1MJ9A

Crystal structure of yeast esa1(c304s) mutant complexed with coenzyme a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVASILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ESA1 PROTEIN
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mj9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mj9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mj9A02
3BJOA 4HNYB 3QRFF 4P9FA 4UWJA 3CUQC 4KIGA 2PI0A 4GYGA 4JXRA 1Q1HA 3J81Z 3HTSB 2ISYA 4FD5A 2L3DA 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 4KOVA 4OU0A 5E20A 2W85A 4Y49B 1NE9A 5IX3A 3DP7A 2L4AA 4IJAA 2CW0F 1T0FA 1LEAA 2CY2A 4CHUA 2FL4A 3E6CC 1A04A 1XGOA 1ZRFA 4MEYF 4OAEA 2B3VA 3H3ZA 4PCQA 1BI1A 1QBJA 2P6GA 4B5OA 5E96A 4HZFA 4Y17A 4M3SA 4U7BA 4PGHA 1E2XA 4MY0A 2W24A 4ENMA 4KOSA 4F6AA 1KU3A 4IF4A 1ON2A 4N9HA 2IW5A 1V4RA 3GX4X 4KLVA 1R7JA 2PBIA 3KEQA 4LLLA 3CXQA 1Z7UA 2DQRA 2G7UA 1ZHFA 5D6EA 2P8TA 2HUZA 2XUBA 4KICA 4ETSA 1IXRC 4QB9A 5IV0A 4EVYA 1FNNA 4MI4A 3ABUA 1IB1E 1N71A 4RGXA 3EDPA 1IN4A 1IICA 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 1G3SA 4PV6A 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 3K69A 1G3TA 3FXQA 3KKWA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 4P96A 3SQNA 5CVIA 1XSDA 2UWMA 2XGXA 3CO7C 5CLSA 1W7PB 3MCZA 4IPAA 1ZGJA 4XNHB 1T38A 5JHUA 4MHDA 3IWZA 4KLWA 2FSWA 5J8FA 1RNLA 1USTA 5F46A 4RS8A 2D1VA 2J8NA 3K1NA 4EGZA 1NHAA 3KZYA 3EXNA 4U0YA 1QSOA 1EV7A 4KN4X 5HDKA 1REPC 5I0CA 3KP5A 3COAC 4U0WA 3BJAA 3LAJA 3W6XA 5FFZA 4XPDC 1O3TA 2B0LA 1R5GA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4EM1A 3KETA 1ZREA 1B6AA 5L3DA 2O61A 2FNPA 3G3ZA 3MZHA 2EWNA 3RPUA 2PEXA 2IP2A 1I5ZA 5DV5A 4K30A 3I59B 2DPDA 2FBKA 2J5OA 1ZG1A 2R98A 5ICCA 1XDSA 1YREA 1O3QA 1NSLA 2FE7A 1W7PD 1XMKA 3HRSA 1V0CA 5AONA 5F47A 1PUAA 4NEXA 3F8FA 5ILVA 4WF2A 1OPCA 4BXUA 4M71A 3LSTA 3HRMA 2GA1A 3B8GA 1TLHB 2A07F 4I2OA 2JDDA 3ZQ7A 2P7CB 2KRFA 4YFJA 1QQIA 2XASA 3FM5A 3BJ7A 3RYRA 4AVBA 2K5TA 2BE5F 4ENNA 4HF2A 4ZH4F 1TNTA 1IYLA 3R9EA 2ZCWA 1TIQA 2V6CA 1Y9WA 4LFUA 3UY5A 1PP8F 2H6CA 2ZKZA 3IC7A 2HWVA 1F1ZA 4BYYA 3CLOA 2GWRA 4LB5A 1BI0A 4KIFA 2QBYB 5AIPA 3TO9A 1M4DA 4KOWA 1LDKB 2ZNZA 3ABTA 4I0BA 3LD2A 1SD5A 3ZMUA 5FGMA 2BEOA 3R60A 4JJXA 2EFPA 3WTSC 2FNAA 2KIMA 4B09A 1FBUA 1K6OA 1WI9A 2HQRA 3C26A 3GFIA 1QPMA 2CFXA 4II9A 2FMYA 5FO5A 3G8WA 4HF1A 1XDUA 1DDNA 3O6BB 1O7FA 2IVMA 2ATRA 3DR8A 2D1HA 3L9FA 4M6YA 3S2WA 4HF0A 1R22A 2W57A 3GY9A 3M1EA 3CUQB 2PMUA 1T98A 2QVOA 4MQVA 1VKCA 3WU0A 4Y15A 1QSTA 4CDGA 4A12A 2M45A 1YK3A 3TCVA 2Q2EA 3ZMTA 1J0RA 3CDHA 2M8EA 3EUHA 2VEZA 4KVME 2QQAA 2IA0A 1R1UA 1BC8C 2JDCA 3K1PA 3QU3A 2R7HA 1ULYA 2O28A 2V79A 3QPTA 4XSXF 2XRNA 2IRFG 4IHSA 3PP9A 4NQWA 1IRGA 5HS8A 2FXAA 5LEJA 2WPWA 1B4AA 2JT1A 3IWFA 2X7BA 4KUBA 3F8BA 4HBLA 2X0LA 2EUIA 1OKRA 2ISZA 5H86A 3HRTA 5LHHA 2RGVA 3KEOA 3FMQA 2YU3A 5F1RA 2EFWA 1I27A 3E5UA 1HBXG 4IHTA 4XLNF 4HA8A 2VZYA 3GYAA 2CNTA 5K5QA 2FIWA 1M4GA 1P4NA 3IL2A 2P6FA 1Q2CA 5DDGA 3FF5A 1FPQA 4JQFA 1J59A 2FEZA 3KZZA 4LJZF 2D4PA 3IRQA 2XIGA 5JI6A 3FXTA 1QZYA 1H9TA 3FYNA 2LKPA 3TOAA 3RI4A 2F2EA 5BMZA 4LK0F 3GYHX 4UVBA 3D5LA 4G6QA 5L3EA 1PP7U 3L7WA 2HTJA 3WTWC 2D2WA 5KVRA 2A6HF 2DT5A 4M9SA 2XAQA 2EA4A 4PK2A 4U9ZA 4OIOF 1XMAA 3GFMA 3SZTA 2GAUA 4RAZA 4N9IA 2XV4S 1U6GA 1DUXC 3R95A 1QZZA 5F64A 4Z2YA 3Q5FA 3HOTA 1Z6TA 2XAGA 3P2FA 2PN6A 3RJPA 3VFZA 2VOOA 1S7KA 1TQMA 4HYEA 3IGRA 2HKOA 3EYIA 1MJBA 4DNCA 1OYWA 1GHEA 2D4OA 3F8CA 5K1YA 5LBQA 4MTDA 1YYVA 4E70A 1J75A 3R9FA 1WWZA 4KIBA 4EM0B 3LQQA 2KJCA 2PMHA 2FBHA 4OINF 3HTUA 3W6SA 3RIRA 2E1NA 2F5IA 5ED4A 2AE6A 3Q9VA 3J80K 3OOPA 1ZG3A 2EFNA 3HSRA 4EVIA 2MLGA 5D8LB 4Q47A 5H20A 1S7NA 3WTVC 4NCZA 4B5PA 2L54A 1X3UA 2M1BA 4YG2F 2CYYA 3VWDA 3DFGA 1F9NA 2CNSA 1YLFA 1R58A 4ZBGA 5BQTA 4GXOA 1SFEA 2ETHA 3GW2A 3PFIA 5ILUA 3ISPA 2Z5UA 4IF5A 2RC4A 3MAJA 4AIKA 2AXLA 2Q0YA 4GCVA 3RKYA 1EH8A 4WK8F 3KCCA 4UUVA 4L0ZB 1R1TA 1XIXA 5EBVA 4R1HA 1ZRCA 5E8IA 2H27A 4ONUA 5DCFA 4HQMA 3E6MA 4L5JA 5E1XA 2VC1A 5FD5A 3J80Z 1DPRA 3CJNA 4YIFA 4XLPF 4KDPA 5FLXK 3C18A 4MEXF 2VZZA 4XPLA 1Z4EA 2H09A 3IWGA 4U88A 1LNWA 5KTAA 3R1KA 4CAWA 4M9ZA 4GYIA 3D0SA 4L8AA 1FSHA 1KUYA 3U1DA 4KVOE 3R96A 2HS5A 1G6NA 1XD7A 4U9YA 1P4XA 1FBQA 3QU6A 2DI3A 1XE4A 3WTXC 3CXSA 4RB0A 2V9VA 4UNOA 