA7A 1JJ6C 3NE7A 1HSJA 1XX5A 5IV0A 1FP1D 5LHHA 1U3EM 3CCQI 3VYUB 1QRYA 3IO1A 4BYYA 4RGRA 2B3VA 2KCWA 2X1DA 2XEFA 3SDGA 5KTCA 3T1BA 2JRTA 2X6YA 2BY2A 2M5XA 1EF4A 4A12A 4KUAA 3BZ6A 4DBRA 5J4VA 2BW3B 3FYNA 1X58A 3Q0WA 2M7AA 4KLWA 1DS2I 4QB9A 4DYOA 2Z5UA 2GLOA 1V54H 5K5RA 3WTSC 2DTZA 5TISC 4CPAA 1MMNA 3U2RA 2J8MA 2HR3A 1IN7A 3E5QA 3G1LA 4WF2A 3E5UA 5E79C 3MZHA 1RO5A 2R8VA 5GAGJ 2LBFA 3C2BA 3EUHA 4MEYF 3FBIB 1X1DA 2UZ3A 5D5VB 4KORA 2WY7Q 4ASNA 1S72I 4LMYA 2IS1A 4K30A 1AWCA 1BI2A 2KHMA 4HOBA 2K9MA 2K40A 4P9FA 4AIJA 1XX6A 2ZCWA 1OJLA 3CJNA 2Z11A 1ETOA 4KA4A 4NQWB 1XOVA 3SZPA 1UZCA 3I71A 3HTSB 2EINH 2DPSA 4CAEA 3G3SA 2JUGA 1I6HJ 3SHFA 1CGJI 1OMTA 4I99C 1R9TJ 1S20A 2ATRA 4HX7A 2M8EA 4AIKA 2NVYJ 4AVCA 4GXOA 2X7BA 3CPAA 4U7BA 1YLOA 4KIFA 3K0LA 2QPOA 3S9NA 1X1PA 4UXHA 1Z8LA 1O7LA 1HC8A 5D8NA 1VQ8I 1VQKI 1OVOA 4IOAF 2OB0A 2L01A 3M8FA 2Z3PA 3RJPA 3TW7A 3MRUA 4JQFA 2ABZA 5JGFA 1XBTA 3QOPA 2ZO4A 3LODA 3HRMA 3NH4A 2E71A 2FQ4A 3CDLA 2R98A 2C27A 4UB8C 5LEJA 3OYKA 3FNCA 3GYAA 4PXCA 1UHSA 3WC5A 3FHNA 4BE1A 4XKCA 3PUFA 2LEOA 5FLMJ 2JVHA 3PM1A 2ANPA 1ZG8A 5CVRA 3QP6A 5L3FA 5DYMA 4HSTA 4MGRA 2A3SA 1EH6A 4PJMA 4EM1A 2XAHA 4KN4X 4WX9A 2YX4A 4GRIA 2VQLA 2IS4A 5FKMA 2XSDC 4M3GA 1KQ8A 2UUZA 2KMQA 2P0WA 1ETVA 1LFWA 2CV1A 3ZOBA 3V8JA 1M1DA 2H6CA 3AL0B 1AHDP 3H5AA 1IRGA 1XFOA 2VI7A 1TKFA 1DDNA 2K27A 3R5CA 4CYPA 4ZDPA 5ICEA 4KYWA 3CXLA 4EM0B 1PYTB 2HKOA 4E6KG 3EFAA 2ZW6A 2CTBA 2CMPA 1SFKA 2DOFA 3GZNB 3C3WA 4UXNA 4ON0A 1VTNC 2O61A 3SGBI 1ZO0A 4P4DA 3F5BA 4XNFA 4QIWN 2ZEFA 4UY8I 4C7IA 1MIJA 2JW6A 1Y1VJ 3IRQA 2MD0A 5IP6A 1UJ8A 2DDAA 4CXFA 2LB7A 1D1CA 1VF9A 1H9TA 1LPQA 1QBJA 4WJBA 5K5QA 2YNEA 3RPUD 1OCPA 3PNTA 4E1PA 2ZEMA 1IDYA 2IGNA 1W4RA 3W2WA 1SAXA 1TTYA 1WJCA 1X19A 4ITVA 3CC7I 1R1TA 2VPLA 2PJ9A 3D2MA 1K7VA 4P4JA 