1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 PROTEIN
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
4UXNA 2XV4S 1IN4A 1F9NA 2AXLA 4G6QA 5L3FA 4ZYEA 2FIAA 1YR0A 5D8LB 1YTYA 1BIBA 4MJ8A 3P7NA 4AG7A 1OYWA 4ZYGA 1YYVA 1ON2A 1RUNA 5FLXZ 5F47A 2PMUA 3K1PA 1XSVA 4JQFA 1M44A 4X5KA 1O3SA 5D5VB 2XGXA 1HSJA 3HOTA 3B73A 3WTWC 2D1HA 1TW2A 2ADUA 3T0YA 2OA4A 1Z6RA 2MBFA 4KIFA 4GGGA 4KLWA 3TOBA 4HF2A 4A5MA 2IJLA 4S04A 4MBUA 4ESBA 1XGSA 2CGPA 4TV7A 1FX7A 3ML6A 2Q0YA 1Z4RA 1OMIA 2Z33A 4IRHA 1QQIA 4I0BA 2ZFWA 5BS6A 3OWCA 4QC6A 2H94A 5JFRA 3WGHA 3HSRA 3GLXA 2RV8A 2YSRA 2Z5UA 2Q0OA 3QP6A 1W7PD 2FXAA 3IL2A 2VOPA 2IL4A 2A6HF 4R57A 4OMYA 3E97A 3NQOA 1T6SA 4Z2YA 1SFXA 4AD9A 2FIWA 3QOPA 2K86A 5ICGA 2H27A 2CYYA 3J80K 1KQ8A 3FXRA 4G8XA 1QSRA 4PDKA 1IUYA 5E20A 4R1HA 1IN7A 5EC4A 4QLCU 1U6GA 1MD0A 1DPRA 1KYWA 1V4RA 1S6LA 1XDSA 4GYIA 1CF7B 4L5IA 2YU3A 1VKCA 3Q5FA 4IF4A 3R0JA 1EH7A 1ZRCA 5LLQA 1K79A 4QUSA 4MQ9F 3AAFA 5BPDA 1ZARA 1K78B 1GHCA 5F1RA 3GF2A 2JPBA 1FT9A 5ILUA 4I09A 3CUQA 3Q9VA 1FYMA 1SQHA 3N7ZA 2YX7A 4N9IA 4O5VA 5DD4A 3H4QA 1RIOH 4IVNA 3DR6A 3KP4A 2P5KA 1HW5A 4YIIA 4ESFA 2JDCA 3F8FA 5D5UB 2FMYA 2X7BA 2DLLA 2RQPA 3VODA 1AOYA 1MK4A 3E5UA 1Z4EA 4O3MA 3TTHA 1U78A 5K5QA 3M7GA 2VBXA 2AS5F 1MDMA 1HSTA 1R22A 2A5YB 1KQ0A 2ZXVA 3MZYA 4LLLA 4ONUA 5K1YA 4G7ZF 3U9GA 2O28A 4LUAA 4FD4A 5FVJA 2J5PA 4WCGA 4NSQA 3GVAA 5FB2A 4HAMA 3GW2A 3RPUA 4EM1A 3L7WA 3BJ7A 1MJBA 5DD8A 2EA4A 4XSXF 2GAUA 2HTSA 4EVIA 3MWMA 2M87A 3C1DA 4MEXF 3EYIA 2Z3YA 1O3QA 4FX0A 2L02A 3F8NA 3BJOA 5L3CA 4MY0A 3R96A 3VOEA 2CSOA 2R8VA 4HX7A 4ASNA 4YFXF 2OB0A 3ZP5A 2QIRA 1FSEA 3IHUA 1P4AA 3V7CA 3KEQA 3GO5A 1UFHA 1QSOA 1LQ1A 1D5VA 1P4XA 2FT0A 3TKYA 2WPXA 1O7FA 3GFLA 4HLYA 3FXQA 1S29A 2CQKA 3OOPA 4UVAA 1ZLJA 3BJ8A 2EV6A 3BPXA 5TJJA 1T0FA 5E1ZB 3K1NA 1GHEA 1B9NA 4KN7X 4PZJA 1ZREA 1TTYA 3DDDA 4CHUA 2VQYA 2ETHA 4GCVA 2VZYA 4UNOA 2M5WA 4KOSA 3ERED 3DFGA 3G8WA 1MJ9A 3WTVC 4WF2A 3KFWX 2IP2A 3ZMDA 4LK0F 4QWQA 5BOXA 4KNYA 2W25A 2QVOA 4WXHA 2EFQA 2Z10A 2MH2A 1USSA 4PK2A 2W84A 3PQKA 4ZZLA 1S7OA 3WTSC 3O6BB 3DXJF 4M9SA 2HUZA 4KOXA 4NEXA 1R36A 3WGGA 2A3SA 2CG4A 4EJOA 2IRFG 2VXKA 2P6SA 1J2XA 1G3WA 4G7OF 3M1EA 3VWEA 5HOOA 1HQCA 3L00A 5JI6A 2VODA 3ZMVA 1Z1DA 2DQLA 2EJRA 3N4MA 1YX0A 3GZ6A 4KLVA 2GXGA 3HRUA 3E3VA 1W5SA 4K30A 3O3KA 4G9YA 3DKWA 3BZ6A 4LLNA 4CS0B 2W24A 3CXPA 3GEZA 2XAGA 1LDDA 2Q7BA 3QAHA 1LEBA 2O6GE 4E0AA 4JXQA 1XMKA 1YLFA 2RKHA 3RKYA 1E2XA 1K78A 2C27A 5HLGA 1V3FA 3HTSB 1JHHA 3IC7A 3RYRA 4JK1X 5D4RA 4CAVA 1TQMA 2CY2A 3TGNA 1S60A 1P92A 3KKWA 1FC3A 5CJ9A 1J9IA 4QB9A 3D3SA 4RS2A 5BMZA 3E6CC 3I3GA 2ESNA 3FMQA 4BQAA 5DEQA 2FMLA 4OADA 1FP1D 4OIQF 3FIXA 5F49A 1KUYA 3EXNA 2LNBA 4B5PB 1XIXA 3MEXA 4PSXA 4Y13A 1ZG5A 1QSTA 3JVNA 4HV5A 2PEXA 4U0YA 3TE4A 1J59A 3HYIA 2EFWA 2E1NA 3FBUA 2Q4VA 3FRMA 2BUEA 1AWCA 2EFPA 2PQ8A 4ENKA 3J81K 1R57A 4AB7A 3LSTA 3F8KA 2ACJA 2OAZA 1Y0UA 5AONA 5A2QZ 1ZGJA 3H3UA 5DWNA 5DUIA 3I59A 4KMFA 3UY5A 5E18F 2FL4A 4HF0A 2F5EA 2PN6A 4O6JA 3T5XA 4JWPA 2CNTA 4R3KA 4AIKA 1P4WA 5D8KB 5BQTA 2O3FA 1Z9UA 3PGPA 4CAXA 4EJUA 2V6CA 3LA3A 4RAYA 4A0XA 1IAWA 1U5TA 2EFNA 2PSWA 1ULYA 2Q8KA 1REPC 2PI0A 2J8RA 4CICA 1YVKA 3E0KA 2FCKA 3KP5A 2B5GB 3EETA 5IT3A 5FGMA 2BSWA 3JUWA 4EMSA 4KOTA 4U7BA 4KT5C 4YIFA 4EJWA 5D5XB 1QZYA 3RDIA 5L3DA 1P4NA 3HIFA 1FBSA 1QSNA 2X0LA 1P6RA 5FO5A 1ZG3A 2DW4A 2RDPA 1O3RA 1USTA 5HH1A 1FBQA 4GS4A 1I6XA 3WU1B 2VBZA 1YS6A 1Z7UA 4Q48A 1ZH5A 3G3SA 3F8BA 1Z05A 4M72A 2UZKA 2M45A 2OH1A 1J75A 3I5UA 4KOWA 4A2UA 3TCVA 5KTAA 5E1XA 4L8AA 1R1UA 4UUVA 1F1ZA 4WXDA 3I4PA 3KE2A 1F4KA 1B6AA 1P2FA 2ZW7A 4M73A 1PDNC 1BBYA 4A0ZA 2NRAC 1I1SA 3ZMUA 3WR7A 1RNLA 1TIQA 1BOBA 3BP8A 4HDVA 2O03A 2NNYA 3E6MA 3ZPLA 4EM2A 3KP6A 3IKTA 1YREA 2KJCA 2K02A 3IKVA 1KU3A 3ECHA 1SMTA 1JE8A 2K5TA 1WWXA 2RN7A 3KLOA 3JSOA 2ELHA 2HKXA 5DCFA 4JLYA 4KICA 1KU2A 1Y9KA 2XAFA 3C18A 5IX3A 2R7HA 2P6TA 5DCMB 4F7ZA 4AVBA 1JGSA 3FM5A 4UVCA 2BYVE 4R3LA 4RGXA 4G94A 2STWA 2P6EA 1HBXG 1BIAA 3ZN0A 5EBVA 3GFJA 3CUOA 3GYHX 1I27A 5FD6A 1OKRA 4B5PA 4FD5A 5JVTA 4M85A 2ZMEB 4HBLA 2L4AA 2BL1A 1WI9A 2ZNZA 3BJAA 3TT2A 1HKSA 1KUVA 4MGRA 3F3XA 3COAC 2QZ8A 5E17F 3FX3A 2L01A 3MZHA 1G3YA 4RAZA 2EVNA 1N71A 1YO5C 3CO7C 4HNYB 2P5LC 1J0RA 3C7JA 1S3ZA 1NHAA 2XRNA 3JTHA 5L3GA 2EWNA 3FF5A 5CVJA 5JHUA 4RB1A 1IF1A 4KUAA 1M4GA 3V8JA 2DQRA 5LRRA 2IT0A 1FSHA 5H20A 3F6VA 2M1BA 3TQNA 5HVQC 3RTRA 1I12A 4EGZA 3GZ5A 1GVJA 5HDGA 4A6EA 2FQ3A 5LEJA 4II9A 4YFNF 1U3EM 3EO4A 3GWZA 4HV6A 3BDDA 5KTDA 1Q2DA 2B5GA 1QO0D 4LK1F 2FS5A 4OU0A 2JSCA 3DPTA 5CVVA 3F6OA 2KKOA 1MJAA 1B59A 1D8KA 4HX4A 1KU9A 3C3WA 4OIRF 4HNXB 3HHHA 1XCBA 2DXQA 2QQBA 2LDUA 3D5LA 2A68F 1IN8A 1NE9A 1S7LA 4A12A 3JTGA 2B0LA 2BEOA 4IPAA 4ENMA 2STTA 4HKFA 5ED4A 2BGCA 4CYDA 2FE3A 5CVUA 3PP9A 3IWZA 2HYFA 2MD5A 3EYYA 3WE2A 1S3JA 1MKMA 3KP7A 3DNSA 3I9SA 1BC8C 4BYYA 2A4NA 1O3TA 2LF7A 1UB9A 4AG9A 4AIHA 4A5NA 3R61A 1SD7A 2FBHA 4HYEA 1FLIA 1TNSA 1BI2A 4L9VA 2ZJ2A 4U0WA 4ESJA 1LJ9A 3GFMA 1XGNA 1OZPA 1B6BA 5IT9Z 3P9IA 3EY5A 3HRTA 4I01A 1TNTA 2XKPA 3TFYA 3P2FA 1IIDA 