2RNJA 1RXTA 2YR2A 2HGCA 4HLYA 4P9UA 1F5TA 1BN5A 2UXNA 1O7LA 3ML6A 1YO5C 5H6QA 3WGIA 3EQLF 3F8MA 5FLXZ 3T90A 2L02A 2EA2A 3JSPA 4CAXA 3WTTC 1NMTA 2DK5A 1S29A 2G3AA 4HX8A 3I54A 2XAJA 4ESFA 2ZW5A 4FX0A 1OZPA 1XGSA 3RYOA 3FZVA 2ZJ2A 2IJLA 5J6XA 2RN7A 2Y48A 4PZJA 2CQKA 4E2AA 1WK4A 3R61A 3K9UA 1YW8A 2GIVA 4GO1A 3DV8A 2Q7BA 1RZ4A 2JRTA 1B9NA 4KA4A 4LG0A 4I01A 1D8KA 3R4KA 5LGTA 3ZMDA 3TOBA 4J3GA 2HYFA 3N97A 3ROUA 4UVAA 1FX7A 2VBYA 1IN5A 3DQVC 2IA2A 2EJRA 5ERIA 2MA3A 3D3SA 3DR6A 2QQBA 2PRBA 5DD8A 1KUVA 1D8JA 1O57A 5IT3A 4CAVA 5LHIA 2G7HA 2PG4A 3JTHA 2OZUA 1W5TA 1FP1D 1RUNA 3DEUA 3BPXA 4MJ8A 4GGGA 4QVTA 2GQQA 3EY5A 3RKXA 3SHFA 2P5KA 4BQAA 2IL4A 3C7JA 3PQJA 1YG2A 2G3TA 2Z11A 3ECHA 5AIQA 2DXQA 1Z4RA 2ZW4A 1DP7P 5ISVA 3K0LA 3FBUA 2Q44A 3FMRA 3R0AA 2P0WA 5CVUA 1M44A 2X4HA 3ZP5A 5C82A 2H6BA 1UHWA 4M73A 1Y0UA 2A6EF 1P92A 4RAYA 4WWCA 2E1CA 5FVJA 3K9TA 3TFYA 3F5BA 4HX7A 4RGSA 5D5XB 4KN7X 1BOBA 1XGNA 1LB2A 2EVNA 1KQ0A 1LVAA 3QOPA 1D5VA 4NXYA 2VBQA 2Q4YA 1B1BA 5F48A 2GXGA 4FD7A 1FY7A 2REEA 3ELKA 3DF8A 3FB3A 3F72A 2G9WA 3WG9A 2VBWA 3ZJ0A 5JVTA 3RTRA 5LGNA 1SFXA 4CRZB 3BJ6A 2BL1A 1KU2A 3TO6A 3LFKA 2HKXA 2O8XA 1ZAOA 1HW1A 4KORA 1YW7A 4EQQA 4M74A 1LQ1A 1Z9CA 3O3KA 1S3JA 1YGHA 4B5PB 1IUYA 3V8LA 1P6RA 2VE8A 4G8XA 2PFBA 3HIFA 4UXNA 2O03A 3P2HA 5JFRA 1JHHA 3JW4A 2BYVE 2KIUA 5CNPA 1U8RA 1AWCA 3P7NA 5JQ4A 2CO5A 3WTUC 4ENKA 4GS4A 4EV0A 2G0BA 4YIIA 3GO5A 4AB7A 3E5QA 1HW2A 1T2KA 1IIDA 2B3UA 1XF8A 2HYGD 5TJJA 4YRHA 3V7CA 2ZMEA 1MK4A 1FT9A 4UBRA 1YFHA 2NAZA 5K5OA 2P4WA 4ZZDA 1CF7A 1MKMA 2OZGA 3Q9SA 4JD6A 1XGMA 2QMLA 1K7AA 4IRGA 3TTHA 3F8KA 1S7LA 3O2PE 1B87A 1AOYA 4L9JA 2B5GA 4L9TA 5EEGA 2RDPA 4S05A 1P4WA 2PQ8A 1BI2A 1IYKA 2ARHA 3KLNA 1WQ2A 4H0EA 2NNNA 1O3RA 4EJOA 2FBIA 2XAHA 3SXOA 1L0CA 4BHPA 1BIBA 3TGNA 4ASNA 3K1MA 1R57A 2O0YA 1SD6A 2BGCA 2RQPA 4NHJA 3QP5A 3QPHA 2MC3A 3TT2A 3FMSA 4HV5A 1IXCA 2EV5A 3TKYA 3F6OA 3WTYC 2MH9A 1EH7A 4I7HA 4CS0B 5LRRA 1MD0A 4JBAA 4F7ZA 1YW9A 4DQ2A 1K78A 3D2MA 3ZN1A 4M85A 3HRUA 2K4JA 2M5WA 1KUXA 1S8NA 2P6TA 1MDMB 3CTAA 3ZN0A 1Z1DA 3BP8A 4HLXA 1ZH5A 1HKTA 4P55A 1KU7A 4FT8A 2DFIA 2TDXA 2ZFWA 1I1DA 2WV0A 5GCNA 4L9VA 2FIAA 1J7KA 2PR8A 2LNBA 2MD5A 2ZXJA 3E0KA 2VXKA 1QSNA 4Q4ZF 2DTRA 1T39A 1IZ1A 4HDUA 4CO8A 3QB8A 4LG0B 2HFHA 1QNTA 3V8JA 2M30A 5HOOA 3OV8A 4QBJA 2FE3A 4OOIA 1IN8A 4JLYA 5DWMA 2WC2A 2H94A 3NRVA 4O6JA 2E7WA 4UV8A 3ERED 2ZNYA 3FXUA 4ZYHA 4U0VA 1ON0A 4I0AA 5JPHA 5IT9K 2YPRA 2OH1A 2R8VA 1I21A 1GHCA 4PSXA 4LD5A 2RKHA 3KP6A 1R5HA 3MWMA 5ICFA 4XSZF 1LJ9A 2OBPA 2QLZA 2VONA 5L3FA 5KTDA 1SQHA 3GWZA 4ON0A 3LA3A 1J4JA 2QIRA 4G7OF 4YFXF 2Q8KA 1M4IA 4AVPA 2J5PA 5HLGA 2LDUA 5EC4A 3B02A 2EFOA 3GVAA 2VOPA 3HYIA 5C88A 2K4BA 1U6MA 4XPKA 2W84A 2RVCA 2LF8A 3WTZA 5DUKA 2BBYA 2BUEA 1XEBA 3HSFA 3M8FA 4AIJA 1P2FA 1U2WA 3GEZA 3REOA 1BOAA 3DDDA 1B59A 5IT9Z 1CJWA 4KYWA 2O3FA 4G7ZF 3SHPA 4U5YA 1J2XA 4XPDB 1Y9KA 2MLKA 1IN7A 2KKOA 1U3EM 3H3UA 3W91A 4WXDA 1XMTA 4CICA 4NB5A 1M1DA 1L0OC 5LRSA 1GXQA 2JZYA 1RO5A 1USSA 1H9GA 2WPXA 2Q0OA 3HHHA 3E6BA 2D45A 3WE2A 2QZ8A 5A2QK 4AVAA 3G73A 5E1ZB 4IRIA 4IUSA 3N4MA 1QO0D 3V8IA 2VT3A 2FT0A 1HXDA 3CO6C 4NSQA 2UZKA 3DXJF 1Q2YA 2PC1A 4MGRA 2DPUA 4P5OA 1ON1A 4BHCA 2HR3A 3F23A 3J7AO 1UHMA 2DU9A 2AS5F 2OA4A 1G3YA 4KOTA 3P9IA 2QM3A 4WXCA 2P5VA 3ZMZA 3U9GA 4G6DA 1KQ9A 5BS6A 2HV2A 2ZBKA 1XB4A 2B4DA 2BEIA 3NQOA 1JHFA 4UHTA 4HX4A 3S6GA 3I4PA 1HSJA 2ZMEB 4K2EA 1IW7F 4RB3C 1RI7A 6PAXA 1WKMA 1CF7B 2IT0A 3PGPA 2OQRA 5A2QZ 5CYVA 5D5UB 1QSRA 3RPQA 2JEVA 2F5CA 5HLIA 2C27A 1EH6A 5KK1A 1MGTA 1VHSA 4A6DA 2KCWA 4A2UA 2B5GB 5E8GA 4QLCU 3C1DA 2JPBA 3N7ZA 4OMYA 4F0YA 1TNSA 1Z9UA 1L3LA 1ZN2A 4CGZA 1OYIA 2F5DA 4FHTA 2IPQX 1W4MA 1ODDA 3FNCA 4KUMA 2C6YA 2VODA 2J8MA 1YVOA 3T8RA 2YX4A 2HZTA 2FRHA 1O3SA 5D6FA 3ECOA 2XVCA 3R0JA 3S6HA 4RGUA 2FCKA 3CXPA 3GUDA 4EMSA 3F6VA 1FLIA 4KOUA 2QWWA 3I71A 2I00A 1S6LA 2CNMA 5L3CA 4R8HA 1TBXA 2RV8A 3V7RA 1K78B 2LSOA 3PQKA 4O3MA 3ZMSA 2BSWA 1BJAA 4AD9A 3P9CA 4HV6A 4L5IA 3E97A 2FMLA 2VN2A 3JAMK 2E7XA 2DK8A 4CYDA 4M6XA 2Z33A 2Z99A 3FM3A 3LODA 4A0XA 2L01A 3VODA 3MGDA 2COMA 1U5TA 2O6GE 2FOKA 3FHZA 4G94A 1ZRDA 2EK5A 4KOYA 3JSOA 2A4NA 2Q04A 3DPLC 1U5TC 1WWXA 2FU4A 4KZTA 1WRJA 2DO7A 4KVXA 1TW3A 3D2PA 3M7GA 4I09A 2NRAC 1R1VA 1B9MA 4UA3A 1BM9A 3HUGA 2JLMA 3TQNA 3ZMVA 3R9GA 