3BT9A 3QRFF 4KOTA 4R7MA 4HW0A 5LD2C 2L02A 4NJRA 2ORWA 3J7ZI 3GTOJ 2L7MP 4I02A 3J80Z 1AA7A 2R5ZA 1S9HA 2HTSA 5GTHC 5F64A 4XPLA 3GTGJ 2JK3A 1IN5A 1IF1A 1KWMA 1XRYA 4IHVA 2EVNA 4NJQA 3HUVA 5DD8A 3TEDA 1B4AA 2K7LA 1WSUA 5IPAA 4EVYA 3Q0UA 4M9ZA 3M9AA 5ERIA 3TGNA 3IGRA 5B1AH 5GTIC 2LMDA 1FSHA 2VJ4A 3JRGA 2MC3A 3D7DA 4PZJA 2KZGA 3F8MA 3TX8A 4XLAA 1ZKGA 1IG7A 3QTLD 3JSPA 1YS7A 3HHHA 2JRMA 1CM0A 5H6RA 3CCLI 3PIPF 3HSFA 3F22A 1WJBA 5D4RA 4PXDA 2DA6A 1VQLI 1R7JA 3WR7A 1ZLKA 3FF3A 3FXOA 1UCRA 1Z3XA 2H6BA 2CUFA 3E6MA 3FMSA 5FD6A 3I53A 3ZP5A 1JTYA 2LNBA 5E18F 4M73A 1ELMP 1IOFA 1ETYA 1YLFA 1H8AC 2BBYA 3D4UA 3F6VA 1BW6A 1RI7A 4U87A 1GXQA 4HPSA 1WQ2A 1YOVB 3GWZA 2NSMA 4L89A 3GTQJ 4U88A 3HOUJ 1QSTA 5JM6A 3OYFA 1V4RA 3MZYA 2ZJQF 1MMAA 4OAEA 3PFIA 3RO0A 3NQOA 4RA2A 3IUOA 4R79A 3R60A 1BO4A 2QF7A 4J00A 4MFJA 2JA2A 4PGHA 5DV5A 2L9VA 1SGQI 3BR1A 3HG9A 2X0LA 3GFIA 3U21A 4P1WA 5CQEA 2LH9A 3UGDA 2SGDI 3OL3A 5KTDA 1HDUA 1H88C 2FNAA 2ESNA 2GKTI 1A36A 5CPRB 1OBRA 5EBVA 2XB5A 2QLZA 1X3WB 4M3DA 4RBOA 4BD9A 1BIBA 3DTKA 4HQMA 1T2KA 2A07F 4NNJA 5K5OA 2ENZA 2FIAA 2PRBA 1MSEC 3RQIA 1BR1A 4KOSA 2QWWA 3OV8A 2QM3A 3SEKC 1YW6A 2XRLA 1ZRFA 4WWVA 1B8IB 4KFCA 3IL2A 2PCUA 2GXGA 1XTAA 1ZGJA 2CH0A 2VODA 3HM5A 4KIGA 4Y33A 2ZKZA 3HJEA 3L2WA 2AS5F 3EY5A 3V4GA 3GLJA 1TBQR 4M3FA 2QSGX 4Y7NJ 2KPMA 2ZC2A 2E60A 1SVMA 1U9NA 3FM5A 3PSFA 1T0FC 2AHQA 4H4KC 2EWBA 4W97A 3PFYA 2R5YA 3SJGA 1ZH5A 3FBUA 3PZJA 5LRJA 4RMNA 2HYFA 2WGCA 3SI1A 3SJMA 1TUSA 2HGCA 3ZCOA 3QYBA 2JSCA 3QPTA 3ULQB 2O6GE 2DPUA 5DCMB 3KR5A 1BM9A 3NH8A 3JRUA 2XIGA 2EFNA 2ZNYA 4DGWB 2JTVA 3BG9A 2GIVA 4A3MJ 1IUYA 2KMOA 2OCEA 1R1VA 2F5CA 3G4SI 1CHOI 1O3RA 1JGGA 2Z3NA 1LAPA 2M7BA 3JRFA 1R5HA 3HH2C 4OC2A 3LWUA 2EB7A 1W5SA 3MGDA 2EV6A 2R3SA 3BY6A 3R6SA 1U8RA 4BBHA 3CJRB 1LR9A 4FETA 5LRRA 