3K0LA 1D3YA 2L4MA 3BLNA 4KUBA 5DWMA 1IN5A 3JAMZ 4B09A 1I21A 2XUBA 2UXXA 5A2QK 4A6DA 3ISPA 5DUKA 3SHPA 1OYIA 4KN4X 5FD5A 1WRJA 4KIGA 1U6MA 2QUFA 5HS7A 5DCMA 3TDUC 2FNAA 1WSUA 2CNMA 1DPUA 4M6XA 2PR1A 2AE6A 4U0VA 3R60A 1YW7A 4I7HA 4P55A 2ZMEA 3W6XA 3ZN1A 3FYNA 1UHWA 3MGDA 4LFUA 4LLGF 2JEVA 4FD6A 5ICEA 1W7PB 2PG4A 2MLKA 3QU3A 2B4DB 3S6GA 4FD7A 3GUDA 1VTNC 4XNHB 4B8XA 2W57A 2HV2A 3CXQA 2VC1A 4LX9A 3DR8A 2RC4A 1IICA 1HW1A 3F21A 1YVOA 2P8TA 4ZYDA 1LDJA 2E7XA 4BAYA 3ABTA 2JZYA 1PP7U 4AIJA 4CRYB 2K27A 2PC1A 4OIPF 3V7RA 2GXBA 1CGPA 3IGRA 4E70A 1FYLA 2P6GA 3ZMTA 4S05A 3LFKA 2VBWA 3CO6C 2OZGA 2JPCA 4DNCA 3G3ZA 4DQ2A 1MZBA 2B3UA 1ZAOA 4UV9A 2B3VA 1IZ1A 1BI0A 4UV8A 1Q2YA 2HR3A 1UCRA 4U9YA 5F48A 4N0BA 2BE5F 2H09A 2EFOA 4OLLA 2D2WA 2HZTA 2R7DA 3LA2A 4L9JA 1H9TA 3QRFF 1PUAA 2IA2A 1BN5A 1FPQA 1JXSA 1DP7P 4KORA 1KGSA 4MHGA 1KA8A 4HW0A 1XCVA 2V9VA 2ZCWA 3FXUA 4IUSA 5HS8A 4U5YA 4WX9A 3OV8A 3LAPA 1KU7A 2WPWA 3H92A 2PLYA 4HLXA 1R58A 3S6KA 3K9UA 1CF7A 4F0YA 2XROA 2F5FA 1XF8A 4M74A 5D6EA 3GX4X 3WTYC 1FY7A 1K7AA 2LSOA 1WK4A 5DYMA 3F22A 2FBIA 3P9CA 3SXYA 1S7KA 4HNWB 4UBRA 1I5ZA 2R1IA 4UWIA 3MQ0A 2HKOA 2O0YA 3D8PA 2ZW6A 2OZ6A 3KP3A 3K9TA 2EUIA 5H86A 2VT2A 2DT5A 2HS5A 5E8GA 3VWDA 4CRZB 3J80Z 2RNJA 3BY6A 3LA7A 5FLXK 1TQIA 2ISYA 3PFIA 2MLGA 4XNHC 3K69A 1XE4A 2E1CA 1PUEE 3RPQA 2FSWA 3QPTA 4YFKF 2IA1A 4HQEA 2QYOA 4AVAA 3M8FA 4L9TA 3REOA 1LNWA 1XN7A 4EVYA 3C26A 2FXFA 2R7FA 4KMUX 2D4PA 3NE7A 4YG2F 3KEOA 2VE9A 2GANA 3V8IA 4IF5A 1ON1A 1NMTA 1IRFA 1PP8F 1YG2A 4CXFA 4HQMA 1W7PA 5D4SA 1GXPA 2WTEA 1O7LA 2FA5A 4I02A 3SXNA 2H5MA 3MFKA 2ZNYA 1T39A 2BEIA 1S8NA 3LWFA 2EV0A 2Q44A 2MA3A 3F0AA 1B87A 1Q1HA 5CVRA 1IYKA 2EA2A 3T1BA 2V1XA 2YPRA 5CVIA 5FFXA 2OBPA 3V8KA 3EQLF 3I64A 2HQYA 2ZPAA 2DBBA 2Z0ZA 2I79A 5J8FA 4KOYA 2QQAA 2VT3A 1M4IA 2TDXA 2KCWA 1RO5A 2D45A 1J4JA 2ATRA 2IA0A 4OAEA 3D0SA 2ZBKA 2HOEA 4KVOE 3ROUA 5E96A 4Y49B 4XLPF 2ZKZA 3FZVA 1XSDA 2XVCA 2KRFA 4WWCA 2VEZA 2VXZA 2IW5A 5K5RA 2HWVA 4ZZDA 2Z11A 1TLHB 4CZZA 3NEUA 2HYGD 2Y75A 4UWJA 3SHFA 4UVBA 3G73A 1YW8A 3RYOA 3CTAA 1XMTA 5DDGA 1M1DA 5C88A 4QVTA 5D5WB 1DUXC 5GCNA 2NAZA 3L09A 4I2OA 5CYVA 1BC7C 4H6ZA 3CLOA 1ODDA 1SFEA 4FHTA 1IRGA 2MC3A 4JJXA 4PGHA 4LG0B 3T90A 3N97A 4U9ZA 4FT8A 5H6RA 2DI3A 3HSFA 1IW7F 2FSRA 3GKRA 1HKQA 2FOKA 2M8EA 2J8MA 2P5VA 5ILSA 3BJ6A 4R8HA 1J5YA 5F64A 4MTDA 2JT1A 1Z6TA 1FNNA 5BPIA 2GWRA 3CUQB 1LEAA 2B58A 5JR3A 2AJ6A 3DV8A 1ON0A 2DPDA 2DAOA 1XGOA 3EUHA 2DK8A 5LEKA 4L5JA 3ZZIA 1U2WA 3TO6A 3CDHA 4D0PA 3E5XA 2GA2A 3VFZA 2DO7A 1K6OA 4PSWA 1L0OC 1FBUA 1IXCA 4E2AA 3K1MA 2EB7A 3ZJ0A 4XRFA 5LHHA 3R95A 3F72A 2G0BA 2QM3A 5HDNA 3E6BA 1RI7A 2HGCA 4ZYHA 3ZMZA 2MH9A 2O8XA 1IYLA 4M9XA 3W91A 3I71A 5HDKA 1IB1E 4LJZF 4KZTA 1MGTA 1LDKB 1K4JA 2COMA 3V7SA 4CDGA 4LGWA 2K7LA 3H3ZA 2L54A 3U1DA 4ENNA 4Y49C 2DK5A 1G3TA 1BI1A 2F5IA 3WG9A 3WTTC 5LGUA 3E5QA 4Q4ZF 2H6BA 2P7VB 3F23A 2YR2A 4KVME 1YFHA 4HOBA 3LD2A 1Y9WA 1RZ4A 3EFAA 1KUXA 2H6CA 2FU4A 2RGVA 3BWGA 1ZG1A 2CFXA 4QBJA 3QU6A 3GFIA 3NRVA 3KETA 2UWMA 3SFZA 1YS7A 4G7HF 3LODA 3VEPA 4BHPA 4NCZA 1FZPB 2HFHA 3KZZA 1EH6A 1FWZA 1BJAA 2GQQA 2ZO4A 1QSMA 3FHZA 2PRBA 3J81Z 2HTJA 3O2PE 3R1KA 5HLIA 4AVCA 3SZTA 1XGMA 1P0HA 3ECOA 4XBFA 3LAJA 3HSEA 4RB2C 4J3GA 3IWGA 1DDNA 4JXRA 4PGGA 3QP5A 4KA4A 2REEA 2GIVA 2NMTA 3WU0A 1STZA 1FP2A 2OQRA 3CUQC 3WE3A 2W85A 1T98A 1SD4A 1OPCA 4IHTA 3D2PA 2L3DA 1SMYF 1T2KA 4R87A 4LG0A 1B4AA 2R98A 2V1UA 2OZHA 4RI1A 3E6DA 4UA3A 3KCCA 4K2EA 2K4JA 2QLZA 4MHDA 3WTZA 4G6DA 2DPUA 1BO4A 4KVXA 4H0EA 4BHCA 3DPLC 3ZQ7A 1CM0A 4ZH4F 3BROA 1TW3A 4LB6B 3FWEA 2VE8A 4KYWA 2OZUA 3K2ZA 2UXNA 4KDPA 1S7AA 3I58A 4UHTA 6PAXA 1D8JA 1RXTA 4HA8A 3EDPA 1B9MA 4NHJA 2F2EA 5C82A 4LMYA 2PDOA 1LRZA 1BI3A 1ZN2A 2CW0F 4XPDB 2NNNA 2BBYA 2XAHA 4MI4A 1BOAA 1NSLA 2FF4A 3P2HA 4Y17A 4IRIA 1R00A 4I98B 4AVPA 3QPHA 4L9NA 5I0CA 4BHBA 1EV7A 5KK1A 2JDDA 1R7JA 4KOVA 1HW2A 1IN6A 4HDUA 1Y7RA 4NXYA 1XD7A 2X4HA 3TOAA 1ZGAA 1X3UA 1WQ2A 3T8TA 3I54A 3ABUA 2NYXA 2PR8A 3R0AA 2JRTA 5LHGA 2QECA 2OU2A 2ARHA 3RI4A 3I53A 3S6FA 4RB0A 3SQNA 3RKWA 1RUOA 3GYAA 2KIFA 3R9FA 2Z99A 3I59B 3F8MA 1BM9A 4HF1A 5HS9A 2J8NA 3TO9A 2A6EF 5LGTA 4HZFA 3VB2A 1R5GA 4RGRA 4XPKA 3R6SA 2RVCA 1ONVA 3TO7A 2GA1A 3MAJA 4M3SA 3WTXC 3FMSA 1ZYRF 2XHKA 4PK3A 5TRDA 2P0WA 3T9YA 4M6YA 1U5TB 2CWEA 3HUGA 3P9KA 4ETSA 2ESHA 2F5DA 3S6HA 4MEYF 3JSPA 1HKTA 2DTRA 1WWZA 1YK3A 1E17A 4PV6A 2Y0MA 1YGHA 1YW9A 4KIBA 1QPMA 4P9FA 2DU9A 2PBIA 4B5OA 3DEUA 1UFMA 1OR7A 5ICCA 1SFUA 3IRRA 4EGYA 3M8EA 2HDCA 5F46A 2EK5A 3B02A 4L0YB 3B8GA 5ERIA 3BOQA 1YLEA 1QBJA 3CJNA 3D2MA 4YGOA 4EJTA 2VBQA 3HRMA 2QMLA 4EM0B 3PQJA 1S7NA 2Z9OA 2JTVA 3DQVC 3HHGA 3TDZC 1F5TA 2PFBA 3RYPA 2XIGA 4I0AA 4U88A 5ICFA 1I1DA 1LVAA 1R1TA 4R79A 4H6UA 2R3SA 3ELKA 4BH9A 4KOUA 2KIUA 5ISVA 2FE7A 1PU9A 2I00A 2REFA 4YRHA 1A04A 3HTUA 4M71A 1CJWA 5HMNA 1J7KA 4JD6A 5HLHA 4XLNF 5IV0A 2QBYB 4L0ZB 4Q5SF 1QGPA 4XPDC 5H6QA 5EEHA 3W6JB 4IJAA 3JW4A 3V4GA 2OD5A 2VONA 2GE3A 1O57A 5IB0A 5AIPA 4IHSA 5AIQA 4NF1A 1LB2A 4KUMA 4P96A 1SAXA 3LQRA 4CAWA 3HRSA 3L9FA 3WODF 3U2RA 2WC2A 