3I9SA 2ZW7A 2QUFA 3T0YA 2STTA 3IHUA 4KFCA 4O5VA 2A5YB 4UV9A 3BLNA 3JVNA 4E8OA 3JAMZ 3IKVA 4S04A 1S3ZA 1LRZA 3I5UA 3LAPA 2CG4A 2PR1A 5LLQA 1YVKA 2OB0A 1FC3A 2R7FA 1KU9A 1YR0A 5HMNA 4ZZLA 1G3WA 1BO4A 3LA2A 1FYMA 2OU2A 2FF4A 1KYWA 5LHGA 1G4DA 1XCVA 1YIOA 4OIQF 4I02A 4JWPA 3F0AA 2XKOA 3DNSA 5IB0A 4CXFA 2DLLA 4PDKA 3BOQA 2NYXA 4ESBA 1S60A 1UFMA 5ICEA 3MEXA 2K7LA 1XN7A 3I58A 3BROA 3W6KB 3WE3A 4ZYGA 4MTEA 2PDOA 3TDUC 4OIRF 1SFUA 5EEHA 1YTYA 5D8KB 4TV7A 2YSRA 2ESHA 3M9AA 2JSCA 1K4JA 4HDVA 3KE2A 4MY3A 4MBUA 2YX7A 1E17A 2FXFA 4R87A 2VC0A 2LF7A 1MJAA 1WSUA 1J5YA 2PJPA 3T9YA 5HLHA 4BHBA 3I53A 1BI3A 2ADUA 2MH2A 4MNUA 2A69F 1ZG5A 1OR7A 3AAFA 3LQRA 3NE7A 3BWGA 3H92A 1UB9A 1S5KA 4HAMA 2Z10A 1TW2A 1PDNC 4PK3A 1YX0A 4KMFA 3SZPA 3I3GA 1FYKA 5D5VB 1XCBA 3PZJA 3KLOA 4A5NA 3L00A 1GVJA 2P7VB 2EB7A 1LDDA 4LUAA 3ZZIA 3HOSA 3S6FA 4L89A 4R79A 5DUIA 4EM2A 3IKTA 2NNYA 5KTCA 4HKFA 2CWEA 2ACJA 4QWQA 5CVJA 4QUSA 3E5XA 1H0MA 1OMIA 2B4DB 2XHKA 3QAHA 3SXNA 2VBZA 4YFNF 4RI1A 1FBSA 3P9KA 4HQEA 5BPDA 1JE8A 2HEOA 3S6KA 4ENJA 2DW4A 5HDNA 3E3VA 3JTGA 2F5EA 3TO7A 2HOEA 2FQ3A 2A61A 3I64A 1SD7A 3GKRA 2A68F 4I49A 4NF1A 5FB2A 3LWFA 1UFHA 1YS6A 1Z05A 2J8RA 2VBXA 2PSWA 5FFXA 1BIAA 2L4MA 1IN6A 4I98B 2V1UA 5HH1A 4LX9A 5DCMA 1Z91A 3GLXA 1IF1A 3F21A 2K27A 3VEPA 4G7HF 3WGGA 4FD6A 2Z9OA 2QQ9A 3I0TA 4L0YB 4RB1A 1JXSA 4BAYA 4ZYDA 3MZYA 3RDIA 2R1IA 5DWNA 4KNYA 1TTYA 4IRHA 1S7FA 2Y75A 5CVRA 4OLLA 2R3SA 1J9IA 3T5XA 2F5FA 2GA2A 4ESJA 1UCRA 2V1DA 1FWZA 5DYMA 5HDGA 4L18B 5FD6A 1V3FA 3EC4A 1SMTA 2P6EA 2ESNA 3QP6A 4H6UA 5LGUA 4R9MA 2KIFA 3JUWA 2AJ6A 1K79A 3VB2A 2PLYA 4EGYA 4AG7A 4N0BA 4HNXB 2B58A 2CSOA 2OD5A 2MBFA 2OZ6A 3BZ6A 2EV0A 4Y49C 4AIHA 3SFZA 2GANA 4PGGA 1F4KA 3HHGA 1RUOA 1U5TB 4AG9A 1Z6RA 2OAZA 5CVVA 2XAFA 3WGHA 2STWA 1HSTA 3WR7A 3F3XA 4OMZA 4EJVA 2VI7A 2GXBA 5DEQA 3E6DA 3RKWA 2HQNA 3M8EA 3TDZC 4Q48A 5F49A 3VOEA 3BDDA 4H6ZA 3D8PA 5HS9A 2WWYA 3BPVA 1LEBA 3EYYA 4R3KA 4WX9A 2Z0ZA 5L3BA 4YFKF 4U7DA 3NEUA 4HOBA 1QSMA 2EV6A 4AWXB 1D3YA 1W5SA 4A0YA 1QGPA 3T1BA 3ZPLA 1FOKA 1YLEA 1IAWA 4A0ZA 3KP7A 3F8NA 3IRRA 1XSXA 5BOXA 1SMYF 2ZW6A 4XBFA 4HW0A 1YQAA 4D0PA 1CM0A 4G9YA 4EJUA 3W6JB 3SXYA 4FX4A 3EFAA 1SAXA 5F6FA 1W7PA 3EO4A 2W25A 2B4BA 3B73A 3EETA 4Y13A 5J8CA 1R36A 1I6XA 3FWEA 5ILSA 4RB2C 1ZGAA 4RGRA 1IXSB 1BBYA 1I1GA 2JTVA 5BPIA 3F22A 2HQYA 3G3SA 4XNHC 4X5KA 4PSWA 2FS5A 4MQ9F 2IA1A 3KP4A 5CJ9A 3WODF 2QECA 2ZXVA 4ORFA 4L9NA 5LEKA 4A6EA 5L3GA 1IRFA 2Z3YA 5E17F 1FSEA 2KJBA 5E18F 3FRMA 1KYZA 3GXOA 3KFWX 4UVCA 5D4RA 1FZPB 2HTSA 2VXZA 2Y0MA 2VT2A 2GZWA 4EJTA 1Q2DA 3GF2A 3DKWA 2H5MA 3OWCA 3U2RA 1Y7RA 1MJ9A 1KQ8A 2K02A 3LA7A 4Q5SF 2A3SA 3I59A 3T8TA 4R57A 2WTEA 1HW5A 4BMHA 4ZYEA 4M72A 4YGOA 5JR3A 1HQCA 3V7SA 5ICGA 3L09A 2QENA 3KP2A 2HDCA 5DD4A 5HS7A 2UXXA 3FXRA 2REFA 1LDJA 1YS7A 4BH9A 2DBBA 1I1SA 4MHGA 1HKSA 1STZA 4LMYA 1OYYA 4UWIA 2R7DA 1ZARA 1TQIA 3FIXA 2DAOA 2M87A 2I79A 3WU1B 1GXPA 2P5LC 3V4GA 2FSRA 3BY6A 1SD4A 2ZPAA 5H84A 5D4SA 4JXQA 2Q4VA 5HVQC 1BC7C 2GE3A 3TE4A 1FP2A 2NS0A 5E1WA 4LLGF 3RYPA 5K5RA 2ZO4A 4IVNA 3GZ6A 1U78A 3KP3A 3DSBA 3VWEA 2V1XA 3CUOA 4QC6A 1ZLKA 4WCGA 2QBYA 3H4QA 2OZHA 4RS2A 1KZFA 2JPCA 1PU9A 1MZBA 4OADA 1S7OA 4LB6B 1B6BA 1KGSA 1R23A 3DPTA 3J81K 4KOXA 1I12A 2BV6A 1JGSA 4H89A 4WXHA 1S7AA 4B8XA 4HNWB 2VQYA 1RIOH 2FA5A 3BJ8A 4AVCA 1R00A 2P6SA 3V8KA 5D5WB 4LK1F 4IXAA 2ELHA 1C0WA 1HKQA 2QYOA 4BNCA 3MFKA 5DCMB 2OQGA 2XKPA 4KMUX 2NMTA 1ZLJA 4E0AA 1ZYRF 1P4AA 4R3LA 1PUEE 1DPUA 1FYLA 4OIPF 1KA8A 1CGPA 3CUQA 4XRFA 3L2CA 4KUAA 3MQ0A 1VTNC 1P0HA 2VE9A 4FD4A 4CRYB 3GFLA 5H6RA 2K86A 3GFJA
chains in the Genus database with same CATH superfamily
3BJOA 2WB1A 2CJJA 4HNYB 3G1OA 3QRFF 1K7TA 2O4HA 4RMNA 3L2VA 1YX5A 1MNDA 4FETA 4P9FA 1VQ9I 2F4OB 2FVGA 3CUQC 4UWJA 1JJ8C 4ZY1A 4KIGA 3IAS2 2PI0A 3H35A 3QPLA 1XX5A 4GYGA 3CPXA 4GI3C 2EBIA 3MZ8A 3IWWA 1SAUA 4JXRA 1Q1HA 4QPQA 4ONWA 1K4TA 2J87A 2EH3A 2MABA 3J81Z 3HTSB 2ISYA 3PB6X 4IZZA 2L3DA 4IKFA 1R5ID 4FD5A 4EMEA 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 2ID6A 3F0CA 4G12A 5EZHA 4KOVA 4TNUA 1JKQC 4OU0A 5E20A 2W85A 1IV6A 3SDGA 5GP9A 4GM5A 4Y49B 1Z77A 3CMMA 4ZJZA 5EF6A 4M3FA 1NE9A 1ETVA 4R6TA 5IX3A 3DP7A 4IHWA 2L4AA 1Z8TA 2P81A 5F09A 5HXDA 4IJAA 2CW0F 3Q3SA 1T0FA 1LEAA 1WGXA 2CY2A 4CHUA 2M0CA 2CWFA 