1XF8A 3S2WA 2P6TA 3KETA 4ZYGA 3J81Z 3G6EI 1K79A 2YS9A 1RESA 1KU2A 3B3CA 4ZX8A 2N8GA 4B12A 4XN0A 1YREA 3T5XA 3TOBA 4A0YA 5HQ8A 3IHUA 4Q38A 4XOTA 1IW4A 1QMUA 3NARA 3I5UA 1TKJA 4HF2A 1F5TA 1E2XA 4P45A 3FXMA 2GFQA 2M9HA 2H1LA 1JI8A 1Z7KB 2W82A 5EDNA 1GUUA 4IRHA 3TE4A 4AVZA 2V1DA 2GLFA 4L5JA 3WHCA 1Y0RA 2P6GA 3BI1A 3CZXA 1F2OA 3LQQA 4E0AA 2V4JC 3M8JA 5B66C 2ZJ2A 2NYQA 5K7HA 4KDPA 3H9JA 4CYCB 2ERWA 5L3EA 4MCRA 2E1OA 1WJDA 4I2OA 3CF2A 3VE5A 3DEEA 2CUZA 3ZXSA 1W36D 1RIOH 3K2ZA 4YIRX 1ZG5A 2GXBA 1WCMJ 5IOZA 4F7ZA 4ZY2A 1PJRA 2JA5J 3CDHA 1R4NB 2LKSA 3T90A 1O7FA 2QYVA 1V5FA 4ZDOA 4C7HA 1C0WA 3RU0A 3BTLA 4FISA 2QSFX 1GLNA 2QA4I 3RKQA 3WODF 5DTDA 1ARMA 4BJTA 2UXNA 1FYKA 1SC7A 1QZYA 2PRQA 1USTA 3JTKA 1PJUA 3VYRB 3OIOA 4NDLA 1P2FA 5HOOA 2GREA 4XNHC 1E17A 4GCVA 1TF9A 2DU9A 3PGPA 3MEKA 5K8PA 4XBFA 1BR4A 2E19A 4KOVA 3BCAA 4LLLA 2NVQJ 1Y8RB 5C3EJ 4PXBA 2GKRI 2Q8KA 1KUXA 1K61A 3GFMA 4JXQA 1QSOA 2X52A 5CCMA 4UCNA 2RREA 5GAEJ 4PK4A 4PUSA 2O4HA 3G73A 2PJ6A 1HDDC 1CPSA 4ZY1A 2HZTA 3A02A 1ITYA 4JZ0A 5K7ZA 1K6OA 2CV2A 5IOYA 4C3IJ 1JXSA 4MJ8A 1VQNI 3FXTA 3SZGA 3JRBA 2BL1A 1D0YA 4W9YA 2HNHA 2LY1A 3NWTA 1GDTA 3KLNA 3OXFA 4UIBA 2L0KA 3TMOA 1NK2P 2ZJPF 1Y7RA 1I6XA 2Y69H 4EMSA 3BTCA 3PRTA 4RM2A 2EFQA 1WI9A 3JUWA 2MC4A 5CPAA 2FUG2 2ELIA 4OLLA 2FVGA 3QOEA 4DYCA 4RN7A 3B4VC 4UEEA 3PO3J 1JKOC 4EWTA 1OISA 2DPTA 1XB4A 1RPWA 1XS9A 4RAFA 4Q5SF 1M4GA 3CCMI 1VQMI 1ON1A 5FUWA 3ESWB 1RRJA 2IGKA 4G7OF 2XEIA 5DM7F 2ME0A 4NGNA 1VQ6I 3N4MA 1BBYA 4E7HA 3C26A 4HLXA 2HXOA 1DGRM 4Y3OA 4OIRF 1FOWA 4PQAA 1QGPA 1NK3P 4HF1A 3QYEA 2CV0A 3UEYA 2JJ7A 4YELA 2A20A 1XMAA 3H36A 4M6VA 1HF0A 1DUXC 2NU0I 4BU2A 2MH2A 4A2UA 3I9SA 3D7HA 2MH9A 4FBEA 3K2AA 3FH4A 2VBXA 2DO7A 1ULMA 3L2QA 2F8HA 3HLPA 4CRYB 3L00A 1HXDA 1FIAA 4M6HA 2CGPA 1Z05A 4KICA 5FKLA 