1U8RA 2M30A 4EJVA 2WV0A 2C6YA 1B1BA 5KVRA 3SXOA 2WWYA 4CO8A 1L3LA 3DSBA 4ORFA 2D4OA 4CGZA 4BXUA 2HQRA 3KZYA 1XB4A 2EV5A 4Q47A 2KIMA 1S5KA 4JBAA 5KTCA 5LRSA 3WTUC 3KP2A 1FOKA 4EQQA 1QNTA 4E8OA 1XDUA 1IXRC 3QB8A 1EH8A 4MTEA 1ZLKA 5JQ4A 2IVMA 4R9MA 3R4KA 1ZRDA 1U5TC 3S2WA 2A07F 2XAJA 4ZBGA 4OOIA 2B4DA 2XKOA 2O61A 1KYZA 5F6FA 5JPHA 2VC0A 4PCQA 1Q2CA 5LGNA 5ILVA 3R9GA 4RGUA 1XEBA 4OMZA 4OIOF 3RIRA 3SZPA 2F5CA 2G9WA 2P6FA 2VZZA 2ZW5A 5L3EA 2FEZA 1G6NA 2E7WA 1KQ9A 4P9UA 1XMAA 1L0CA 1R23A 4LD5A 4A0YA 2BV6A 3M9AA 3R9EA 5EEGA 2YX4A 3IRQA 3GY9A 2QQ9A 2G3AA 1Z91A 4OINF 2PJPA 1IXSB 1I1GA 4AWXB 5K5OA 2J5OA 1ZRFA 2XASA 4BNCA 5E8IA 1VHSA 3L2CA 3FNCA 1YQAA 4WK8F 3V8LA 3W6KB 2FRHA 2CNSA 3FXTA 3RJPA 4GYGA 5LHIA 3LQQA 5IT9K 4HX8A 4IRGA 4FX4A 1S7FA 3DF8A 1H0MA 4P5OA 4N9HA 1JHFA 5LBQA 1Z9CA 1W5TA 2P7CB 4L89A 1R5HA 2V79A 1H9GA 1W4MA 1XSXA 4IXAA 3I0TA 3GXOA 3J7AO 2JLMA 4RB3C 3F5BA 4I49A 3WGIA 1GXQA 2HEOA 3JAMK 4MQVA 3IWFA 2D1VA 5L3BA 2B4BA 5CNPA 1G4DA 4ENJA 3ULQB 4ON0A 2QWWA 3W6SA 2K4BA 4GXOA 3EC4A 1TBXA 2G3TA 3KLNA 4F6AA 3Q9SA 4YFJA 2ZXJA 4M9ZA 2QENA 2Q4YA 2VI7A 5J6XA 1V0CA 3F8CA 2ZW4A 2NS0A 2VN2A 2QBYA 1QZZA 4BMHA 2A61A 4MY3A 1FYKA 3FM3A 4RGSA 1M4DA 5E1WA 2XAQA 5J8CA 5D6FA 4RS8A 3DP7A 3BPVA 4Y15A 4NQWA 2ISZA 2PMHA 4MNUA 3MCZA 2G7UA 5CLSA 3ZMSA 2P4WA 3PZJA 5DV5A 2DFIA 1HXDA 2Q04A 3T8RA 4NB5A 3FMRA 4GO1A 2V1DA 2IPQX 1UHMA 4XPLA 1WKMA 3CXSA 2A69F 1ZHFA 2FBKA 1T38A 2Y48A 1MDMB 2HQNA 4U7DA 4L18B 1OYYA 3RKXA 1KZFA 2FNPA 4WXCA 1C0WA 2KJBA 2CO5A 1SD5A 1SD6A 4KFCA 5H84A 2VOOA 2G7HA 1R1VA 4H89A 2Q2EA 1G3SA 2VBYA 4EV0A 3HOSA 5FFZA 3FB3A 2GZWA 1TQPA 4LB5A 4XSZF 2OQGA 2LKPA 1YIOA 2LF8A
chains in the Genus database with same CATH superfamily
3FX6A 5K8NA 3E2IA 2NS7A 4UXNA 2XV4S 1IN4A 1F9NA 2PJBA 2XEFA 3BT9A 2AXLA 4G6QA 5L3FA 1XPXA 2XB0X 4CSWA 4ZYEA 2IS1A 2Y69H 2FIAA 3TC8A 1YR0A 5D8LB 1YTYA 1BIBA 4MJ8A 3P7NA 4AG7A 1OYWA 5F08A 4M6IA 4OVOA 4ZYGA 1YYVA 1ON2A 4D7NA 1DU0A 1RUNA 5FLXZ 5F47A 3JR9A 2PMUA 3K1PA 1XSVA 4JQFA 1M44A 4X5KA 5HXDA 1O3SA 2B0UC 2DFHA 5FKNA 5D5VB 2XGXA 2D5VA 1HSJA 4BY1J 3HOTA 1Z3YA 3B73A 2D1HA 2NS8A 3WTWC 3OXGA 1TW2A 2ADUA 3CPAA 1HDQA 3T0YA 5F04A 4G12A 2OA4A 1Z6RA 2MBFA 4KIFA 3RQ4A 1VNDA 3PNVA 2L7ZA 4GGGA 3H35A 4KLWA 4MXUA 3TOBA 4HF2A 4A5MA 2IJLA 4S04A 4MBUA 5GPAA 1ETQA 2EIMH 4ESBA 4MO7A 2YNEA 1XGSA 2CGPA 1NSAA 3Q0UA 4TV7A 3B3CA 4II3A 1NXUA 1FX7A 4HPSA 3ML6A 5FUWA 1YX3A 2Q0YA 1Z4RA 4J01A 1OMIA 4KSAA 4ZX8A 2Z33A 2CF4A 1N75A 4IRHA 1QQIA 4I0BA 5EGOB 2ZFWA 4A3EJ 3GTKJ 5BS6A 4NDLA 1ULMA 1U0JA 3OWCA 2L2OA 2ZJPF 4QC6A 2H94A 5JFRA 1EF4A 3WGHA 1LE8A 1PVEA 3MMYB 1VQ7I 3HSRA 3GLXA 1HLVA 4PJLA 2RV8A 2YSRA 3FVLA 2Z5UA 2Q0OA 3QP6A 1W7PD 2FXAA 2VJ5A 4XRSA 3IL2A 3PSFA 2DJIA 2PJRB 2VOPA 2A6HF 3JRFA 2XSDC 4OMYA 4R57A 3E97A 2NXNB 5F0CA 4XIDA 1SGEI 3KZWA 2N52A 4B47A 3NQOA 7CPAA 1T6SA 4Z2YA 4M3FA 1SFXA 4AD9A 3OYIA 2FIWA 3SJGA 2KMUA 1FAQA 3QOPA 2K86A 2M7BA 2SGFI 4P4FA 5ICGA 2H27A 2CYYA 3J80K 3G6EI 3L2QA 2IS4A 2BW3A 4AIDA 1KQ8A 3HM5A 3FXRA 4G8XA 2C6CA 1QSRA 3SDBA 3VATA 1TWGJ 2OC6A 3UFFA 2JYYA 4IK2A 1QHHD 4XKCA 2IJZA 4PDKA 1IUYA 5A27A 5KCMA 1UAAA 4A24A 3QPSA 4YIRX 2EIJH 2LBFA 4PJJA 5E20A 4R1HA 1IN7A 2DXIA 5EC4A 1K7TA 4QLCU 1U6GA 2YUUA 1I1DA 1LFWA 2DMNA 2NVUB 3OYAA 1MD0A 3Q0VA 4RMNA 1DPRA 1KYWA 3EUAA 1V4RA 1S6LA 1XDSA 4GYIA 4SGBI 1CF7B 1W0TA 4MFKA 4L5IA 2OV7A 1S20A 1OCZH 2YU3A 4XNFA 2IGNA 4BDZA 1SGYI 4MFJA 1VKCA 3E7LA 3Q5FA 4IF4A 4CYQA 3QAYA 1WPKA 3R0JA 1EH7A 3JRIA 1ZRCA 5LLQA 4OIWA 1K79A 3BJIA 3BR0A 1K7UA 5EEAA 4QUSA 4MQ9F 1BL0A 1E3HA 3AAFA 1MBFA 4DJAA 3O8HA 5BPDA 2E60A 3C2BA 4ZDOA 3PBBA 4BU2A 3H5NA 4DOZA 2JW6A 1ZARA 5F27A 1K78B 1GHCA 1CT2I 5F1RA 4DW6A 1PJUA 2O7OA 3GF2A 2JPBA 1FT9A 2ZOGA 3IU2A 5ILUA 1HCRA 4I09A 3CUQA 3Q9VA 4A3BJ 4MHYA 3C2HA 2E2IJ 1FYMA 4DGWB 1SQHA 2DIPA 4BEHA 2DA1A 3N7ZA 4IO9F 2YX7A 4N9IA 4O5VA 5DD4A 3H4QA 1RIOH 2X6WA 3DU6A 9WGAA 2YNCC 4IVNA 3DR6A 3KP4A 2P5KA 1HW5A 4YIIA 3RZDJ 2PJ5A 1RTQA 4ESFA 2JDCA 3F8FA 5D5UB 2FMYA 2X7BA 2DLLA 4B43A 2YNDA 2RQPA 3VODA 3RZOJ 1AOYA 1MK4A 3E5UA 3VE5A 2L8EA 3ZQFA 4CCOA 1Z4EA 2WGCA 4O3MA 4LOCA 3Q3SA 3TTHA 3TBIA 3ERMA 1U78A 5K5QA 3M7GA 2VBXA 2AS5F 1ERDA 1MDMA 2E34A 3U1KA 1HSTA 1R22A 2A5YB 4JP0A 1KQ0A 2ZXVA 3M4OJ 3MZYA 4LLLA 1OISA 3HOZJ 4ONUA 5K1YA 2PIZA 4G7ZF 4PXDA 1SAUA 3U9GA 4Y7NJ 2O28A 3DGVA 4LUAA 4FD4A 3PB7X 4DJLA 5FVJA 2J5PA 4WCGA 3DKYA 3GVAA 1TGSI 2VJIA 5FB2A 4NSQA 4HAMA 3GW2A 3GBGA 3L2RA 4F55A 4NNJA 2L9RA 3RPUA 3GTLJ 4IQJA 2PMZA 4EM1A 2XB5A 2HVQA 5EZGA 4L9MA 3L7WA 4GRIA 3BJ7A 1MJBA 1MBHA 2EPFA 5DD8A 2EA4A 5IY5H 4XSXF 2GAUA 2HTSA 4A69C 3MWMA 4EVIA 1B72B 2M87A 2LK2A 5GTHC 3C1DA 3PB6X 4MEXF 3VYUB 3DLLF 3EYIA 2Z3YA 4E7IA 4C3HJ 1O3QA 2W0TA 2JZMA 2IGOA 3HG9A 1E3PA 4FX0A 3S8PA 4KSIA 2L02A 3F8NA 3BJOA 3A01A 5L3CA 3HOYJ 4MY0A 3PO3J 2OD1A 1YHQI 3M8JA 3R96A 4LITA 3VOEA 2CSOA 4P4DA 4M3GA 2QVPA 3K2AA 1Q1VA 2V9KA 2R8VA 4WWVA 4HX7A 2BVLA 4ASNA 3HOVJ 1OYVI 4YFXF 1RKWA 2OB0A 3ZP5A 1PYVA 2QIRA 1FSEA 2ZEEA 3OL3A 1PYTB 4BBHA 2JK3A 3IHUA 1P4AA 3V7CA 3KEQA 3SEQA 1Z8XA 3GO5A 2EQRA 1UFHA 1QSOA 