1VQPI 3E6CC 2FL4A 2CV0A 1VFCA 1A04A 3J7AY 3TEDA 1ZR2A 1XGOA 3H5NA 4A3GJ 1ZRFA 5LRKA 2XGDA 3HZJA 4OC5A 1PCAA 1T0FC 4PJJA 4MEYF 3A2KA 5DAEA 1ZKGA 3BCBA 1FMWA 5EX3A 4OAEA 4KS9A 2B3VA 3H3ZA 4PCQA 1BI1A 3E7LA 2JW6A 4BEHB 5DM6F 5J47A 2R7VA 3I3LA 1QBJA 2P6GA 4B5OA 5E96A 4HZFA 2RIJA 4Y17A 4X2TA 4M3SA 3IAM2 2CF4A 3CCJI 4U7BA 1M4LA 2JWTA 3HXLA 4PGHA 1E2XA 1X4OA 2VLAA 1TOTA 4BS9A 1W3SA 4XRSA 2V9PA 3I1UA 1IY6A 3MN8A 2K9SA 4MY0A 2W24A 2Y31A 2N17A 3DLLF 2EK8A 2L0KA 4ENMA 4KOSA 4F6AA 1KU3A 4IF4A 1Z5RA 1ON2A 3KQXA 1X2MA 2HUZA 2JUCA 1ZG8A 4N9HA 1ARLA 3SJEA 2IW5A 1V4RA 2MD0A 3GX4X 1K7VA 4KLVA 1R7JA 1X2NA 4UUSA 2PBIA 4X3RA 1K4SA 3LMMA 4XKBA 3SJXA 3KEQA 2BOLA 2JA5J 2HB6A 4LLLA 5E3MA 4UEEA 3CXQA 1Z7UA 1NTCA 2JVGA 3IH3A 3S9LA 2DQRA 2G7UA 1ZHFA 3M07A 2P8TA 5D6EA 2LLKA 2XUBA 2NOJB 1M1EB 3GTKJ 4KICA 1ETYA 3EUAA 2KQRA 1IXRC 3K4JA 4M3EA 4ETSA 5KNLA 4QB9A 3S9MA 5IV0A 3A0HC 4EVYA 3CJRB 1FNNA 1P7IA 4MI4A 3ABUA 5FRMA 1IB1E 1N71A 4RGXA 4GRIA 1Y7EA 3EDPA 1IN4A 1IICA 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 4A95A 1X58A 1TURA 1G3SA 3NWSA 4PV6A 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 2IGKA 3K69A 1G3TA 3FXQA 4NDLA 3KKWA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 1U8BA 4P96A 3SQNA 2OVOA 4UEZA 5CVIA 1XSDA 5F27A 2UWMA 2XGXA 3CO7C 3HOUJ 5CLSA 3F9KA 1W7PB 3MCZA 2R7RA 4IPAA 1ZGJA 3RZOJ 4XNHB 1T38A 3T8WA 5JHUA 1VQ7I 4MHDA 4A31A 3IWZA 4KLWA 2FSWA 2XRLA 5J8FA 1RNLA 1USTA 3H5AA 2E60A 5F46A 4Z6YA 3KQZA 4RS8A 1IG7A 2D1VA 3S17J 2J8NA 3VE5A 5FLVA 5IP7J 1I39A 3K1NA 2R7SA 3HJEA 3QWLA 1YJNI 2LTPA 3K4KA 3H0DA 4EGZA 3OYGA 1NHAA 3KZYA 1TBNA 3EXNA 3MVPA 4E7LA 2QSFX 4U0YA 1OCOH 2A20A 1P9ZA 2B8TA 1EV7A 1QSOA 4KN4X 5B3SH 5HDKA 1REPC 5I0CA 2WV1A 3KP5A 3B2YA 3COAC 1FEXA 4U0WA 1AKHB 2ZEGA 3BJAA 3LAJA 3W6XA 5FFZA 4XPDC 2ZJQF 5ELYA 1VQOI 1O3TA 2B0LA 2L9SA 2LP0A 1R5GA 5GPAA 2QCOA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4LOCA 4EM1A 5FLMJ 3KETA 1B6AA 2LKSA 3BZKA 4HPQA 3OYAA 1LPQA 3L2QA 1FOWA 5L3DA 2RREA 4ITVA 2O61A 2FNPA 3G3ZA 3MZHA 1CGII 2AFUA 2EWNA 3RPUA 4S0HB 2PEXA 2IP2A 2MC4A 1HC8A 1I5ZA 5DV5A 4K30A 3I59B 2DPDA 3OS1A 2FBKA 4BE2A 5EGOA 3LSHA 2J5OA 3BCAA 1ZG1A 1DTDA 3A01A 3KX2A 2YNEA 2R98A 1W0TA 5ICCA 1FAQA 1ETKA 2LK2A 1XDSA 1YREA 2DMQA 1O3QA 1NSLA 2ZELA 3OXGA 2FE7A 1RKTA 2PJRB 4C2TA 5CCMA 1W7PD 3VPRA 2E2JJ 4E1RA 1GLNA 1XMKA 3BR3A 3HRSA 1LE8A 1SVMA 1V0CA 5AONA 5J1YA 2JEWA 5F47A 1PUAA 4G6TB 4NEXA 4JX4A 4D5FA 1A36A 1K7UA 3F8FA 1R3NA 5ILVA 4WF2A 3HPHA 2ZEOA 1OPCA 4BXUA 1MH4A 1QHGA 2LH9A 3LSTA 3HRMA 4M71A 2QYVA 2GA1A 3B8GA 1TLHB 2A07F 4I2OA 1YSJA 2JDDA 3ZQ7A 4ABZA 1ZLIA 2P7CB 1F43A 5IP9J 2KRFA 4YFJA 1QQIA 2XASA 1KWMA 3FM5A 1CHOI 5IYCJ 4FE7A 4XLHA 3BJ7A 3RYRA 3TBIA 4A3LJ 2DCEA 1RKWA 3OYJA 3ZQLA 1VQNI 1Q9BA 4AVBA 2B63J 2BE5F 5EG0B 2K5TA 1Z21A 4ENNA 1XS9A 2I8DA 4HF2A 3WHBA 4ZH4F 4P4IA 2DMUA 1TNTA 2CQNA 4J01A 2QQDA 1PYTB 1IYLA 5B1BH 3SJFA 3R9EA 3UEYA 4CGMA 2ZCWA 1TIQA 2V6CA 2HDDA 4MFEA 1Y9WA 4LFUA 3UY5A 1XBUA 1GVDA 2VI6A 4PFPA 1PP8F 3GTOJ 5FKLA 2H6CA 4OMEA 4FCYA 2ZKZA 3IC7A 1D1CA 2R7ZJ 2HWVA 1Y1VJ 1F1ZA 4BYYA 3BXMA 1S9HA 3CLOA 2GWRA 3OSGA 4W1UA 1IUFA 4OC0A 4OKOA 4LB5A 2DT7B 3KASA 2JBJA 1BI0A 2KRCA 4KIFA 1X1PA 4XM3A 1TIHA 2QBYB 5AIPA 3TO9A 1M4DA 4KOWA 2R4GA 1JT6A 1LDKB 3HH2C 2ZNZA 2VQGA 3ABTA 4I0BA 3LD2A 1SD5A 2R7QA 3ZMUA 4A30A 5FGMA 2BEOA 2FUG2 4MFLA 2M7BA 3R60A 4JJXA 5B5EC 1TF8A 1XC5A 1ELMP 2EFPA 4GFBA 3IC1A 3GZNB 3WTSC 3ZXSA 1NK3P 2FNAA 2KIMA 1Z7KB 3BQZA 4JX5A 1ULNA 1AUGA 2PJ4A 4B09A 1FBUA 1Z8XA 1K6OA 4HEA2 1MBKA 2X9DA 2HYJA 1DU6A 2G9DA 2DEAA 1TT5B 1WI9A 4E7IA 2HQRA 4A3EJ 1LAMA 3C26A 3GFIA 1QPMA 2CFXA 2QVPA 5G20A 4II9A 2FMYA 2DOFA 3K4MA 4L9MA 3OYHA 1X1CA 5FO5A 1UELB 1EJ9A 3G8WA 5M3FJ 3HB9A 4FBEA 4M6VA 1DU0A 3OOUA 4HF1A 1XDUA 1CGJI 3ESWB 1DDNA 4RBOA 3O6BB 3K2KA 1O7FA 2IVMA 2ATRA 3DR8A 2EZLA 1UG2A 2D1HA 3L9FA 4M6YA 3S2WA 4IK2A 2HOSA 3CP8A 4HF0A 1R22A 1Z7LA 4Y4RA 2VIXA 2W57A 1W5CC 2JRMA 3D5RC 3M1EA 3GY9A 3CUQB 2KMPA 4C7IA 2PMUA 1W4RA 1T98A 2QVOA 4MQVA 5J1QA 1VKCA 1CT2I 3WU0A 4Y15A 1QSTA 4CDGA 4BXFA 2M45A 4A12A 2HVQA 3TP0A 2OD1A 3TCVA 2NU3I 4MCSA 4UY8I 2Q2EA 2TRTA 3ZMTA 4CH7A 1J0RA 5KAIC 3CDHA 1WGCA 3ISZA 2CXAA 2M8EA 1QHHD 4RM3A 3EUHA 2L9VA 3RKQA 2VEZA 2X1EA 4A3CJ 3GTJJ 4KVME 2ME0A 1OCCH 2ECCA 2IA0A 