2Z9OA 3LSJA 2BVLA 1VNDA 3OXLA 2JDDA 1G2HA 5EYRA 2JVGA 2ZNZA 4Q48A 4BL0B 2XVCA 4G7ZF 4LIVA 2JWTA 2YNDA 3R9FA 1XA6A 1TWGJ 4NSQA 4EQQA 5JHWC 1ON0A 4I76A 2E34A 3S17J 3BG5A 4CYNA 3OVOA 1XC5A 3ZQ7A 5IT9K 1R36A 2G7HA 3K4CA 1TW2A 1Z7LA 1MZBA 1X4PA 1R5GA 2IXSA 4MFDA 1HDLA 1W7PB 2EZIA 3DTIA 2IS6A 2DYSH 2C6CA 2DMTA 2Q4VA 3M07A 5LGTA 4NF1A 4PK3A 5JH9A 1ZK8A 2ACJA 2CIJA 3G2BA 4E7LA 4FD4A 3DWLE 3W6VA 1ZQ3P 3GTKJ 4NGTA 2ZW5A 2IA2A 1U2WA 5D6EA 1QPMA 4OIOF 1LNWA 5EF6A 3R1KA 1SGNI 3T8TA 1HEVA 2FXFA 3CCUI 1CP7A 1P9QC 1ETXA 1SFUA 3DBLB 1FMVA 4L0YB 2I00A 3QU3A 2D4PA 2FBHA 4R8HA 3R0AA 3F23A 2HS5A 4CCNA 1ZG1A 3ZPLA 2HQYA 3A01A 1Q2CA 4OC4A 5G20A 1SFEA 2HOSA 1YVOA 5LFAA 2GBYA 3UKGA 2WAFA 5E1XA 2RQQA 3S1NJ 1Q1HA 3RYRA 2HOTA 3ML6A 1B72A 2FL4A 2FIWA 1VQ5I 1UHAA 1M8BA 2AE6A 4P4IA 1HKQA 2RIJA 3GB0A 1Z2IA 4RI1A 4WK8F 3RCOA 5LEKA 1FOKA 1FIPA 2VKHA 2NVUB 3ZMDA 1MNMC 3B2YA 5K8MA 2VPRA 3PO2J 2P7VB 4FT8A 2WB1A 4JWPA 5DS0A 3WU0A 2HPMA 3BC8A 4YRVA 2Y30A 1IN8A 2XSJC 3H0DA 3FEDA 7CPAA 2FQ3A 2ZBKA 1O4XA 3JRDA 1P6RA 5C4XJ 3F72A 4CCLA 4SGBI 2BOLA 5AIQA 4UVBA 4WWCA 3WU1B 3AL0C 3EUKL 1IXCA 1HQCA 2XB0X 4EM2A 1EJ9A 1Z3YA 4AU7A 3QWPA 1GV2A 1E0EA 3KEYA 1CJWA 3VH9A 4AG7A 1EH7A 2DT7B 2V1XA 5A27A 2GZWA 5AIPA 3JRAA 2POKA 1LOKA 4XMYA 3DR6A 5E17F 3PIOF 2CW7A 3BXMA 4KOXA 1WJ5A 3ZQQA 2HDDA 2VKDA 2RV8A 1B87A 5ILVA 1IUFA 3S8PA 5CVUA 1WJFA 1Y6IA 3QPHA 3DU5A 3BPXA 4JX4A 5L3DA 2JA1A 2VQHA 4UWIA 2PBIA 2RC4A 2ISZA 5IX3A 3N5FA 3E97A 1YW4A 4HX8A 4RS8A 3K4NA 2NU4I 1JUSA 2WCYA 3KYLA 3QWLA 4E7JA 3VYSB 3KX2A 5BQTA 2LBFB 4IOCF 1ULYA 2LDUA 4IX7A 4CHUA 5HH1A 1K4TA 2DCEA 3K4BA 4Y52J 4LK1F 4PCQA 3L7WA 4RB0A 5EEHA 2OOTA 2B5GA 2O0YA 1FSEA 1CP6A 4NB5A 3DBHB 1KBEA 5CLSA 4U7DA 1FWZA 3TDUC 3OMYA 1VQ9I 1YU6C 3CZ6A 2JBKA 4CCJA 3HYIA 2CSOA 3SXYA 1B6BA 2F7VA 3D1NI 