1LQ1A 4GFBA 1D5VA 1P4XA 2QQEA 4CCMA 2FT0A 5EMIA 3TKYA 2WPXA 4NJRA 3BTIA 4B14A 1O7FA 3GFLA 3QTLD 2DJNA 4HLYA 4EFDA 3FXQA 2CUZA 2L5QA 4MCPA 1TP4A 1S29A 2CQKA 1YQEA 2Z3NA 3OOPA 4UVAA 3FSYA 3PB4X 1CSOI 1R71A 1ZLJA 2VXDA 3LSIA 1Z3XA 1XC5A 4FKDA 3BJ8A 2AQFA 2EV6A 4FASD 4A3MJ 1VI0A 3BPXA 1D5YA 2WAFA 3K7AJ 5TJJA 3S93A 1T0FA 4F91B 5E1ZB 4UFWA 2KL4A 3K1NA 1GHEA 5HLTA 1B9NA 3IAS2 5J40A 3VPRA 1UG2A 4KN7X 4GM5A 5M3MJ 4PZJA 3AKZA 1ZREA 1TTYA 2PCUA 3DDDA 1VQOI 1X4PA 4CHUA 3B4VC 2GFQA 2ETHA 4GCVA 2VQYA 2VZYA 3D7DA 5DWNA 5LRJA 3UR3C 4UNOA 4B6DA 5EGOA 2M5WA 4KOSA 3LSHA 1MSEC 4FTHA 3MVPA 3ERED 1S9HA 2VJJA 2WADA 3DFGA 1NUBA 3G8WA 3H9QA 1MJ9A 3WTVC 3TJQA 4F8ZA 4WF2A 1X1DA 3FF3A 4OC0A 3KFWX 3CLQA 2EBIA 2IP2A 3ZMDA 4LK0F 4QWQA 5E3LA 5BOXA 2PJRA 4XMYA 2W25A 4KNYA 4V19K 2QVOA 4FE7A 1P9QC 2EFQA 4WXHA 1FIPA 1I3AA 1USSA 2MH2A 2Z10A 4PK2A 4R8FA 2W84A 2WV1A 3PQKA 4ZZLA 1S7OA 2PJ3A 4C2ZA 3WTSC 3OSFA 1VQ9I 3O6BB 2XRCA 3DXJF 4M9SA 2HUZA 3S1RJ 4KOXA 1X4OA 3LSPA 1XRYA 3BR1A 3HGGA 1R36A 3WGGA 4NEXA 2XGEA 2A3SA 2CG4A 3A03A 4EJOA 3H3VK 4BKXA 2IRFG 2VXKA 2P6SA 1X1CA 1J2XA 1G3WA 4G7OF 2ABZA 3M1EA 3VWEA 3ABKH 5HOOA 1JKOC 3A0BC 1HQCA 3G1MA 2CWFA 4JOMA 3L00A 5JI6A 2VODA 3DBHB 4FQGA 3ZMVA 3PIPF 1Z1DA 2GKRI 4NGRA 2DQLA 5GAEJ 2EJRA 3N4MA 1YX0A 3QWPA 2JQ7A 3G4SI 3GZ6A 4KLVA 2LKXA 2GXGA 3HRUA 3LSMA 3ZQIA 2DCEA 4IOAF 2MGQA 4HNUA 3OIOA 3H36A 3E3VA 1W5SA 3KYCB 4A3LJ 2N71A 4AYBA 4K30A 4Q36A 4XL9A 3O3KA 4G9YA 3DKWA 2W82A 4XRMA 3BZ6A 4C2UA 4LLNA 2WUUA 1Y1CA 2W24A 3I56I 3LACA 4CS0B 5HI7A 2ELJA 4P4JA 1FOYA 2CW8A 5EZHA 2DFFA 3H5AA 2DMUA 3GEZA 2R7ZJ 1RETA 3CXPA 2JSPA 1LDDA 2XAGA 3BR2A 2O9LA 2Q7BA 3QAHA 3S3OA 2NVQJ 3HPGA 1LEBA 4R7MA 2O6GE 2JBKA 3L2VA 4E0AA 2I3CA 4JXQA 1XMKA 1YLFA 2RKHA 3RKYA 2F4OB 1AU7A 1PUFB 5K7ZA 1IUFA 1E2XA 1K78A 4F9UA 3DEEA 2EILH 2C27A 5HLGA 1JJ6C 3CCEI 4M6HA 1V3FA 2DPTA 1BAVA 3HTSB 3KI9A 1JHHA 3EPZA 4AMLA 3IC7A 4UIAA 3RYRA 1VDDA 2PJ4A 2CRGA 1SVOA 4JK1X 5D4RA 4CAVA 1TQMA 2E1MC 1K7VA 2CY2A 3D68A 3NAUA 2DODA 5JLWA 3TGNA 4HRIA 1OVOA 1P92A 3BLYA 4FE4A 2AO9A 1DQUA 1FC3A 5CJ9A 1J9IA 1S60A 5CPRB 2R7WA 4QB9A 3D3SA 4P44A 5BMZA 1Y0YA 3E6CC 2J87A 4XR6A 2ESNA 3FMQA 3I3GA 4ZDLA 3S9MA 2CWGA 4BQAA 2L7FP 5DEQA 1Z7KB 2E1OA 2FMLA 1EE3P 2M4KA 4OADA 3SJXA 1FP1D 4OIQF 3FIXA 3OS0A 1TWCJ 2K9LA 2IS2A 5F49A 1KUYA 3EXNA 4HNVA 2LNBA 3FKJA 1IOFA 4B5PB 1XIXA 3MEXA 3S9NA 4CPAA 4PSXA 4Y13A 2BXYA 4QPQA 2CV2A 1ZG5A 1QSTA 2ZEHA 3JVNA 3FXMA 4YEJA 2LTPA 4HV5A 2GU2A 3B3WA 2PEXA 1HF0A 3JREA 4U0YA 3TE4A 3CD6I 3ZCOA 1J59A 3HYIA 1M4LA 3W2AA 2CV0A 2F6CA 2EFWA 2E1NA 3FBUA 1ARMA 3OYCA 2Q4VA 3FRMA 1ELLP 2BUEA 2LLKA 2VASA 4A3FJ 1AWCA 2EFPA 2XSJC 2GKVA 5KAIC 2PQ8A 4ENKA 5FKMA 3J81K 5CCMA 1R57A 3MD2A 4AB7A 4JYWA 3RKQA 3LSTA 3F8KA 5B3SH 2ACJA 1B72A 2OAZA 3HOUJ 1Y0UA 4MFDA 5AONA 5A2QZ 1ZGJA 3H3UA 2XC7A 1S72I 1CT0I 4RLFA 5DUIA 1TOTA 2ZEOA 3IFEA 3I59A 1HA8A 4RS2A 5E3PA 4KMFA 3UY5A 4CA0A 3VDPA 3M07A 1SGRI 1WFXA 2V8HA 5E18F 4XQFA 4HF0A 2FL4A 4R76A 1BR4A 2VQLA 1RR7A 2EZIA 2F5EA 4BL0B 3HOXJ 4GXHA 2PN6A 4O6JA 1HEEA 3T5XA 1GLNA 3I9V2 2CNTA 4JWPA 5J1YA 3GZNB 4AIKA 4R3KA 1P4WA 5D8KB 5BQTA 1QPIA 2O3FA 1IY7A 4BS9A 1SGQI 1Z9UA 3PGPA 4EJUA 4CAXA 4CGPA 2V6CA 3LA3A 3E0JB 4RAGA 4RAYA 4A0XA 1IAWA 2CFOA 1U5TA 2CTBA 4UXHA 3B6CA 3Q0WA 5LD2C 2EFNA 1P9GA 1YJWI 2PSWA 3WT4A 1XFOA 3M1CA 3W6VA 1ULYA 2Q8KA 3R5DA 1ETXA 1REPC 1O4XA 2PI0A 4CICA 2J8RA 1YVKA 3S1NJ 1CGJI 3E0KA 1F43A 1UHSA 1WHUA 2FCKA 1OFCX 1D0XA 3KP5A 3GTPJ 3FJUA 1YIJI 2B5GB 4IKFA 3EETA 5IT3A 5FGMA 4E7LA 4ZX9A 2BSWA 3JUWA 3I3LA 4EMSA 4KOTA 5H2FC 4A30A 4U7BA 3M3YJ 4KT5C 2LG4A 4YIFA 2KLOA 4EJWA 5D5XB 1QZYA 1XOVA 3RDIA 4AC0A 5L3DA 4IHYA 1P4NA 3HIFA 1FBSA 1FARA 4F52A 2CU7A 1QSNA 2X0LA 1CPXA 1P6RA 5FO5A 1ZG3A 4A3JJ 2DW4A 2RDPA 4W9YA 2F7VA 4OC3A 1VHEA 2DYSH 1O3RA 1Z7LA 3JTKA 1USTA 3RPUD 4E6KG 1NG6A 4BXFA 5HH1A 1FBQA 4GS4A 4P10A 1I6XA 3WU1B 2VBZA 4XK4A 1ZLIA 3OY9A 2ANPA 4RM2A 1YS6A 1Z7UA 2ZEPA 4Q48A 3UNGC 1ZH5A 3F8BA 4BBSJ 3G3SA 1Z05A 2QKMB 4M72A 2CJJA 2UZKA 2M45A 2OH1A 1J75A 3I5UA 2X6YA 4KOWA 4PFPA 4OIDA 3LSRA 4CYPA 2Z2SB 2FUG2 3NH4A 1BMOA 3FKIJ 3PUBA 4DUKA 1XX5A 4A2UA 1TIHA 2KQRA 3TCVA 5E1XA 3OYDA 4L8AA 5KTAA 4HGUA 1R1UA 3GMEA 4CH7A 1F1ZA 4WXDA 4UUVA 2Y0SA 3I4PA 1WJFA 2SGEI 2VKEA 3KE2A 1FYBA 3H5ZA 2V77A 1F4KA 2DF5A 2Z1DA 3MN8A 1B6AA 1GT0C 1P2FA 4IHWA 1BPNA 2ZW7A 4A3KJ 1YRNA 1YE9A 3O8GA 2DT7B 1SGPI 4M73A 2F4MB 1JKRC 1PDNC 2GVIA 1BBYA 1LUJB 2KMRA 2BXZA 4A0ZA 2DOEA 3EUHC 2NRAC 5AG4A 1I1SA 3ZMUA 5THWA 3WR7A 4U87A 4XONA 5B1AH 1RNLA 2OJED 1TIQA 1BOBA 3BP8A 2ZJRF 4HDVA 1V1HA 2O03A 2NNYA 3E6MA 3ZPLA 3BG7A 4EM2A 3KP6A 4FETA 3IKTA 1M8CA 3ASNH 1WGTA 1YREA 2KJCA 2K02A 4GI3C 1Z8TA 3IKVA 1KU3A 3ECHA 1SMTA 4H4KC 1JE8A 1FOXA 3D5SC 3JRAA 2K5TA 5EF6A 1XX6A 1NK3P 4ABZA 3FIWA 1WWXA 3QOEA 2ZEGA 2RN7A 3IP4B 1GVDA 2R0QC 1VQLI 3W3CA 3KLOA 3JSOA 3EUKL 2ELHA 2HKXA 3A4CA 4E7JA 1ACIA 5DCFA 4JLYA 1APLC 2VQHA 1ORKA 4KICA 5J1RA 3SEKC 1KU2A 2WAQA 1Y9KA 1K4SA 1MMNA 5IOZA 2EBJA 1ETOA 1H0ZA 3AG4H 1EA3A 2XAFA 2JXDA 3C18A 1K61A 5IX3A 4Z65A 2R7HA 2P6TA 1WJCA 2JA1A 3PNTA 