1R1UA 2QQAA 3I56I 3K1PA 1BC8C 2E2HJ 2JDCA 2NVTJ 2DMTA 4FAIA 1RFHA 3QU3A 1YLOA 2R7HA 1ULYA 3GOXA 2O28A 4WWVA 3D7FA 2V79A 3QPTA 1IDYA 1VQ4I 4DZJA 3EUHC 4XSXF 2IRFG 2GOXB 4IHSA 3KHXA 3PP9A 4NQWA 1IRGA 2BXYA 2Q4ZA 2K9HA 2LMDA 1MMSA 5HS8A 2FXAA 5LEJA 2WPWA 1B4AA 2JT1A 3IWFA 2X7BA 3SDBA 3H8EA 3F8BA 4IHVA 1TUSA 4KUBA 2DJNA 1IRXA 4HBLA 2X0LA 2HPIA 5D8NA 2EUIA 1F36A 1OKRA 3IFEA 2ISZA 5H86A 3DLAA 4ZX9A 5E3LA 3HRTA 1OCRH 1R4MB 3LSMA 5K7FA 5LHHA 2Z3MA 2RGVA 4G1PA 2X1CA 1LFPA 3KEOA 2M0MA 2YU3A 3FMQA 2Q7SA 5F1RA 1S7EA 2EFWA 2E5ZA 1I27A 2DYSH 4PPZA 2FQ4A 1HPTA 3E5UA 4CCKA 2PVWA 2CTCA 4ZY2A 1HBXG 2CW7A 2L7ZA 1RETA 4IHTA 4XRMA 2P6AC 3HKZN 4XLNF 4B48A 4HA8A 2VZYA 4V2FA 3QPSA 3GYAA 2CNTA 3FJUA 2VKVA 2Y30A 1LAPA 4X8IA 2W48A 3K70C 5K5QA 3JRDA 2FIWA 1G59A 1M4GA 1P4NA 3KEYA 3JRFA 3IL2A 2P6FA 1MW7A 1Q2CA 4ZTFA 5DDGA 3FF5A 1FPQA 4JQFA 5FKKA 1J59A 2FEZA 3KZZA 4LJZF 2D4PA 4AXVA 3IRQA 2QA4I 4BDYA 2HOTA 4UUSB 5F1JA 2XIGA 5JI6A 4R8FA 3FXTA 4CYPA 4KSAA 4E6KG 2Y0SN 3SYTA 1QZYA 1H9TA 2QQCA 2WZNA 3FYNA 2LKPA 4ZC3A 3TOAA 3RI4A 1VQKI 1IOFA 1UJ8A 3GTMJ 2KZGA 2DT6A 2F2EA 4EATA 2IEKA 1PVEA 2AQFA 4PFOA 3MKYB 3I4MJ 5CBMA 5BMZA 3UEJA 4HNUA 4LK0F 2XF6A 3SI0A 3HC7A 3GYHX 1WKXA 1CE3A 2VJJA 1I3AA 4UVBA 3D5LA 4G6QA 1DE4C 3HL2A 5L3EA 1PP7U 4JCVE 3Q0WA 1ETWA 3L7WA 2HTJA 3WTWC 2K9MA 2D2WA 1CQTA 5KVRA 2KDZA 2A6HF 2DT5A 4M9SA 2XAQA 2EA4A 4PK2A 2V77A 1DGWY 4U9ZA 2R7TA 1CT0I 2XGCA 4OIOF 1XMAA 3GFMA 3SZTA 2GAUA 4RAZA 4N9IA 1FYBA 2SGPI 2XV4S 2IS1A 3BHXA 1U6GA 2BY2A 1UVGA 3K10A 1DUXC 3BI1A 5FJ8J 3R95A 1QZZA 3RCOA 2DIPA 1MMAA 4C2MJ 2M7AA 5F64A 4Z2YA 3HOTA 3Q5FA 3IH2A 1T95A 1Z6TA 2V53A 1RESA 1UZCA 3BTLA 2XAGA 3P2FA 2PN6A 3RJPA 3VFZA 2R7OA 2VB6A 4DBQA 2VOOA 1LANA 1S7KA 3QOEA 3S1NJ 4UCNA 1TQMA 4HYEA 3IGRA 2HKOA 5EZGA 5G1ZA 3EYIA 2KCXA 3GFLA 2DA3A 1MJBA 4DNCA 1PUFA 3ISXA 5DS0A 3CC2I 2VQHA 3DU6A 1OYWA 1GHEA 2D4OA 3F8CA 3TL4X 2CV1A 4IX7A 2J9AA 5K1YA 5E3OA 1Q1VA 3OYLA 2KMUA 3PBBA 5LBQA 4MTDA 4A3KJ 1YYVA 3FDYA 3MKZA 2ODFA 2B7EA 4E70A 3NWTA 4OVOA 1J75A 3R9FA 1WWZA 4KIBA 2AFWA 4EM0B 2DMNA 2V8DA 4OWRB 1G8XA 3LQQA 4UB8C 2NS7A 4E7HA 2KJCA 2PMHA 2FBHA 2BUSA 4OAZA 4FWUA 4OINF 1IV8A 3OYEA 3BG7A 3HTUA 4BD9A 2CMPA 2W00A 2AFSA 3W6SA 3RIRA 1VQ8I 3CPAA 4RLFA 5JHFA 2E1NA 2F5IA 1TWHJ 4HG2A 5ED4A 2AE6A 2C6GA 3Q9VA 3J80K 3OOPA 2NYQA 1ZG3A 2EFNA 3HSRA 2XEFA 4C2ZA 3ABMH 4EVIA 2MLGA 5D8LB 2E5NA 4Q47A 5H20A 4FKDA 5GADJ 1S7NA 3WTVC 4NCZA 4B5PA 2L54A 1X3UA 2M1BA 4YG2F 2CYYA 3VWDA 1EA3A 3HEFA 4KISA 3DFGA 5EGOB 1F9NA 2CNSA 2F4IA 4DZPA 3A01B 3KZWA 4IQ4A 1YLFA 1R58A 3SEQA 4ZGYB 4BJTA 4ZBGA 5BQTA 3GTQJ 1N25A 2V7FA 4GXOA 2N71A 1SFEA 2ETHA 1BR1A 3GW2A 3K4CA 3PFIA 3U21A 2FJ1A 5IY5H 3L2UA 3H9QA 3BI0A 4NGSA 4B10A 5ILUA 3ISPA 1CPSA 4DYCA 5JVGF 4PXDA 2Z5UA 4UB6C 2RAEA 2DTZA 4DOZA 4IF5A 2RC4A 3MAJA 4BKXA 2F7VA 3SEKC 4F8ZA 4AIKA 2AXLA 1Z67A 4MHPA 2XPWA 1DS3I 2Q0YA 4R76A 4GCVA 3RKYA 1EH8A 4MFDA 3PNTA 4WK8F 2JUGA 1EF4A 3CCYA 3KCCA 3I55I 4UUVA 1TWGJ 4L0ZB 3VDPA 2AFZA 3H8GA 1R1TA 5C4XJ 1R43A 2UZ3A 2BHZA 1XIXA 3NFZA 3AG3H 5EBVA 4R1HA 1ZRCA 2V4JC 5E8IA 2H27A 4LQ6A 5DCFA 4HQMA 4ONUA 3E6MA 1ZG9A 4L5JA 5E1XA 2ZEPA 1V55H 2VC1A 2JQ7A 3I4NJ 2OJED 4Q38A 5FD5A 1KBFA 2DKVA 3E0JB 2YUSA 2CQ7A 3J80Z 1DPRA 3CJNA 3DKXA 3WC6A 4C3JJ 2OPTA 4YIFA 3PUBA 3W2VA 4XLPF 4HSTA 4B4CA 4KDPA 5JLXA 5FKOA 5FLXK 4NGTA 4NFRA 3C18A 4MEXF 4CCJA 2VZZA 4RM2A 4MCRA 4XPLA 2HNHA 3VH9A 2SGDI 1Z4EA 3W2AA 2H09A 3RPUD 3E2IA 3B3SA 3B3TA 3IWGA 4U88A 1ERDA 5DTDA 1LNWA 3KGQA 1XX6A 5KTAA 3R1KA 2CRGA 2LUYA 1IDZA 4CAWA 3ZCOA 2AFXA 4M9ZA 4GYIA 4AVZA 3D0SA 2POKA 1FSHA 1KUYA 4L8AA 2EPFA 3U1DA 1NG6A 3S2HJ 4KVOE 3B4VC 3R96A 1BMOA 4CZCA 3OXFA 1TWFJ 2KMQA 2L7XA 2HS5A 1G6NA 3VYSB 2WSAA 5A27A 2OTJI 1MBGA 1XD7A 3OYBA 2F6CA 1ZREA 3TC8A 3FSXA 4U9YA 1P4XA 1FBQA 3QU6A 2DI3A 1XE4A 3WTXC 2ZEMA 2DA6A 4HSRA 3CXSA 3UFFA 1YIJI 3ZGKA 4RB0A 2V9VA 4UNOA 1MBEA 2RNJA 5KHDA 3VWBA 1RXTA 4P4EA 2YNCA 1JT0A 3WABA 5FUXA 4LIVA 3CQZJ 3PB7X 4IHYA 3S14J 2IS2A 2YR2A 2HGCA 4HLYA 4P9UA 3BR0A 1F5TA 1BN5A 2UXNA 4XR6A 1O7LA 5M3MJ 3ML6A 2CFOA 3CMEI 3D5SC 5H6QA 1YO5C 1MBFA 4HPSA 3JCUC 4XIDA 2YNCC 3WGIA 3CJTB 2PJBA 3EQLF 1FTTA 3CMYA 3F8MA 5FLXZ 5AG6A 2UVOA 3UR3C 4MHYA 2Z1DA 2M2EA 2WY8Q 3BR6A 4C2UA 3T90A 2L02A 2EA2A 2IGOA 2WAFA 2GLFA 2DDAA 4UCMA 3JSPA 1MMDA 4D7NA 2X6YA 