4RUHA 2ZMEC 3JAMZ 4OP4A 3S9LA 2N52A 1BJAA 4EATA 3S14J 2V26A 1YJNI 3BTJA 2P5VA 1SD5A 1Z67A 1TT0A 2DQRA 2OCCH 2QQBA 3HGYA 1J4JA 2X6OA 4LOCA 5E20A 5FKKA 4J01A 2DF5A 3BLNA 1IJWC 4XKBA 3QP5A 2R7VA 3IWGA 2EK9A 5J1YA 4L18B 1SQHA 3OOUA 1KU7A 3EDPA 2FMYA 4NBQA 1CT2I 2Q4ZA 3DSBA 3SFZA 3VWBA 2IP2A 2VQGA 2ARPF 1OCZH 5DM6F 3CXSA 2RB7A 1TKHA 3KIOA 1TNTA 4JP0A 1M4IA 5H84A 4B5OA 2XGDA 2O8KA 2VC0A 1CT4I 1TOTA 1WWXA 4HAMA 4AWXB 5L3CA 1AU7A 2G3TA 2KRFA 3FB3A 4Y17A 3OYIA 3RZAA 2W0TA 3I4MJ 1XMTA 1STZA 4PJNA 1DQUA 3ZRGA 1NSAA 2VQYA 4OADA 4OIDA 1TWAJ 3CUQA 2L9RA 5D5UB 3VDXA 2E7WA 4PSWA 4MCQA 2R5YB 1UFMA 2M45A 3JW4A 4GM5A 1B59A 4UUVA 3CQZJ 3T0YA 1ARLA 3BPVA 3ECOA 1FBQA 4XKWA 1JTXA 4QTRA 4P55A 2V1CC 4YGOA 4X0GA 4ZYEA 2BHYA 4NGMA 3H8FA 1TC3C 2XASA 5F49A 4LB5A 2SGEI 2L7ZA 5FVJA 2A6EF 1MBFA 1AKHB 4P10A 4E7SA 3GXOA 3K7AJ 4F92B 3P9IA 1KQ0A 5JLXA 1H8LA 2ODFA 5KCMA 1WZ2A 2VJIA 3IFEA 5G22A 2K9SA 2MFZA 4II2A 3I4NJ 1LQ1A 4FE4A 4II9A 1D3YA 2RNJA 3GMEA 2GU2A 1R4MB 2JA7J 4IKFA 1MKMA 4NUBA 1RUOA 2I5UA 5JI6A 4EFDA 3OL0A 2PLYA 3A0BC 1WGXA 2ZB9A 3RZDJ 3PDNA 1W1WE 4NEXA 4G6QA 1YJ9I 1B72B 2PVVA 5E96A 4A24A 5GPCA 1Q2YA 3D66A 2G0EA 4YWYA 5C4JJ 4UV8A 3SFIA 2VB6A 4C2YA 3ZQIA 2K9HA 2YR2A 5HI7A 3MVPA 4AVPA 3H3VK 2VOOA 2DBBA 1IRFA 1P9ZA 3HOWJ 4H2KA 3HPGA 2V9PA 1YRNB 4KUBA 3BG6A 2GIZA 2EILH 1TZLA 3KQZA 5LRSA 3K4JA 1BI1A 3ABTA 2CF4A 2F5FA 5FJ8J 2L9SA 3LMMA 1ON2A 3UOEA 5FB2A 1IC8A 1SFOJ 1Z8WA 5D29A 2BCOA 5LYFA 5C44J 1X4SA 2P6EA 2ZSIB 2QQ8A 4PGGA 2QIRA 2ZOGA 4CA0A 5J1QA 1AYEA 1TW3A 4Z6YA 4UFWA 2JUCA 4EJTA 2FXAA 2PEXA 4L0ZB 3F8KA 2IA1A 4MCPA 1S8NA 3MQ0A 3UFFA 4U9ZA 4NGQA 5DD4A 2QGUA 1FOXA 2Y2ZA 2LLKA 4BQQA 2R7HA 2ZW7A 2ZPAA 1OMIA 2EO8A 1J7KA 3GEZA 4CCKA 2SGPI 4D7NA 2LRDA 3J7AY 2A68F 1ZGAA 2H8WA 1HKTA 2OC6A 1SMTA 5E3NA 4CSWA 1L0OC 5A2QZ 