5DCMB 4F7ZA 4BQQA 4AVBA 2KCXA 2XEGA 3UEYA 2WYRA 3BCAA 1JGSA 3FM5A 3DLJA 1NTCA 2ZXIA 1MNMC 4UVCA 2ARPF 2BYVE 4R3LA 4RGXA 4G94A 2STWA 3TL4X 1AA7A 1HBXG 2P6EA 1BIAA 3ZN0A 4NGSA 5EBVA 3GFJA 3CUOA 1XG1A 3GYHX 1I27A 4ITVA 2VIXA 1DU6A 5FD6A 1DS3I 3KQZA 4BINA 1OKRA 2PIYA 4B5PA 2E71A 4FD5A 2MW8A 4MFQA 5JVTA 4M85A 3V38A 1LCPA 2ZMEB 2XEIA 1X12A 2UVOA 2E2HJ 4HBLA 2L4AA 2BL1A 1WI9A 2ZNZA 3BJAA 3S32A 2IS6A 4PJNA 1HKSA 2N17A 3TT2A 1TWAJ 1KUVA 4MGRA 2Q7SA 4YRVA 3F3XA 5TGTA 3COAC 2K9SA 2QZ8A 5E17F 3DPUA 3D7GA 4XLCA 3K4LA 3CC7I 2QF7A 2L01A 3FX3A 3MZHA 1ULKA 1G3YA 4RAZA 2EVNA 1N71A 4AUXA 1YO5C 3PB9X 3PBEA 4OP4A 2HQAA 3BCBA 3CO7C 4HNYB 2P5LC 2X1CA 3LSKA 1A6QA 1J0RA 4CGOA 4NGMA 2R5YA 2LP0A 2WAEA 3FISA 3C7JA 2GBYA 1U9OA 1S3ZA 1NHAA 2XRNA 1UHAA 1HOMA 3JTHA 5L3GA 1TBQR 3R5BA 2EWNA 1B8IA 2BY1A 3FF5A 3GTMJ 4IL6C 2NVTJ 5CVJA 3S2HJ 3PDNA 5JHUA 4RB1A 2ZXWH 1IF1A 3IEHA 4IHMA 3IH4A 4KUAA 1M4GA 1D1CA 2RAEA 3V8JA 2DQRA 3ONQA 2GLFA 3OIPA 3U21A 4W1UA 5LRRA 1WVRA 2IT0A 4P6YA 4IQ4A 4CYOA 1FSHA 5H20A 4L5EA 3F6VA 2M3AA 2M1BA 4M3BA 4QIWN 3S3MA 2ORVA 1XS9A 3HKZA 1VGYA 3CDLA 3QNVA 3TQNA 2X6XA 3H9GA 5HVQC 5DM7F 3RTRA 3RAMA 1I12A 4EGZA 3GZ5A 5GADJ 1GVJA 5HDGA 4A6EA 2QKLB 2WSAA 1ZK8A 2V8VA 1R5ID 2FQ3A 4E7SA 1IY6A 1I39A 3PO2J 2ODFA 3HUGB 5LEJA 1OMUA 3FMCA 4II9A 4YFNF 1U3EM 4NGNA 3CPXA 5LRKA 2BUSA 3EO4A 3GWZA 1ZG7A 4B12A 2GXAA 2C6GA 4HV6A 4RBOA 2DOFA 2MABA 3BDDA 4PJ0C 5KTDA 1Q2DA 1X2MA 2B5GA 4YWYA 1QO0D 3WHBA 4LK1F 1TL8A 1LFPA 2FS5A 4OU0A 1YJ9I 2JSCA 4RUHA 2A5WA 1AYEA 3DPTA 5CVVA 3F6OA 2KKOA 1VQNI 1MJAA 1SANA 4E1RA 3KPHA 3IU1A 1B59A 2WB1A 1D8KA 3BG5A 2FNFX 2QYVA 4HX4A 1KU9A 1X1PA 3C3WA 4OIRF 2E35A 2XPUA 4HNXB 3HHHA 6CPAA 4UXJA 1XCBA 2XGDA 2DXQA 4PXCA 2KMQA 1UMQA 2QQBA 5GP9A 2LDUA 2DN0A 1WH5A 3D5RC 2Z3PA 3D5LA 2A68F 2Y9YA 3VSLA 1HPTA 1IN8A 2R92J 1YU6C 1BLLE 3H8EA 4M3DA 1NE9A 1S7LA 4A12A 5EX3A 3JTGA 4DYOA 1OCTC 2B0LA 2BEOA 2LUYA 3CT9A 1AUGA 4IPAA 4ENMA 3G2BA 2STTA 2YUSA 5ED4A 2BGCA 3GIUA 4HKFA 1MW7A 4XKBA 1YJNI 3BC8A 4CYDA 2FE3A 1FEXA 5CVUA 1VQ5I 3PP9A 3IWZA 2HYFA 3CZXA 2BY0A 2HNHA 2MD5A 2WY7Q 3EYYA 3WE2A 3IV5A 1S3JA 4MCSA 4G1PA 2W48A 1MKMA 1MNEA 3IO1A 1YW4A 5EDNA 3KP7A 5CBMA 3DNSA 1WH7A 5E3OA 2NVYJ 3I9SA 1AN1I 4X2TA 1BC8C 4BYYA 2A4NA 3KL9A 1FIAA 3I1UA 1O3TA 4FUUA 1FT7A 2LF7A 2V8GA 1UB9A 4AG9A 4FAIA 4AIHA 4A5NA 3R61A 2Y30A 1SD7A 2DTZA 2FBHA 4HYEA 1FLIA 1TNSA 5DAEA 2BOLA 1R49A 1R0RI 2CIJA 1BI2A 1MIJA 4L9VA 2ZJ2A 1Z8LA 4U0WA 4ONWA 3OS2A 4FWUA 4ESJA 3OYMA 2NU3I 4MFLA 3SJFA 1LJ9A 3FH4A 3GFMA 3NE8A 3A0HC 1WJEA 1XGNA 3H1CA 1V1IA 1OZPA 2W7NA 1B6BA 1PJRA 2LR8A 2VKVA 1ZTRA 5IT9Z 3FXKA 4BJTA 3P9IA 3EY5A 3T8WA 3HRTA 2E19A 4I01A 4XLHA 1TBNA 2Z3MA 4C7HA 3B2YA 3OL0A 1TNTA 5K8MA 2XKPA 2CQNA 2K9MA 3TFYA 1SVMA 2ECCA 1H8AC 2ZMEC 1IGNA 3NA6A 3P2FA 2KRCA 5F0HA 1IIDA 3H8FA 3K0LA 2K9NA 1D3YA 1MSFC 4MFPA 4IHXA 1MBEA 2JMWA 2L4MA 4QSHA 3BLNA 2K9QA 4KUBA 5DWMA 1IN5A 3DBLB 3JAMZ 1GDTA 4XLAA 4A2ZA 1IGBA 4B09A 1I21A 2XUBA 1JTYA 3BG3A 2UXXA 5A2QK 3W2WA 4A3IJ 1PTQA 4A6DA 3ISPA 1V5EA 5DUKA 3SHPA 4N4NB 1OYIA 3F9KA 4KN4X 5FD5A 1WRJA 4KIGA 2GLOA 1U6MA 2QUFA 3BG6A 1SC7A 1VHOA 1CPSA 5HS7A 3DEWA 5DCMA 2X1EA 3TDUC 3LSGA 1BA5A 4UEFA 2FNAA 2ZELA 1J09A 3G1LA 5DM6F 1WSUA 4I76A 1UZCA 3DCFA 1DPUA 2CNMA 4M6XA 1DGWY 2PR1A 1NK2P 2AE6A 1MNDA 5HVGA 4U0VA 1JUSA 3R60A 2PJ1A 5DTDA 1QZEA 1Z21A 1YW7A 5FROA 2V8DA 4I7HA 4P55A 3LMSA 2ZMEA 5LYLA 3W6XA 1D0YA 3ZN1A 3FYNA 2Z3LA 3A2KA 1UHWA 3MGDA 4LFUA 2YNCA 2AFUA 3OR2C 3HH2C 4B4CA 4XOPA 4LLGF 5LFAA 2BCOA 2GOMA 2JEVA 5ICEA 4FD6A 1W7PB 1EJ9A 1DGRM 2PG4A 4RA2A 2DOAA 1FJLA 1LKXA 2KT0A 1DE4C 2MLKA 3QU3A 2AXTC 2HOAA 1ETWA 2B4DB 3S6GA 4FD7A 1TBOA 3GUDA 2R7QA 1VTNC 4XNHB 4C68A 4B8XA 2W57A 2HV2A 4A39A 4C2XA 3CXQA 3OSGA 4GDFA 2VC1A 4C2TA 4LX9A 3V42A 4WP4A 3DR8A 2RC4A 1IICA 2IL4A 1HW1A 2X51A 3F21A 1YVOA 2P8TA 2B7EA 4ZYDA 3A1YA 1LDJA 1T33A 2DDAA 2E7XA 2L9NA 4BAYA 3ABTA 1FOWA 1OR7C 1OCCH 4PK4A 1Y0RA 4A95A 2JZYA 1PP7U 4AIJA 4CRYB 2UUZA 4F93B 5HNHA 2K27A 4C30A 1RR8C 2PC1A 4OIPF 3V7RA 2GXBA 4MCQA 1CGPA 2KISA 2QQ8A 2OTJI 3IGRA 4E70A 1BW6A 2XAUA 2K3FA 3CMAI 2LH9A 1FYLA 2OPTA 2P6GA 3ZMTA 4S05A 3OXFA 3LFKA 2VBWA 3CO6C 3BTLA 3OVOA 2JPCA 5J3LA 4DNCA 2H8RA 2X85A 3G3ZA 3CXLA 2OZGA 2E5NA 3FXOA 5AG6A 1W5CC 4DQ2A 1MZBA 2B3UA 1ZAOA 4UV9A 1MH3A 2B3VA 5HVFA 1IZ1A 2M2EA 2A20A 1QA6A 1ZKGA 4BQOA 1BI0A 4UV8A 3D4UA 1Q2YA 1QQ9A 2C1CA 2HR3A 1IY5A 4W97A 1UCRA 2KZGA 3LWUA 5FKOA 4UXIA 1MBKA 1W0UA 2GLJA 4MHPA 4U9YA 5F48A 4DYRA 4N0BA 2BE5F 2LKSA 2H09A 3SZGA 5DS9A 1TF8A 2EFOA 4OLLA 2ODDA 2JBJA 2OOTA 2D2WA 2N1AB 2HZTA 2R7DA 1TXRA 3UKGA 3LA2A 3FXLA 4L9JA 4ZDPA 1H9TA 2YU9J 3QRFF 1JQGA 3DKXA 1PUAA 2R7TA 2DMTA 2WCYA 2IA2A 1BN5A 1FPQA 1JXSA 1DP7P 4XM3A 1QVUA 4KORA 1IU8A 3S14J 2PJ8A 3WABA 1KGSA 3HEFA 1S7EA 3NH8A 4PPZA 5G22A 4MHGA 1KA8A 3CCMI 3KIOA 4HW0A 1XCVA 2V9VA 1IV8A 4F0XA 1XMXA 2ZCWA 2Y2ZA 2VI6A 3FBNB 4RM3A 1ZR4A 3FXUA 3LL7A 2LYCA 2VPRA 4A3CJ 1MMSA 4IUSA 1VQMI 5HS8A 4U5YA 3KKWA 4WX9A 4H2KA 2L7KA 3BI0A 3OV8A 3LAPA 4NGPA 1KU7A 1LR8A 5BNGA 2WPWA 3H92A 2BZTA 5AG7A 2M0CA 1R9TJ 2KRHA 