1ACIA 5F04A 1GUUA 4B3AA 2CTBA 2Q2EB 4CAXA 2X6WA 3WTTC 1R49A 4P1WA 2ZEHA 2JZMA 4Y33A 2OUMA 4UEFA 3LWUA 3LSIA 4BE0A 3DBHB 1WJCA 2DK5A 2LBFB 1HOMA 2RNGA 1NMTA 4PJNA 3OYKA 1S29A 2G3AA 5F08A 1RTQA 4HX8A 2E34A 3I54A 1EE3P 2XAJA 1IRZA 4ESFA 1F2OA 3QYFA 2ZW5A 4FX0A 1OZPA 1XGSA 3KY9A 3RYOA 3FZVA 3KYCB 2ZJ2A 4BQNA 2IJLA 3FSYA 2QJ8A 5J6XA 3FXOA 2RN7A 2HVSA 2Y48A 1S20A 4PZJA 2CQKA 3GTLJ 2LRDA 4E2AA 2IBDA 2IGNA 4B12A 1WK4A 1ZO0A 4OC2A 3R61A 2ARPF 3NAUA 3OYMA 2GBYA 2X51A 1R71A 4NQWB 4UCPA 2GLJA 3K9UA 5J1RA 4RDUA 1V5EA 1ORKA 4WJBA 1YW8A 2DA4A 2GIVA 4GO1A 4E4HA 3KR4A 5CPRB 3DV8A 2Q7BA 1RZ4A 2JRTA 1B9NA 1O4XA 5E3QA 4KA4A 4LG0A 1NK2P 3IIBA 3QAYA 4I01A 2ORVA 2K3FA 1D8KA 3R4KA 5LGTA 3IWEA 3P5JA 3ZMDA 1A6IA 3SI1A 2OC6A 2CUEA 3TOBA 4J3GA 2HYFA 3N97A 3ROUA 4UVAA 2GLOA 1FX7A 3VYTB 2VBYA 1IN5A 3B6AA 3RBUA 3FF3A 1RR7A 3DQVC 5E79C 2BO9A 4CGOA 2IA2A 4I99C 1JJ6C 4BQOA 1BR4A 1V54H 2EJRA 4V19K 5ERIA 3L2NA 2MA3A 5EMIA 3D3SA 3DR6A 2QQBA 1V1IA 2PRBA 5DD8A 1KUVA 2SGFI 4BDZA 1D8JA 1LR9A 1R79A 1O57A 5IT3A 2NS8A 3TMOA 4Q7AA 4X0GA 5LHIA 2G7HA 4CAVA 2PG4A 3WC5A 3JTHA 3FK7A 3DU5A 1YK3A 2OZUA 3RSNA 1UHAA 1VQ5I 1W5TA 1FP1D 1RUNA 3DEUA 3BPXA 4MHZA 4GGGA 3OYIA 2GQQA 1UWYA 4MJ8A 1IY5A 3BTJA 3BG5A 1LR7A 3EY5A 3RKXA 2BOAA 3SHFA 2P5KA 4BQAA 2XF5A 2IL4A 3C7JA 1KZHA 1B8IA 3VYUB 3DBRB 5M5YJ 3QODA 1XTAA 3PQJA 2WA0A 4F52A 2NVYJ 1YG2A 2G3TA 2Z11A 3ECHA 3PUFA 2M4KA 2EZHA 5AIQA 3S3NA 4MHNA 4A32A 3O8GA 3W3CA 2DXQA 2JYYA 1Z4RA 4F92B 2ZW4A 3UKGA 1DP7P 5ISVA 3K0LA 4JX6A 3FBUA 3FX6A 1W1WE 2Q44A 9ANTA 3BTIA 5K7ZA 2CUZA 3FMRA 2P0WA 3PSFA 3R0AA 1LCPA 3OL3A 3TX8A 1X12A 1K6YA 2JA1A 5CVUA 4PK4A 1M44A 3DEWA 2X4HA 3ZP5A 5C82A 2H6BA 2LREA 1UHWA 4A93J 4M73A 4KSIA 1Y0UA 2A6EF 2EZKA 1P92A 4RAYA 5EDNA 4WWCA 1Y1WJ 2E1CA 5HI7A 2GIZA 5FVJA 4YELA 3WC7A 3K9TA 1NXUA 4UIAA 3TFYA 1D0ZA 1MBJA 3X2QH 3F5BA 1Y1CA 2BVLA 2Q51A 5E3NA 4HX7A 4RGSA 5D5XB 4KN7X 1BOBA 1U0JA 5J4YA 1XGNA 4LQGA 4QVTA 2ZOFA 3K70D 2YS9A 3LSJA 1LB2A 1HDQA 2EVNA 1KQ0A 1YHQI 4EFDA 4Q36A 1Y8FA 2L9RA 1LVAA 3QOPA 4ZY0A 1D5VA 2OCCH 4ZDLA 1W36C 4JZ0A 4NXYA 2VBQA 3FISA 4HNVA 4OP4A 2Q4YA 1XG1A 3W6VA 1B1BA 1HDLA 1PUFB 1ULKA 1F2PA 1FARA 4BJ5C 2E71A 3BC8A 4BL0B 1VHEA 5F48A 2GXGA 2DA5A 3ERMA 1BW5A 4JYKA 4FD7A 1FY7A 2REEA 3LACA 4BXXJ 2Y9YA 3ELKA 3DF8A 5CCLA 2A5WA 3FB3A 3VATA 3F72A 2G9WA 2NXNB 3WG9A 2VBWA 2QQ0A 1WHUA 3CCLI 3OL0A 1CP7A 3ZJ0A 2HQ5A 5JVTA 3RTRA 5LGNA 1SFXA 4CRZB 1YI2I 3BJ6A 2NU4I 3K7AJ 2BL1A 5K7HA 1IO2A 4XLAA 1KU2A 1CT4I 2WYRA 3KHZA 3TO6A 3LFKA 5D29A 2HKXA 3IEHA 2E2IJ 2O8XA 5A28A 1ZAOA 3FKIJ 3MEKA 2AFOA 1HW1A 4KORA 2VL8A 1Z2IA 2ZXHA 1YW7A 2ID3A 4PJ0C 1EKEA 3GMEA 4EQQA 2BVMA 3IJ3A 4M74A 1LQ1A 2VKDA 1Z9CA 2DFFA 3O3KA 2CU7A 2COBA 1SEUA 1ZTRA 1S3JA 2K9NA 3S32A 1YGHA 1IUYA 4H2KA 4B5PB 4CYCA 2ME6A 3V8LA 4MO7A 1P6RA 2IJZA 3FXLA 2VE8A 2VPRA 2O7OA 2PFBA 3HIFA 4G8XA 4UXNA 4A38A 2O03A 1H0ZA 5JFRA 3H1CA 1JHHA 3JW4A 5J3LA 5IYBJ 2ZC2A 1X4SA 3P2HA 2BYVE 2KIUA 3S3OA 1X19A 5CNPA 5K8PA 1Z8WA 3BZCA 1U8RA 3CCQI 3OS2A 7CPAA 2Z16A 4BBHA 1AWCA 3P7NA 1MMNA 5G22A 3N5FA 2LFBA 2XPVA 2PJ5A 5AGEA 5JQ4A 1FOXA 3H0GJ 4P4FA 2CO5A 2ZEFA 3R5BA 3WTUC 4ENKA 4GS4A 2K5CA 5F0HA 4EV0A 3DGVA 3B35A 4DIQA 5H2FC 2G0BA 5GTIC 2M34A 4YIIA 3GO5A 4AB7A 3E5QA 2X52A 1HW2A 3PL8A 1SGYI 2XEIA 1T2KA 5BNGA 1IIDA 4CAEA 3OIPA 2B3UA 1XF8A 2WVJA 4RLQA 4NGQA 2HYGD 5TJJA 4YRHA 3V7CA 2ZMEA 3KZIC 3G4SI 2EQRA 1MK4A 1FT9A 4B11A 4UBRA 1YFHA 1D0XA 2KRHA 1TKHA 2NAZA 5K5OA 2P4WA 3BTCA 4ZZDA 1MKMA 1CF7A 4IAVA 2OZGA 2OV7A 4ZTJA 3PFEA 2KHMA 3Q9SA 2QKMB 4JD6A 1XGMA 4D7MA 3FHNA 2QMLA 3DWLE 2IAIA 1X1BA 4IRGA 1K7AA 2ZMEC 2R7UA 1R6RA 5CKTA 3F8KA 4ZX8A 4F9VA 1OBRA 1S7LA 3O2PE 1B87A 2DPTA 1AOYA 2WY7Q 4L9JA 4MPIA 2B5GA 4L9TA 3OVOA 5EEGA 2RDPA 2H8RA 2KL4A 4S05A 4BBRJ 1P4WA 3CCSI 2PQ8A 1OFCX 4XICA 1BI2A 3JTKA 1P9GA 1IYKA 1TF9A 3G2BA 2C1CA 2ARHA 3KLNA 2HQAA 1WQ2A 4H0EA 4IO9F 5B66C 9WGAA 2NNNA 2MG4A 4EJOA 1O3RA 1YMEA 3Q0UA 2FBIA 2XAHA 2I3CA 1HLVA 1XA6A 3PB9X 3MKWB 4D9JA 1L0CA 3SXOA 4BHPA 1YRNA 1BIBA 3MD2A 3TGNA 5IYDJ 5EJCA 4ASNA 3K1MA 3ZRGA 1R57A 4MCPA 2O0YA 4XN0A 4PJMA 2KMOA 5FROA 1TC3C 3D4UA 1SD6A 4M6GA 3W2WA 2BGCA 2RQPA 1ZQ3P 5J1UA 4NHJA 2E35A 3H36A 3QP5A 3QPHA 2MC3A 4O23A 3TT2A 3FMSA 4HV5A 4OIWA 1IXCA 3DTEA 3A9LA 2EV5A 3LOCA 3TKYA 3F6OA 2LEOA 1F57A 3WTYC 2ERWA 2MH9A 4BINA 