4CUGA 1N78A 1CE3A 4N4OB 1J0RA 4A6DA 1SEUA 4MFZA 3D7FA 2OQGA 5FLXZ 3SYTA 4BS9A 1LE8B 3HSRA 2VKVA 1Z0XA 2FT0A 2KDZA 2XPVA 4OC1A 2EIJH 1WRJA 1QVUA 2HOAA 4FX4A 3FEEA 4MHYA 4ZYQA 5F6FA 3Q9VA 1ENHA 2DYRH 4XRSG 2EK8A 3EUHC 4I0AA 2AFXA 1OYIA 2Q43A 3PQJA 2GA2A 2O5RA 2NS7A 5CKTA 3VYTB 2WPWA 4XICA 3T8WA 1UG0A 3CUOA 2K9NA 3FM3A 4ZH4F 5KHDA 5IT9Z 4OVOA 4A3CJ 1T95A 4G7HF 3RZOJ 5H2FC 1FNNA 1OMUA 2ODDA 3S16J 1M4LA 4PXEA 4C30A 3H35A 1TQIA 2HQAA 4BQAA 3HC7A 5H86A 4AUXA 4A3BJ 3O8HA 3G3ZA 4Y13A 3CC4I 2Y31A 5F0HA 2LSOA 1FJLA 2PJRA 1HCRA 2Q44A 3V7CA 1F9NA 4MY3A 1PYVA 1R71A 2GOXB 3IAS2 4S0HB 2R92J 3TJQA 5D5XB 1ZHFA 1RKTA 4HNYB 3V7ZA 1BOBA 1XG1A 1VIXA 2IL4A 3CP8A 2E2IJ 2DT5A 2IS2A 4B1RA 3IU1A 1XSDA 4GYGA 3OYEA 3UNGC 4E7IA 4MFEA 1QA6A 2JXDA 2OQRA 4FCYA 1M4DA 3GIUA 2DA4A 2EV0A 4XRMA 2PDOA 2RAEA 4UVAA 1KU3A 3L2NA 4F9UA 1FMWA 3TKYA 2NVXJ 4H89A 3AKZA 2ZEDA 3B02A 1AUGA 1Q7LA 2LKXA 1YO5C 4ZGYB 7WGAA 3FMQA 5FRMA 2F2EA 2EZLA 2FJ1A 1YFHA 2BVMA 4ESFA 5BOXA 4UCMA 1FEXA 1R1UA 1P4XA 3W3CA 1DP3A 5DAEA 4D1QA 1BR2A 1ZG3A 3BJAA 2FBKA 1YS6A 2DJIA 5HVHA 4UEZA 5D4SA 4UXIA 3HOSA 1IYKA 4C2MJ 4YU9A 2J8RA 2R7SA 9ANTA 2PR1A 3FIWA 4MHDA 4MHGA 2DI3A 2P6SA 4A3EJ 3OSGA 3IWWA 4YG2F 2LP0A 1U78A 2R7OA 2ELJA 5IY5H 3W6XA 4ZI6A 2Z99A 1HSTA 3MKZA 2NRAC 3KCCA 4RS2A 3V8IA 1R23A 3BR3A 2CQ7A 1FY7A 4XIDA 4IHWA 5HS8A 3H0GJ 3LFUA 4DYRA 4EV0A 5IB0A 4M9XA 4KISA 4ANJA 5HLGA 2HB6A 3IAM2 4XLPF 3RSNA 1MMGA 1YW8A 4G8XA 4A2ZA 4CAXA 2MABA 1G3TA 3K10A 1G3YA 2HOEA 3WTXC 1LFUP 3PB9X 1PCAA 5B5EC 4D5CA 3JRIA 1KMAA 4KOWA 4ZDLA 4PV6A 2DDBA 3ISXA 1L3LA 2N1AB 2V8DA 4XSZF 1QSRA 2ZEOA 4I49A 3ZQGA 2Q4YA 1K7UA 1DP7P 4KZTA 4FE7A 3KZZA 2VZYA 3E7LA 3S3NA 2G3AA 5BWAB 1X3UA 1A31A 1LDKB 1MBJA 3D5LA 5JLWA 3ZN1A 1O3QA 2CG4A 1SVOA 3CESA 4F0YA 5TJJA 1TBOA 4M85A 4AB7A 3I0TA 2JEWA 