2PLYA 4HLXA 3KQXA 3I4MJ 1R58A 3K70C 4CAEA 3FXJA 3S15J 3K9UA 1CF7A 3S6KA 4F0YA 2XROA 2F5FA 2ME0A 3KEYA 1MMDA 2ZSIB 1KONA 4M74A 4QPOA 5IYBJ 1LPQA 1ITYA 5D6EA 1UVFA 1XF8A 2AFMA 1OCRH 3GX4X 5LYDA 1SGDI 3WTYC 1FY7A 3HBLA 1K7AA 2LSOA 1WK4A 2NYQA 5I4MA 5DYMA 3F22A 2FBIA 3P9CA 2X3TA 2R7XA 3ZQGA 3SEZA 3SXYA 1N25A 1S7KA 2VUMJ 4HNWB 4D1QA 4UBRA 1I5ZA 1CP6A 2R1IA 5JLXA 4UWIA 3MQ0A 2HKOA 4WJBA 4IHVA 2RREA 2O0YA 4J00A 3D8PA 1N78A 2ZW6A 2XGCA 2OZ6A 3GCMA 4AM3A 2VL1A 3KP3A 4JX6A 3K9TA 2EUIA 2F3CI 1D0ZA 5H86A 5DS0A 1POGA 4JZ0A 2VT2A 3S3NA 3QYFA 4UFXA 2DT5A 2AHQA 4B13A 1Z67A 2HS5A 4XORA 5E8GA 1CHOI 4B11A 3VWDA 1HJAI 4CRZB 1Q7LA 3J80Z 1CT4I 2RNJA 5E3RA 3CJTB 3BY6A 3LA7A 5FLXK 2DMQA 1KBEA 3NWTA 1N13A 2LMDA 3JRHA 1TQIA 2DYRH 2ISYA 3RBUA 3PFIA 3K10A 3SFIA 5J1UA 2MLGA 4XNHC 4KT6A 3K69A 1XE4A 4TNUA 5FJ8J 3IC1A 1TKJA 2E1CA 4KS9A 4XKVA 4ZI6A 1PUEE 3RPQA 2FSWA 3QPTA 4YFKF 1HDUA 5FRNA 2IA1A 4HQEA 2QYOA 3N05A 4A3GJ 4AVAA 4EWTA 2AFZA 4TWEA 3M8FA 1R6RA 4L9TA 3REOA 4MCRA 1LNWA 5G1ZA 1XN7A 4EVYA 4HSRA 5E79C 4G6TB 3DTKA 3OS1A 3B7IA 4FISA 3C26A 2FXFA 5GPCA 2R7FA 4BJ6C 3PFEA 4KMUX 4LQGA 1RFHA 2D4PA 1OLTA 1FTTA 1FMWA 3NE7A 2N8GA 3KEOA 4YG2F 2VE9A 2GANA 3V8IA 4IF5A 5CPAA 5J4VA 1ON1A 1NMTA 1YW6A 3DTIA 2Y0SN 1OJLA 1IRFA 1PP8F 1YG2A 3GOXA 1Z5RA 1V5FA 2A6TA 3OWTA 1Y39A 2FOWA 3PNYA 2Q1ZB 3PB8X 1F57A 2DKVA 4OC2A 2LB7A 1WJ5A 5FKLA 1CG2A 4CXFA 4HQMA 2EK9A 5JHWC 3S9LA 3HB9A 1W7PA 5D4SA 1GXPA 3GTGJ 2WTEA 1O7LA 2QSGX 2FA5A 2HDDA 4I02A 3W2VA 3SXNA 3CC4I 3BR5A 2H5MA 3MFKA 2NOGA 5IYDJ 2KP6A 2UZ3A 2ZNYA 1T39A 2QSHX 1BPMA 5D8NA 2BEIA 1IDZA 1S8NA 2HXOA 2EV0A 3LWFA 2MA3A 2Q44A 2JUCA 1H8LA 3D7HA 4NFRA 3MKZA 1JT6A 2WBMA 5F1JA 1B87A 1GV5A 1Q1HA 5CVRA 1IYKA 2EA2A 3F0AA 3TX8A 1SFKA 2L7MP 3UGIA 3T1BA 2V1XA 3B3SA 2X52A 3AG3H 4LG3A 2FD5A 2YPRA 5CVIA 5FFXA 1F36A 1X3ZB 1P9ZA 2OBPA 3V8KA 3GTOJ 2NU2I 4UY8I 2F5VA 1YLOA 4IEJA 4PFOA 3EQLF 5JH9A 1RC9A 3I64A 2EZLA 2HQYA 1LOKA 3MKYB 4XOTA 2Q51A 2ZPAA 2DBBA 4HEA2 1GYTA 2Z0ZA 2I79A 4X1EA 5J8FA 2KPMA 4KOYA 4AXVA 4UUSB 2Q4ZA 2CUFA 2QQAA 2VT3A 2CH0A 4E7ZA 1M4IA 3VYRB 2TDXA 2KCWA 4A38A 3CQZJ 4XKWA 1RO5A 1QRYA 4S0HB 2D45A 4BXXJ 1J4JA 2ATRA 2PJ0A 2IA0A 4OAEA 3QODA 4PQAA 3D0SA 2ZBKA 4Z6YA 2HOEA 4KVOE 5GAGJ 1ZGWA 3ROUA 1P7IA 5E96A 4Y49B 4XLPF 2ZKZA 1XTAA 1A31A 2R7UA 2AFXA 4IAVA 3DU5A 3BXMA 3FZVA 1F2PA 1BUSA 4OWRB 1XSDA 2XVCA 2PJ6A 2MYSA 1ZR2A 4I6ZA 1Y7EA 3KY9A 4CGMA 1G8XA 2KRFA 4WWCA 4X0GA 2ZJQF 3CCUI 4XRSG 2VEZA 2VXZA 3G71I 3VSKA 2IW5A 5K5RA 2ELIA 2AFSA 4P4IA 4C7IA 2HWVA 4ZZDA 2Z11A 1TLHB 2JRMA 4CZZA 1HDLA 3NEUA 2M0MA 1ETYA 2HYGD 2VLAA 2ERWA 2Y75A 4Q7AA 4UWJA 4ZGYB 2EWBA 3SHFA 5JHFA 2MSYA 3IWWA 2IBDA 4UVBA 2OUMA 4KSFA 3OYBA 2O5RA 4MFZA 4D7MA 4P4EA 3G73A 1YW8A 3RYOA 2KMPA 3CTAA 3UGDA 2FJ1A 3BI1A 1XMTA 5LYFA 2R7OA 5DDGA 1M1DA 4CAFA 5C88A 4QVTA 1QHGA 2VQCA 2QJ8A 4ZY2A 3RO0A 5D5WB 1DP3A 2OF7A 4UCNA 1DUXC 5GCNA 4BACA 2NAZA 3L09A 4HG2A 1VQKI 3IAM2 4I2OA 5CYVA 4IZZA 1BC7C 4H6ZA 3PJRA 1MMAA 2LBFB 3CLOA 1W4RA 1ODDA 1SFEA 4FHTA 2M9HA 4A37A 3K4BA 3VARA 5EYRA 1IRGA 2HB6A 2MC3A 4JJXA 1R3NA 4PGHA 4LG0B 2ENZA 2AFWA 3PL8A 5C44J 3KHXA 3T90A 3N97A 3CDXA 3VDXA 3RNZA 4U9ZA 3CMMA 4FT8A 2CJSC 5H6RA 2ZEDA 2DI3A 1ZLHA 3HSFA 5K7HA 1IW7F 2VKDA 5GTIC 5M5XJ 2FSRA 4A33A 2BY2A 2QSFX 2ID6A 1JWQA 2PJAA 3SGBI 3GKRA 3JRBA 1HKQA 4UUTA 3A02A 2FOKA 2M8EA 1W36C 2C6PA 4BE1A 1PUFA 2J8MA 3OYJA 2GKTI 2P5VA 5ILSA 1TURA 3BJ6A 3FSXA 4R8HA 1J5YA 1IRXA 4MHNA 4CCJA 1Z77A 2V6EA 5F64A 1XJOA 4MTDA 1MT1A 2AFOA 2JT1A 1Z6TA 4RAFA 1BW5A 4PUSA 1FNNA 4IX7A 1LR9A 1NG7A 5BPIA 3BQZA 2GWRA 1VFCA 1D1AA 3CUQB 1LEAA 4O23A 2SGDI 2TRTA 1DS2I 2L9VA 2B58A 1K83J 3GLLA 2MC4A 5JR3A 3CCRI 2AJ6A 3DV8A 1ON0A 3LNQA 3BTJA 1WJAA 2DAOA 1XGOA 2M8GX 2DPDA 2E2JJ 2J9RA 3EUHA 4Y52J 2CS3A 1TWFJ 2DK8A 4L5JA 5LEKA 2HVSA 1YX5A 2ECBA 1JKPC 3ZZIA 1U2WA 3TO6A 2VQGA 3CDHA 4D0PA 5BWAB 3E5XA 3BR6A 2PJ2A 2GA2A 1LFBA 2QCOA 3H0GJ 2I8DA 4IOCF 1JUMA 3VFZA 2DO7A 3PUFA 4PSWA 5IOYA 1K6OA 2GM4A 1L0OC 2XF5A 3B3VA 3TW6A 1FBUA 3KZIC 1CE3A 4X8IA 2JA6J 3HL2A 1IXCA 3CMYA 4E2AA 3K1MA 2EB7A 3ZJ0A 2V26A 2IXSA 4XRFA 5LHHA 3CZ6A 3OYFA 2CMPA 4A93J 3R95A 3F72A 2G0BA 1T08B 2JA5J 2QM3A 5HDNA 3E6BA 1TZLA 1RI7A 4NUBA 3S17J 4BBRJ 3FDYA 3SI0A 2HGCA 1X74A 4ZYHA 3ZMZA 2MH9A 2O8XA 3E1SA 1IYLA 4M9XA 3SJEA 3I71A 5HDKA 1IB1E 4Y3OA 2RB7A 4MHZA 3W91A 4ZYQA 2JUGA 3D00A 2RNGA 4LJZF 5ELYA 4KZTA 1MGTA 2K85A 1LDKB 3K2KA 4OAYA 4BE0A 1K4JA 1LR7A 2COMA 3V7SA 3ZXSA 4CDGA 3D1NI 4LGWA 2K7LA 3H3ZA 1E3OC 2L54A 1TKFA 2WVJA 5HNFA 2PRQA 3U1DA 2KIQA 4ENNA 4ZJZA 3SGQI 4Y49C 1RPWA 1HDPA 2DK5A 1T95A 1P7JA 2RIJA 1QU3A 2BOAA 1G3TA 2BHZA 3L1PA 1WGCA 1BI1A 4C3IJ 2F5IA 3WG9A 3A01B 3WTTC 3FEEA 1U8BA 5LGUA 2QGUA 3E5QA 3NWSA 2H6BA 4Q4ZF 2P7VB 3F23A 2YR2A 2V9PA 2P6AC 4KVME 4C2YA 1YFHA 3CCVI 2DDBA 4HOBA 4LIUA 3LD2A 1Y9WA 1RZ4A 3HPHA 4RDUA 3EFAA 3RU0A 1KUXA 2ZEMA 1IW4A 3P5JA 2M5XA 2H6CA 1EKEA 1KMAA 5C4XJ 2FU4A 3NFZA 2ORWA 3QYEA 1VQ6I 1E0EA 2RGVA 4C9YA 4UUSA 3K70D 4II2A 3BWGA 3L2WA 1ZG1A 2CFXA 4NC8A 4QBJA 3QU6A 3GFIA 3NRVA 5JVGF 1T8IA 3KETA 4AVZA 2UWMA 3SFZA 2ENNA 