1TBRR 1EH7A 4I7HA 2PX9A 2ZEEA 4CS0B 3UGIA 2CQXA 4H4KC 5LRRA 4BU2A 5IB9A 1MD0A 4CYNA 4JBAA 1UG0A 4F7ZA 1YW9A 2NVXJ 4DQ2A 2A6TA 1K78A 3D2MA 2ANPA 3B3WA 3ZN1A 4M85A 5F0FA 1OLTA 4PQAA 3VDUA 3HRUA 2K4JA 2IS6A 1XPXA 2M5WA 4NC7A 1KUXA 3FK6A 1S8NA 2P6TA 2W7NA 1MDMB 3CTAA 2LC2A 3QYBA 3ZN0A 2DN0A 2F48A 5K8OA 1Z1DA 1VHOA 3BP8A 3CC4I 4HLXA 1ZH5A 1HKTA 4P55A 1KU7A 1A2ZA 2WGCA 1WFXA 1SC7A 3GB0A 3J7YJ 4FT8A 2DFIA 5J40A 2TDXA 3ZQGA 2ZFWA 2EZIA 2EWBA 1RPWA 1WH5A 7WGAA 4NUBA 4IQJA 3UNGC 1I1DA 2PJ3A 2WV0A 5GCNA 4L9VA 2FIAA 1J7KA 2ENNA 4PXCA 2WAQN 2PR8A 2LNBA 2MD5A 2ZXJA 3A02A 3E0KA 5LRGA 4A3IJ 2VXKA 1QSNA 5K8MA 2I10A 2X6OA 4V2GA 4PJLA 3OSFA 2HZDA 4Q4ZF 2DTRA 1T39A 1Z2LA 4XL9A 1IZ1A 2JA8J 4HDUA 3LFUA 4CO8A 3QB8A 4XLFA 4LG0B 4BBSJ 4DW6A 2HFHA 1QNTA 3V8JA 4MFPA 2M30A 3PFYA 5HOOA 5GPCA 1VQLI 3OV8A 1I50J 4MFKA 4QBJA 4YIRX 2FE3A 4OOIA 1IN8A 4EWTA 1HEVA 1SANA 4JLYA 2ELKA 5DWMA 4OIDA 2WC2A 2H94A 2L2OA 3HGYA 3NRVA 4O6JA 1P9QC 2E7WA 4UV8A 3KYLA 3ERED 3QWPA 2PJ7A 1WH7A 2ZNYA 3AG2H 1YX3A 1FMVA 2OF7A 3CCRI 3FXUA 4Y52J 4ZYHA 2FNFX 2X6XA 2LY2A 4U0VA 1ON0A 4I0AA 5JPHA 5IT9K 2YPRA 1TBOA 1LOKA 3O8HA 5KCMA 2OH1A 1YE9A 2R8VA 2XB5A 1CP6A 1I21A 1Y0RA 4BQQA 2KPMA 1GHCA 4XKVA 3NH5A 4C7HA 1WJFA 4PSXA 1MNMC 4KJZA 4LD5A 1UAAA 2RKHA 2EILH 3KP6A 1CX8A 5I4MA 1R5HA 3MWMA 5FKMA 5ICFA 3K4BA 4IOCF 2O8KA 2R92J 2F8HA 2JN6A 3QYEA 4DJAA 3NE8A 4XSZF 1S5LC 1JKRC 1LJ9A 2OBPA 1VIXA 4BGDA 4A3MJ 4CGLA 3OR1C 3BG9A 3ZQIA 2QLZA 4AUXA 1PJRA 2VONA 4DYOA 1LUJB 1PJUA 4A39A 5L3FA 5KTDA 1SQHA 3GWZA 1KMAA 5HLTA 3HDDA 4ON0A 4C9YA 3LA3A 1J4JA 4NGPA 2QIRA 1SGQI 4A24A 4G7OF 4YFXF 2Q8KA 1M4IA 4AVPA 1A31A 2J5PA 5HLGA 2RFHA 2LDUA 1SFKA 3RNZA 3CCEI 4KSFA 1ZELA 2ELJA 5EC4A 3S9NA 5LYFA 3B02A 2EFOA 3GVAA 2VOPA 5GTHC 3HYIA 5C88A 2K4BA 1U6MA 2ECBA 2NU1I 4XPKA 1POGA 2W84A 2RVCA 3U1KA 2VUMJ 2LF8A 3WTZA 2GU2A 5DUKA 2BBYA 2BUEA 3K4LA 1CG2A 3HSFA 3M8FA 1XEBA 4AIJA 2AQEA 4A3FJ 1H89C 1P2FA 1U2WA 1RR8C 3GEZA 4C68A 3REOA 1BA5A 1BOAA 4A3BJ 3DDDA 1B59A 2E73A 1ETQA 1MBHA 4XNFA 5IT9Z 3WHCA 1OMTA 4WP4A 2ABZA 4ZI6A 1CJWA 3CDLA 4KYWA 2O3FA 4G7ZF 3PO3J 3SHPA 1CBXA 1NG7A 4U5YA 1J2XA 1WGTA 4XPDB 5FRNA 2GM4A 5G21A 1Y9KA 2MLKA 3H5RA 2JVHA 1IN7A 2KKOA 3JRHA 5GAHJ 3JRBA 1U3EM 4M6HA 3H3UA 3OXLA 3W91A 4WXDA 3DBLB 1WJ5A 3PRTA 3GLJA 1XMTA 4X1EA 4CICA 4NB5A 5M5XJ 1M1DA 1NH3A 1L0OC 5LRSA 2PJ9A 4BY7J 4HGUA 3DLJA 5AG7A 3GBGA 1BL0A 3ZQHA 2OOTA 5HVGA 1GXQA 2JZYA 3IV5A 1RO5A 1USSA 2CW8A 2LOOA 3OS0A 1H9GA 2JXDA 1PTQA 1Y1BA 3HOWJ 2WPXA 5LYIA 2Q0OA 3HHHA 2AO9A 1X3WB 3E6BA 3WE2A 2D45A 2K40A 2QZ8A 3FIWA 3HKZA 1R4NB 5A2QK 1WTJA 4AVAA 3G73A 5E1ZB 4IRIA 2QSHX 3GIUA 4IUSA 3R5AA 4MXUA 3NH4A 3N4MA 1QO0D 1JUSA 2ICWG 1NSAA 3V8IA 2VT3A 2FT0A 1HXDA 3CO6C 2DOAA 1PYVA 4CA0A 1XMBA 3OL4A 1Y56A 4NSQA 2UZKA 4XLEA 1LE8B 3DXJF 1RRJA 2O9LA 1TKFA 4X6AJ 4CYCB 1Q2YA 2PC1A 4MGRA 2DPUA 3IO1A 4P5OA 1ON1A 2QGUA 2DA2A 4BHCA 2HR3A 3F23A 3Q0VA 3A4CA 4XKWA 3J7AO 2GKTI 2QQ8A 2UV1A 1UHMA 4A33A 2DU9A 1YOVB 2AS5F 2OA4A 1HDPA 4UUTA 2Y0SA 1G3YA 2KP6A 3LSPA 4KOTA 3P9IA 2QM3A 2XSJC 4WXCA 2HXIA 4MMOA 2P5VA 3ABLH 4XORA 3ZMZA 3N05A 1OJLA 3U9GA 4G6DA 2PVVA 4UXHA 1VZ0A 2ENZA 5JH9A 1KQ9A 4AU7A 4BY1J 2MGQA 1AA7A 5BS6A 2HV2A 2ZBKA 3C2BA 5EG0A 1XB4A 1FIAA 2B4DA 2BY0A 1HA8A 1UHSA 2BEIA 2XPUA 2EO8A 1MSFC 4B13A 3NQOA 4P4BA 1XFOA 1JHFA 4PXBA 4LG3A 2KDOA 4UHTA 1QMUA 4HX4A 5HNFA 3S6GA 3I4PA 1HSJA 2ZMEB 4K2EA 2NSMA 1IW7F 4B1RA 2NU0I 4RB3C 1RI7A 6PAXA 3UGLA 1WKMA 1V5FA 1CF7B 2IT0A 3PGPA 2OQRA 5A2QZ 5CYVA 5D5UB 1QSRA 3RPQA 4XOTA 4E7ZA 3LSGA 3JREA 2IGMA 2JEVA 1X10A 2F5CA 5HLIA 1ARMA 1MT1A 2C27A 1QVTA 1EH6A 3WU2C 5KK1A 1MGTA 1WPKA 1M8BA 1VHSA 4A6DA 4F3QA 1SGEI 2GOMA 2KCWA 4A2UA 2H1KA 4ZDOA 1BPMA 2B5GB 3LMSA 2WADA 5E8GA 1YW4A 4QLCU 3C1DA 2JPBA 3N7ZA 2AXTC 4OMYA 2VQCA 3PIPF 3PM1A 1IY7A 1TNSA 3G1MA 1Z9UA 4F0YA 3FXMA 1L3LA 2ROWA 1ZN2A 4MIMA 1OCPA 4CGZA 5CPAA 2BCOA 2Z3PA 2F5VA 1OYIA 1XRYA 3OYFA 2Q1ZB 2F5DA 2CIJA 3OWCA 1JTYA 4FHTA 2IPQX 4QSHA 1W4MA 1ODDA 1VI0A 5C44J 2IQ6A 3FNCA 4KUMA 3FXKA 2LY9A 3JRAA 2F4MB 1IJWC 2C6YA 2VODA 2J8MA 2R5ZA 2M8GX 1WJEA 1Q7LA 3D7HA 1YVOA 3T8RA 2VJ5A 2HZTA 2YX4A 1N77A 1YRNB 3SXNA 2FRHA 3ASNH 1O3SA 2ZEDA 5D6FA 2NVUB 3ECOA 2XVCA 3R0JA 3S6HA 4RGUA 4F55A 3FC3A 2FCKA 3CXPA 3GUDA 1MMGA 4EMSA 1Y0NA 2V1CA 3S3MA 4B43A 3F6VA 2W4SA 3OIOA 1YITI 