5DUKA 4I01A 4UV9A 4M9SA 4IF4A 1X4OA 2MLGA 1LVKA 3IC7A 4YFKF 3E0KA 3S6GA 3SJEA 4IK2A 2IRFG 1IU8A 2PJAA 3FRMA 4YIFA 2PJ2A 2OF7A 1NUBA 2OZUA 2B0UC 2VJ5A 2KRCA 4BGDA 1QPIA 3W2AA 3EXNA 3C2HA 4IEJA 3WTYC 3E5XA 1Z9CA 4B11A 4E7ZA 1ZG9A 3IIBA 1ETWA 2PQ8A 3KY9A 1Z6TA 3HUGB 3ZQHA 3LA2A 1O3TA 3FK6A 1XDUA 3RYPA 3E3VA 1FP2A 3I59A 3ZMTA 3GTMJ 5IP7J 3D00A 1YQAA 4UIAA 4E2AA 2M4GA 5HNFA 3ISZA 1N75A 2NVTJ 2L9NA 1YW9A 4D9JA 3OSFA 2ZEEA 4ABZA 5J4YA 3S15J 1CGII 1APLC 1S7NA 1S5KA 1ZN2A 2K5CA 4HGUA 4R8FA 1RKWA 5F09A 5D5WB 4OOIA 1U5TA 4OMYA 2M0CA 2STWA 5FO5A 3KP4A 2COMA 1IO2A 1ZLJA 2O9LA 2YNCA 5IYDJ 3KL9A 2F4IA 2LKPA 4MHPA 1IV8A 1P4AA 4A38A 4O6JA 1T6SA 2Q0OA 2F3CI 1J09A 1CBXA 1QSMA 2I3CA 5J6XA 1R5ID 5HODA 4QUSA 4M3EA 1FOYA 2XKOA 2UZKA 4NCZA 2EIKH 3RKXA 4D5FA 2EZKA 4LG0B 2EIMH 3E2IA 4P4FA 2QKLB 4CGNA 1TWFJ 4CRZB 1W5TA 4BBRJ 4Q4ZF 2B8TA 1G6NA 1BOAA 1SD4A 2I10A 1XSVA 2LG4A 4AIDA 5ICCA 1LAMA 2AFUA 5LBQA 1MBHA 2O53A 2VIXA 2D4OA 4CGPA 2O8XA 3F8FA 3LACA 4IF5A 4L9VA 3CD6I 2HKXA 2IGOA 4M3SA 4C68A 4Q36A 3EETA 3MWMA 4LD5A 2CXAA 3G8WA 1CF7B 2JA8J 4A30A 2KZVA 3O6BB 3CO7C 1NMTA 1F36A 3HUGA 3R5DA 2BEIA 2OVOA 3HEFA 5HLTA 2OV7A 3S1RJ 1B6AA 3R61A 4ZC3A 1T0FA 3SGQI 4BY7J 2BE5F 1GYTA 3A03A 2PC1A 1LEAA 5DUIA 4D7MA 1D5YA 1XMBA 1IN6A 1DPRA 4A39A 2CS3A 4XSXF 1HJAI 3BR0A 3MN2A 2MBFA 3LWFA 3A2KA 3WTWC 1SD7A 3U9GA 2R7TA 4MFKA 4FQGA 2OJED 3DF8A 4EJOA 2WAEA 5EC4A 3H8GA 4IHMA 2R7QA 1BJZA 3GUDA 2AFOA 3GO5A 1B9MA 1XBUA 2IJZA 3BZKA 3G1MA 3TCVA 4ENMA 5FD5A 2X1CA 5CVVA 1TNSA 4MRIA 5CBMA 1A6IA 5HVQC 4ORFA 4RM3A 4LLGF 2L4MA 1BN5A 1I3QJ 1ZREA 3HB9A 4E1RA 2FNPA 3VDPA 3K1MA 1H0ZA 1T38A 1S6LA 2BOAA 4DIQA 2R7FA 2CW8A 1LFPA 3H9QA 3D7GA 4JLYA 2OU2A 2Q04A 4PFOA 1YX5A 4XLCA 1Z4EA 3SXOA 5I0CA 3CMEI 2VZZA 2ZOFA 4I7HA 1YTYA 4A3JJ 2BXZA 4MBUA 3K1NA 3DTEA 