1Y8RB 2CTCA 1YS7A 3KYLA 5FUYA 3UEJA 2L9SA 3AFHA 4G7HF 1A35A 3LODA 4CYNA 3VEPA 2F48A 2IGKA 2WY8Q 4BHPA 4NCZA 1V54H 3FHNA 4ZC3A 1FZPB 2BO9A 4F9VA 2HFHA 3KZZA 1EH6A 1FWZA 2W4SA 2WZNA 5HVHA 1BJAA 2GQQA 2ZO4A 3KGQA 1UVGA 1QSMA 2KDZA 2CV1A 3TP3A 3FHZA 2PRBA 3J81Z 2PVVA 2HTJA 2PMZN 3O2PE 5JGFA 3CCYA 3R1KA 5HLIA 1UELB 3WU2C 3OOUA 1Y0NA 4I99C 2B9SA 4AVCA 3SZTA 3MKWB 1XGMA 2K9HA 1CBXA 1P0HA 3ECOA 1GUUA 4XBFA 3LAJA 3HSEA 3VWBA 3V7ZA 4RB2C 5D29A 2PVWA 2FQ4A 2BVMA 4J3GA 3IWGA 1DDNA 1D1BA 2E5ZA 4JXRA 3SYTA 2NSMA 2LY9A 4PGGA 1A5JA 3QP5A 1DTDA 4KA4A 1Y6IA 2HYJA 3CJRB 2REEA 2YGWA 3LMMA 2GIVA 2NMTA 2X1DA 3FK7A 2COBA 5K8PA 3CDIA 3WU0A 2B63J 1STZA 3BG9A 3RSNA 1X4SA 5E3NA 1A2ZA 4M3EA 3HGYA 5B1BH 1WKXA 5E3QA 1FP2A 2OQRA 4UEZA 3HOWJ 3CUQC 2DMPA 3WE3A 4R6TA 2W85A 3WC5A 1TC3C 3RCOA 3KX2A 3OYGA 3IJ3A 2EZHA 1YOVB 1OQYA 3OL4A 1T98A 3ESWB 5J1QA 1SD4A 1OPCA 3HXLA 4IHTA 2EO8A 3D2PA 2L3DA 3NARA 3S2DJ 1SMYF 3I4NJ 1T2KA 1I6HJ 1UUCA 4R87A 4LG0A 4A94A 1B4AA 2ZEFA 2R98A 2I10A 1LANA 2V1UA 3QPLA 1PPFI 2OZHA 4RI1A 5LYIA 2H1KA 3E6DA 1YITI 3FBIB 2SGPI 4UA3A 1XBTA 3KCCA 4BQNA 4K2EA 1M8BA 2TCTA 2K4JA 2MG4A 1X3WB 2QLZA 3DTEA 4PJMA 4B48A 4MHDA 3WTZA 5KHDA 4XICA 4ZTJA 4G6DA 2DPUA 3R5AA 1BO4A 4KVXA 1ZG9A 4H0EA 1FMVA 2EH3A 4BHCA 5M5YJ 3DPLC 4Y33A 2WA0A 4BGDA 3FECA 2PJCA 3ZQ7A 4CCNA 5K7FA 4UF4A 1CM0A 5A28A 3AG2H 3IUOA 3TW7A 4D9JA 3MEKA 2EINH 4ZH4F 3BROA 1TW3A 2HOTA 4LB6B 3FWEA 1K6YA 1TKHA 3PFYA 3S1QJ 4OC1A 1VIXA 2VE8A 4KYWA 2OZUA 3K2ZA 3DLAA 2UXNA 4KDPA 1BR1A 1S7AA 3I58A 1ZG8A 4UHTA 2R7VA 6PAXA 1D8JA 4DYCA 2R5ZB 1RXTA 2X9DA 4HA8A 3EDPA 3KR5A 1B9MA 3NH5A 4NHJA 2F2EA 5C82A 2R7SA 1VQ8I 4LMYA 1HC8A 3PIOF 2PDOA 1LRZA 1BI3A 1ZN2A 3OYHA 2CW0F 2JVGA 4CCKA 5C4JJ 4XPDB 3HZJA 3PRTA 2M4GA 2NNNA 2BBYA 4JX4A 2XAHA 4MI4A 1BOAA 2OCEA 1NSLA 1IDYA 3FEDA 2IEKA 2FF4A 3ZRGA 5EG0B 2XRLA 3P2HA 2HXIA 3VH9A 2KFDA 2X6OA 3MN2A 3VYSB 4B44A 4Y17A 4HSTA 3CCQI 3SJMA 4IRIA 1R00A 4I98B 4AVPA 3QPHA 4L9NA 3IH2A 5I0CA 1HEVA 1AMPA 4BHBA 1EV7A 5KK1A 1FNOA 1TT5B 2JDDA 5IP6A 1R7JA 4KOVA 3H9JA 1HW2A 1IN6A 4XN3A 4HDUA 2M34A 3BTCA 1Y7RA 1XD7A 2X4HA 3IIBA 4NXYA 3TOAA 1ZGAA 1X3UA 1WQ2A 3T8TA 5M5WJ 1JUPA 1IRZA 4OC4A 1TUSA 5CQEA 4AYBN 3I54A 3ABUA 2NYXA 2B8TA 2PR8A 2JA2A 2AQEA 4B3AA 1Q9BA 2Y9ZA 3PEIA 1JTXA 3HC7A 3R0AA 3L2NA 3A9LA 3ZQHA 2JRTA 2IAIA 1V5GA 2OU2A 5LHGA 2ARHA 2QECA 3RI4A 3I53A 2E1MB 3S6FA 2HZDA 3X2QH 4RB0A 3H5RA 3SQNA 2LD5A 1T0FC 2V53A 3RKWA 1WCMJ 1Z2LA 1RUOA 2KDOA 1YI2I 3GYAA 1S5LC 2KIFA 3R9FA 2Z99A 4ZYAA 5KAFC 3I59B 3F8MA 1QMUA 1BM9A 5IB9A 1CGII 3J7ZI 3ZQLA 4HF1A 5HS9A 4A3DJ 5E3MA 2J8NA 3TO9A 2A6EF 5LGTA 4HZFA 4OKOA 3VB2A 1R5GA 4RGRA 1W1WE 4ZTFA 4XPKA 1XA6A 3R6SA 2RVCA 5FUXA 3ZQCA 1ONVA 2O53A 3SI2A 4V2FA 3TO7A 2GA1A 3MAJA 4M3SA 2LVSA 4CGNA 4MRIA 1Y8QB 3WTXC 3FMSA 1ZYRF 2XHKA 3J7YJ 4BY7J 2P0WA 5TRDA 1N77A 4PK3A 2RQQA 4EATA 4DBQA 3OYEA 2LC2A 4DZPA 4E7KA 4M6YA 3IWEA 3T9YA 1LAMA 1U5TB 2CWEA 3HUGA 2PX9A 1H89C 3P9KA 4XN0A 4ETSA 2ESHA 4CYCB 2LY1A 1Y1WJ 2F5DA 2EK8A 3OYLA 3N5FA 3S6HA 3S16J 2R7RA 4MEYF 3JSPA 1HKTA 2DTRA 2VJ4A 1WWZA 1YK3A 2XPWA 1E17A 4JX5A 2Y0MA 5IPAA 4PV6A 2Z3OA 3HDDA 1YGHA 1YW9A 2V1NA 2ZXHA 3JRDA 4KIBA 2CUEA 1QPMA 4P9FA 1W36D 1AKHB 2DU9A 2CUJA 2PBIA 4MIMA 3DEUA 2NU1I 2NU0I 1UFMA 2DA2A 7WGAA 4B5OA 1OR7A 5ICCA 1MMGA 1SFUA 3B35A 2VKHA 3IRRA 4EGYA 3M8EA 2HDCA 5F46A 2EK5A 3B02A 5FLMJ 2JN6A 1WTJA 4B3XA 4L0YB 3B8GA 4BUPA 5ERIA 3BOQA 3AL0B 4E1PA 1YLEA 4X6AJ 5J47A 1QBJA 3CJNA 2HPMA 3D2MA 4YGOA 1U9NA 1ETKA 4EJTA 3HLPA 2VBQA 3HRMA 3DBRB 4M6GA 2DFEA 2FX0A 2QMLA 2KZVA 4EM0B 3PQJA 1S7NA 3JCUC 3TP0A 2NOJB 2Z9OA 2JTVA 3KR4A 5JM6A 1WJDA 3CESA 3F0CA 2HOSA 1I50J 3DQVC 3HHGA 3TDZC 1F5TA 2J9AA 2G0EA 2PFBA 1X1AA 3RYPA 2XIGA 3K4CA 2W1OA 4HPQA 4I0AA 1LVAA 4U88A 1R1TA 4XLEA 5ICFA 4R79A 2R3SA 3ELKA 4BH9A 1SFOJ 2KIUA 2Z3KA 4H6UA 2FE7A 4KOUA 4OC5A 1PU9A 5ISVA 3GLJA 3B6AA 2I00A 4NBQA 2JEWA 1KBFA 1A04A 2REFA 4YRHA 3PSIA 2LRDA 3HTUA 4JCVE 4M71A 2CWHA 1TBRR 1CJWA 5CQGA 1ZQ3P 1J7KA 4JD6A 5HLHA 5HMNA 4JYKA 2OTLI 4Y4RA 4MMOA 3TMOA 2GIZA 1M1EB 5F0FA 4XLNF 3FK6A 1YRNB 5IV0A 2QBYB 3ISXA 3CJQB 4UB8C 4L0ZB 4Q5SF 3KYDB 4P45A 1QGPA 1KZHA 1K4TA 1IJWC 5H6QA 1SEUA 4XPDC 1U5KA 5EEHA 3W6JB 1FTZA 4IJAA 3JW4A 3V4GA 4KJZA 4UIBA 2OD5A 3SI1A 2QPOA 4J19A 2CW7A 2VONA 9ANTA 1IO2A 2UV1A 1IC8A 1VQ4I 2GE3A 1O57A 3UGLA 5IB0A 2R93J 4NQWB 5AIPA 1V55H 3ASOH 4IHSA 5AIQA 4KISA 2PJ7A 4NF1A 3C2GA 4PXEA 1LB2A 4KUMA 4P96A 2P81A 1SAXA 3LQRA 1R43A 4CAWA 3HRSA 2QQ0A 1A36A 2EZKA 3L9FA 1RESA 3BQYA 4MLOA 3WODF 5IYCJ 2HVRA 3U2RA 1WZ2A 2WC2A 1U8RA 1MBJA 2M30A 4EJVA 2WV0A 3BR3A 1PCEA 2ME6A 1TWHJ 3OXLA 2LY2A 2C6YA 1B1BA 4FBEA 1MH4A 2W00A 1X10A 1X1BA 2R5ZA 2DA7A 4UCPA 5KVRA 2DB6A 2BY3A 5TISC 3SXOA 3MKLA 2WWYA 1VF9A 1X2NA 4CO8A 1L3LA 1MBGA 4FCYA 3DSBA 2V1CC 2D4OA 4ORFA 3K4KA 4P1WA 3S1MJ 3LSJA 2LOOA 1NH3A 3R5CA 3HJEA 4CGZA 3HUVA 1R4NB 4BXUA 2GOXB 3GB0A 3B3TA 2HQRA 3KZYA 2DA6A 1PCAA 2Z16A 3LFUA 1R79A 1XB4A 4BDYA 4X3RA 4DBRA 5AGEA 2EV5A 4Q47A 4F92B 5EG0A 2ZENA 2QQDA 2GREA 2KIMA 4CGLA 1S5KA 4JBAA 1TT0A 1Y1VJ 5KTCA 5LRSA 3WTUC 3KP2A 3QYBA 1FOKA 2Q2EB 4EQQA 1QNTA 1HDDC 4E8OA 1XMBA 4D5CA 1XDUA 3OIQA 2DT6A 5G21A 1IXRC 1F2OA 3QB8A 4DYQA 1LAPA 4UEEA 4K3NA 1EH8A 4MTEA 1G2HA 2E36A 1ZLKA 1X58A 2IVMA 4R9MA 3QQAA 3R4KA 5J4YA 3LOCA 1YTPA 2POKA 1ZRDA 3K6GA 2RFHA 1U5TC 3S2WA 1JJ8C 2A07F 3MRUA 5C3EJ 3WHCA 2XAJA 1VZ0A 4ZBGA 4OOIA 2QQCA 5K8OA 5FKKA 2B4DA 2XKOA 2O61A 4XLFA 1KYZA 2O8KA 5F6FA 4MPIA 2VC0A 5JPHA 4KITB 2HDWA 4PCQA 5IP9J 1PTRA 3JRUA 1Q2CA 2H8WA 2JWTA 5LGNA 1T56A 1OCPA 2IGMA 5ILVA 2VPLA 1ULNA 3GUXA 3R9GA 4RGUA 1XEBA 3PFOA 4OMZA 2R5YB 3RIRA 3SZPA 4OIOF 2F5CA 4E7HA 2G9WA 2V1CA 2P6FA 2VZZA 2M7AA 5L3EA 2ZW5A 2KHMA 4A32A 2FEZA 1G6NA 2E7WA 1KQ9A 4P9UA 3D66A 2OR4A 2HPIA 1XMAA 1B8IB 2CQQA 1L0CA 1R23A 1H88C 4LD5A 4A0YA 2A05A 2LEOA 1VQPI 2DEAA 1OMTA 2BV6A 4B1RA 3M9AA 3R9EA 2CQ7A 5EEGA 2YX4A 3IRQA 1JT0A 3KHZA 3RQIA 2ID3A 3GY9A 1WGXA 3JRCA 3D67A 2ZB9A 2DA3A 2WAQN 2Q43A 4ZY0A 4CUGA 2QQ9A 4YELA 2MFZA 3AL0C 3VDUA 2F8HA 2V4JC 5KNLA 1UWYA 2G3AA 1Z91A 4OMEA 4UFVA 2X48A 3ZR8X 4OINF 2PJPA 1IXSB 8CPAA 1I1GA 4AWXB 2HC9A 5K5OA 4P4BA 4NGQA 4DIQA 3CP2A 2J5OA 1RRJA 3TEDA 4HNTA 1ZRFA 5GAHJ 2XASA 2ZSHB 2QEXI 1Y56A 4BNCA 5E8IA 1VHSA 2G9DA 2ZOFA 5JQ4A 3OMYA 3L2CA 3CCJI 1YQAA 4CYCA 4WK8F 1G59A 3V8LA 3BHXA 3FNCA 3W6KB 2FRHA 1CX8A 2CNSA 2NVXJ 1I3QJ 3FXTA 2EIKH 1IG7A 2XF7A 3CP8A 4RN7A 2I5UA 3ZQQA 3RJPA 3PM1A 4GYGA 5LHIA 2IMOA 4B10A 1WI3A 4A31A 3WC7A 4Q38A 3IH3A 2PE3A 3LQQA 2BHYA 3J7AY 4B6ZA 5HODA 2K40A 3WG7H 1LE8B 1LVKA 4MFEA 1AKHA 4HX8A 3GTQJ 2ZFUA 4C3JJ 5IT9K 1YSJA 4IRGA 4FX4A 3CCLI 2SGQI 1S7FA 3I55I 3DF8A 1H0MA 4P5OA 4N9HA 1JHFA 5LBQA 1Z9CA 1W5TA 2QA4I 2P7CB 2YQPA 2LREA 4L89A 1R5HA 2V79A 4NC7A 4LQ6A 4UCMA 4RLQA 4DZJA 1Z8WA 1H9GA 1W4MA 1XSXA 4IXAA 3I0TA 3GXOA 3J7AO 1IV6A 4RB3C 2JLMA 3F5BA 4D5FA 4I49A 3WGIA 1GXQA 2HEOA 5HQ8A 2E5RA 3ZGKA 4MQVA 4F3QA 3JAMK 2VRWB 2FVGA 3IWFA 2PJ9A 2D1VA 3QWLA 4LIVA 4C2MJ 5L3BA 2B4BA 3CC2I 2BW3B 2JJ7A 4EEFG 5CNPA 1G4DA 4ENJA 3ULQB 3CCSI 5EX0A 2E73A 3FC3A 2KMOA 2DA4A 1JKQC 4ON0A 2O4HA 4NC6A 2QWWA 4N4OB 3G1OA 1UJ8A 3W6SA 1QVTA 3WC6A 5F09A 2R4GA 1SVLA 3MZ8A 2K4BA 4GXOA 2JA8J 1TBXA 1W3SA 2G3TA 3EC4A 3H8GA 3HKZN 2OCCH 3KLNA 5G20A 4F6AA 5EJCA 3Q9SA 4YFJA 2ZXJA 4M9ZA 2HU9A 2YS9A 2QENA 4E4HA 2CXAA 4CZCA 2Q4YA 2IQ6A 2VI7A 5J6XA 1Y1BA 1V0CA 5FUVA 3F8CA 2VL8A 5B66C 2ZW4A 2HQ5A 2NS0A 4ANJA 2JVHA 3L2UA 1OCOH 3UOEA 2VN2A 3ABMH 5LRGA 1X19A 2CQXA 2QBYA 3ZOBA 5FRMA 2K3PA 1QZZA 4BMHA 2XF6A 3ABLH 2A61A 1KWMA 4MY3A 2ZC2A 5M3FJ 3E59A 4AU7A 5CKTA 3K4MA 1FYKA 2L7XA 1TF9A 3FM3A 4M6VA 1ZELA 4RGSA 1M4DA 5E1WA 2XAQA 4BE2A 3OR1C 5J8CA 5FLVA 5D6FA 4RS8A 3DP7A 3BZKA 4BJ5C 3BPVA 2WB1N 4Y15A 4YU9A 4NQWA 2ISZA 2PMHA 4MNUA 2XPVA 2OVOA 1CQTA 4OAZA 3MCZA 1ELMP 4EMEA 2G7UA 1Z0XA 5CLSA 4V2GA 4UB6C 4BEHB 3H0DA 1XBUA 2DA5A 1UG0A 3ZMSA 2XDVA 3CF5F 2P4WA 3BZCA 1YMEA 3PZJA 2ROWA 1RKTA 2JA7J 5DV5A 2DFIA 1SGNI 1WJBA 2XEJA 1BJZA 1BR2A 2LFBA 1HXDA 1LFUP 4BD9A 2Q04A 2F4IA 3T8RA 4NB5A 3FMRA 4NJQA 4GO1A 2V1DA 2IPQX 3AG1H 1UHMA 4XPLA 5B5EC 1WKMA 3CXSA 2A69F 4QTRA 1ZHFA 2FBKA 3D7FA 3OYNA 1T38A 2Y48A 1MDMB 1AHDP 2ELKA 2V7FA 2HQNA 2ICWG 3SDGA 4U7DA 4L18B 1CP7A 1ETVA 4PXBA 2H1LA 1OYYA 3RKXA 1ARLA 5IP7J 2MD0A 1KZFA 2FNPA 4WXCA 1C0WA 5AG5A 2KJBA 2HI3A 1OBRA 2CO5A 2DPSA 1SD5A 1SD6A 1ZO0A 4KFCA 1JGGA 1A6IA 1GV2A 5H84A 2VOOA 1Y8FA 1JI8A 2G7HA 3K4JA 1R1VA 4CCLA 4H89A 3RZAA 2Y31A 4ZY1A 2K5CA 2Q2EA 1G3SA 5CCLA 3ISZA 2VBYA 2VB6A 4EV0A 3OYKA 3HOSA 1Z2IA 5FFZA 3FB3A 3VYTB 3CF2A 1R4MB 2GZWA 3GTJJ 3KASA 3CMEI 1TQPA 1ENHA 4LB5A 4XSZF 3K4NA 2OQGA 2L0KA 2NU4I 2LKPA 1YIOA 3DWLE 2LF8A 1IOIA 4NGTA 3JRGA
chains in the Genus database with same CATH topology
4UXNA 2XV4S 1IN4A 1F9NA 2AXLA 4G6QA 5L3FA 4ZYEA 2FIAA 1YR0A 5D8LB 1YTYA 1BIBA 4MJ8A 3P7NA 4AG7A 1OYWA 4ZYGA 1YYVA 1ON2A 1RUNA 5FLXZ 5F47A 2PMUA 3K1PA 1XSVA 4JQFA 1M44A 4X5KA 1O3SA 5D5VB 2XGXA 1HSJA 3HOTA 3B73A 3WTWC 2D1HA 1TW2A 2ADUA 3T0YA 2OA4A 1Z6RA 2MBFA 4KIFA 4GGGA 4KLWA 3TOBA 4HF2A 4A5MA 2IJLA 4S04A 4MBUA 4ESBA 2YNEA 1XGSA 2CGPA 4TV7A 1FX7A 3ML6A 2Q0YA 1Z4RA 1OMIA 4KSAA 2Z33A 4IRHA 1QQIA 4I0BA 2ZFWA 5BS6A 3OWCA 4QC6A 2H94A 5JFRA 3WGHA 3HSRA 3GLXA 2RV8A 2YSRA 2Z5UA 2Q0OA 3QP6A 1W7PD 2FXAA 3IL2A 2VOPA 2IL4A 3JTKA 2A6HF 4R57A 4OMYA 3E97A 3NQOA 1T6SA 4Z2YA 1SFXA 4AD9A 2FIWA 3QOPA 2K86A 5ICGA 2H27A 2CYYA 3J80K 1KQ8A 3FXRA 4G8XA 1QSRA 4PDKA 1IUYA 5A27A 5E20A 4R1HA 1IN7A 5EC4A 4QLCU 1U6GA 1MD0A 1DPRA 1KYWA 1V4RA 1S6LA 1XDSA 4GYIA 1CF7B 4MFKA 4L5IA 2YU3A 4MFJA 4CYQA 1VKCA 3Q5FA 4IF4A 3R0JA 1EH7A 1ZRCA 5LLQA 1K79A 4QUSA 4MQ9F 3AAFA 5BPDA 1ZARA 1K78B 1GHCA 5F1RA 3GF2A 2JPBA 1FT9A 3IU2A 5ILUA 4I09A 3CUQA 3Q9VA 1FYMA 1SQHA 3N7ZA 2YX7A 4N9IA 4O5VA 5DD4A 3H4QA 1RIOH 2YNCC 4IVNA 3DR6A 3KP4A 2P5KA 1HW5A 4YIIA 4ESFA 2JDCA 3F8FA 5D5UB 2FMYA 2X7BA 2DLLA 2YNDA 2RQPA 3VODA 1AOYA 1MK4A 3E5UA 1Z4EA 4O3MA 3TTHA 1U78A 5K5QA 3M7GA 2VBXA 2AS5F 1MDMA 1HSTA 1R22A 2A5YB 1KQ0A 2ZXVA 3MZYA 4LLLA 4ONUA 5K1YA 4G7ZF 3U9GA 2O28A 4LUAA 4FD4A 5FVJA 2J5PA 4WCGA 4NSQA 3GVAA 5FB2A 4HAMA 3GW2A 3RPUA 4EM1A 3L7WA 3BJ7A 1MJBA 5DD8A 2EA4A 4XSXF 2GAUA 2HTSA 4EVIA 3MWMA 2M87A