4BJ5C 2X48A 1X1CA 5FUVA 3M8EA 2B4DB 4FUUA 4A93J 1OPCA 2KQRA 4CAVA 4NXYA 4M72A 4FWUA 2G0BA 2VI6A 3HSEA 4DBQA 5K1YA 1Q2DA 2PSWA 5LYLA 3JR9A 2KP6A 5EZGA 4E70A 3D5SC 2L8EA 2FCKA 2FE7A 4KUMA 1ULNA 4X1EA 4G12A 1BC7C 4P6YA 2DT6A 3C2GA 4C2ZA 5FFXA 4LGWA 3WC7A 3P2HA 3NWSA 5ELYA 3S6HA 3LA3A 3JRCA 2C6YA 1HW2A 5E3OA
chains in the Genus database with same CATH topology
1JHFA 2V79A 5E8IA 3EO4A 2XAQA 1BI0A 3F0AA 3ZMSA 4X5KA 4HZFA 3NEUA 3ECHA 4AD9A 2B5GB 2MA3A 2TDXA 1FPQA 1KZFA 4RGSA 1XIXA 4QBJA 1IN4A 1KUVA 4CAWA 4CGMA 5JHUA 5ILUA 2KIFA 4KS9A 4BAYA 3GF2A 3I4PA 1LDDA 3R95A 3BWGA 3Q5FA 3H3UA 2QUFA 2DK5A 3SQNA 3S6FA 5ICFA 3RPUA 3F8CA 3HRUA 3KZYA 4U0YA 4XPDC 1KA8A 2QVOA 2YX7A 1FT9A 4H6ZA 5BPDA 3KFWX 4R3LA 3SHPA 2EFOA 4R1HA 4LX9A 2V9VA 5ILSA 2XAJA 1FYLA 3U1DA 4KOYA 2RDPA 4BXUA 4XNHB 2PG4A 4CAFA 1RZ4A 2VOPA 3I59B 3V7RA 5HS9A 1LB2A 3O3KA 4IJAA 1VKCA 3N97A 1OYWA 4HDUA 4R9MA 2PMHA 2RQPA 4KOUA 3VOEA 3HOTA 3TO7A 4BNCA 5AGEA 2HQNA 2XGXA 4A32A 1FC3A 3KLOA 3Q9SA 4YFNF 3BOQA 2REEA 1R00A 4U0WA 3D0SA 2HTJA 4BHCA 1H9GA 4B8XA 3GW2A 4QLCU 2M87A 4EGZA 4RB2C 4PK2A 5BS6A 1BC8C 1S7LA 2PR8A 1OZPA 5D6FA 1S7KA 4A0XA 3DP7A 2MD5A 4QWQA 5ED4A 2P5LC 2VEZA 1YX0A 3DR8A 2BSWA 5BPIA 3VB2A 3K9UA 2K4BA 1MDMA 5CNPA 1K78B 3IWZA 1U5TC 3ZMVA 1P0HA 3OOPA 3D8PA 5E8GA 4Z2YA 2JPBA 3H92A 2PI0A 4KVME 2JDCA 2ZMEA 3TOAA 3WTZA 1OR7A 2Z3LA 4ENKA 2FE3A 1UFHA 2NNYA 4AVBA 3F21A 2IT0A 3P7NA 1PUAA 4IRIA 4MFQA 4OINF 3RKYA 3K9TA 2DPDA 4MY0A 3KP7A 3WGGA 2WUUA 4UBRA 1UHWA 5J8FA 3TFYA 3KE2A 4XLNF 3CLOA 1JGSA 3FHZA 4P9UA 2VC1A 1XN7A 4P96A 2VN2A 2JPCA 4R3KA 4ESJA 5D8LB 3CXPA 2QYOA 3JAMK 3V8KA 3W6SA 3V7SA 3CXQA 5AG7A 2REFA 3BJ7A 1YIOA 4MTDA 3F8NA 3KP2A 3DPLC 5LHIA 3EQLF 5CYVA 2DAOA 3CO6C 1HW1A 4BH9A 1KYZA 3BP8A 2XHKA 2CY2A 5AG6A 3GLXA 4BMHA 4M74A 1G3WA 2FU4A 4WCGA