1N78A 6CPAA 3UOEA 2EIKH 1FLIA 3LNQA 4KOUA 2QWWA 3I71A 2YUUA 3CZXA 2I00A 1S6LA 4BACA 1TBQR 4F0XA 4FQGA 2X3TA 3D66A 1J09A 1TWCJ 3CF5F 2CNMA 5L3CA 4XQFA 3HOXJ 3CC7I 2V1CC 3AL0C 3FECA 4R8HA 2VL1A 1TBXA 2RV8A 1TT0A 3FXJA 3DEEA 5LYDA 2ZFUA 1Y8RB 3V7RA 2L8EA 1U9NA 4U87A 3OWTA 1K78B 4FASD 2LSOA 3PQKA 4ZDPA 3ZMSA 4O3MA 2BSWA 5HODA 1BJAA 2H1LA 4AD9A 3P9CA 4HV6A 4L5IA 3PO2J 5DS9A 1AN1I 3E97A 4XLCA 2Z3KA 2FMLA 3DPUA 1YW6A 1P7JA 2VN2A 3MKLA 3JAMK 2E7XA 4IL6C 1LFWA 4F9UA 2DK8A 1WJBA 2ZB9A 4CYDA 2CV2A 3GTPJ 1MIJA 4MFZA 4M6XA 2Z33A 4CAFA 2Z99A 3FM3A 2L5QA 3VSKA 1PPFI 3LODA 4UFXA 4A0XA 2L01A 3QNVA 1SGRI 3VODA 2DODA 3MGDA 1A6QA 2COMA 4GXHA 1U5TA 5HNHA 2O6GE 2FOKA 1BAVA 1JUMA 3FHZA 1HF0A 1GYTA 4G94A 1Z3XA 1LR8A 3S1MJ 3JR9A 1ZRDA 2EK5A 4KOYA 2D5VA 2HDWA 3JSOA 2A4NA 2Q04A 3DPLC 1GDTA 4B3XA 1U5TC 2PJ0A 1WWXA 5EEAA 2FU4A 3CLQA 1QQ9A 2IXSA 4KZTA 1WRJA 4NGRA 4E7KA 1D0YA 4A3DJ 3FEDA 2DO7A 2V9KA 2K9LA 1TW3A 4KVXA 3CD6I 2K9QA 2NOGA 3S1RJ 3BR5A 3D2PA 3M7GA 2BHYA 2BY3A 4I09A 2NRAC 1R1VA 2OR4A 1HEEA 2QSGX 2IS4A 1B9MA 2V8GA 3CDIA 1R0RI 4CUGA 3QQAA 4F91B 4P44A 4E7SA 3FBNB 2Z2SB 4UA3A 1BM9A 3VARA 3HUGA 2JLMA 3TQNA 1LKXA 3ZMVA 4C2XA 3K6GA 3R9GA 3I9SA 2ZW7A 3C2HA 3HOZJ 2QUFA 3T0YA 2EIMH 4E1PA 3JRGA 4P4DA 2STTA 2R5YA 3KI9A 1WCMJ 3IHUA 4O5VA 4KFCA 1HJAI 3B3CA 4OC1A 1FIPA 2A5YB 1E0EA 3SFIA 3CP2A 4UV9A 4NC8A 5E3PA 3BLNA 3CZ6A 3JVNA 1JWQA 4E8OA 1I6HJ 3JAMZ 1ZK8A 3IKVA 1ETXA 4AC0A 4KITB 4S04A 1IW4A 4AM3A 1LRZA 1S3ZA 3I5UA 3LAPA 2CG4A 2G0EA 5KAFC 2PR1A 4SGBI 5LLQA 1YVKA 3RAMA 3PJRA 2OB0A 1FC3A 2CH0A 2R7FA 4M3BA 3CXLA 1E3HA 1WI3A 1KU9A 1VDDA 1YR0A 4ZZLA 5HMNA 2BW3A 1G3WA 1OVOA 4A2ZA 1OCTC 3R5CA 1BO4A 2L9NA 3LA2A 4CCNA 2OU2A 1FYMA 2GKRI 2K3PA 2ZSIB 2Y69H 1JI8A 4C2YA 2FF4A 1KYWA 2JA2A 3DKYA 5LHGA 1G4DA 2DOEA 4UIBA 1XCVA 1VGYA 2KT0A 1YIOA 4NJRA 5CQGA 3M3YJ 2DXIA 3RQIA 4OIQF 4YWYA 3KL9A 4I02A 3B3VA 3NA6A 4JWPA 4UXJA 3H9JA 1X3ZB 2DFHA 2XKOA 3DNSA 3F0AA 5IB0A 2AFMA 2VKHA 4CXFA 2DLLA 4PDKA 3BOQA 2EBJA 3UGDA 2LD5A 2OTLI 2NYXA 3RQ4A 5J4VA 1OYVI 1T08B 4ESBA 1S60A 1UFMA 4M3GA 5ICEA 2CUFA 4UFWA 2HOAA 3MEXA 3S16J 2K7LA 1XN7A 3I58A 1K61A 2V8HA 3BROA 2BXZA 3W6KB 3WE3A 1Y0YA 4UF4A 4ZYGA 4MTEA 1BJZA 2DA7A 4CCOA 2PDOA 4IHMA 4P45A 3TDUC 1SGNI 4OIRF 4IHXA 1YU6C 1SFUA 1JKPC 2VQLA 2PJAA 1LVKA 5EEHA 1MNEA 2DJIA 5C4JJ 5D8KB 1YTYA 4TV7A 3CMAI 3CCVI 2DA1A 2YSRA 2EK9A 1LFBA 1VQ6I 2ESHA 3M9AA 3GUXA 1TP4A 3RZAA 2KLOA 3S15J 1JTXA 2JSCA 2R0QC 3D00A 4I76A 1K4JA 4NBQA 3L2WA 2R7XA 4RAGA 3SGBI 2JBKA 1Z8LA 4B14A 3FKJA 5HQ8A 4HDVA 5GAEJ 3KE2A 5IOZA 3HOVJ 4MY3A 4MBUA 4CCMA 1B72A 2JJ7A 2YX7A 1E17A 1ZR4A 2FXFA 2MW8A 4R87A 2HXOA 2VC0A 5CQEA 2LF7A 4CPAA 2E1MC 1MJAA 1WSUA 1J5YA 2PJPA 3OR2C 3DTKA 5LD2C 2UUZA 3T9YA 5HLHA 4BHBA 2DF5A 3V38A 4A3JJ 3I53A 1BI3A 1IU8A 2ADUA 2MH2A 4MNUA 1H88C 1RC9A 2DYRH 1HDUA 3GLLA 3SJMA 2Q43A 2A69F 1ZG5A 1DS2I 2JA6J 4TWEA 1OR7A 2WAEA 3SZGA 4Y7NJ 3AAFA 3LQRA 4DBRA 3NE7A 1XMXA 2ORWA 2O53A 3ZOBA 2QQEA 3K2AA 3ABKH 3D68A 2B9SA 4Z65A 3BWGA 3H92A 1UB9A 3G6EI 2ZJRF 1S5KA 2C6PA 1KBEA 1TZLA 1WZ2A 4B47A 4HAMA 3JRIA 2L7MP 1I3QJ 2Z10A 1OR7C 1TW2A 2QEXI 1PDNC 2PRQA 1YX0A 2ZENA 4PK3A 1X1DA 4KMFA 4OAYA 3PEIA 2K85A 4P10A 3SZPA 3I3GA 3BG3A 5D5VB 1FYKA 3S2DJ 2RQQA 1XCBA 1YJWI 2MYSA 2WUUA 3KLOA 3PZJA 4LITA 4A5NA 3L00A 4BE1A 1GVJA 4CYOA 2P7VB 2EB7A 1LDDA 2Y2ZA 4LUAA 3ZZIA 4RUHA 1HCRA 1XOVA 1MH3A 5FUYA 3GTGJ 5C3EJ 3HOSA 3TW6A 1AHDP 1T56A 2H8WA 3DTIA 4R79A 4L89A 3S6FA 5JGFA 3S93A 3NH8A 1ENHA 5DUIA 2HI3A 4EM2A 1A35A 2YU9J 2B0UC 4KT6A 5F0CA 3IKTA 1DP3A 4D1QA 4DUKA 2PJ2A 3KR5A 2NNYA 5KTCA 1DGRM 2GKVA 2V26A 1SFOJ 1GV5A 3D67A 2DMPA 3D7GA 4HKFA 4M6IA 2CWEA 3J7ZI 2ACJA 2LVSA 4QWQA 5CVJA 4QUSA 1SGDI 3E5XA 2VJ4A 2GXAA 2XSDC 1H0MA 1OMIA 2HPMA 2B4DB 2XHKA 2ZSHB 3QAHA 1T8IA 2VBZA 3TW7A 4YFNF 3PSIA 4RI1A 1FBSA 4FE4A 4NC6A 3P9KA 1NUBA 4HQEA 5GAGJ 1E3PA 5BPDA 2PJ6A 5EX0A 3IH4A 1JE8A 1X74A 1Y8QB 2HEOA 5LRJA 3S6KA 2ZXIA 2LG4A 3L1PA 5LYLA 3G71I 4ENJA 2DW4A 3A1YA 4D5CA 5HDNA 3E3VA 2R93J 1AU7A 3JTGA 1GT0C 2F5EA 3TO7A 2HOEA 2FQ3A 2A61A 2XGEA 3I64A 4NNJA 1DQUA 2I5UA 5IPAA 1SD7A 1KONA 1E3OC 3GKRA 1U9OA 2A68F 4I49A 4NF1A 5FB2A 4AMLA 4CCLA 4GDFA 3HGGA 3MMYB 3LWFA 2CQQA 1UFHA 1SVLA 1YS6A 4CSWA 1Z05A 2J8RA 2VBXA 2PSWA 5FFXA 4OC4A 4FTHA 5IOYA 1BIAA 2L4MA 3FMCA 3IP4B 1IN6A 1AMPA 4I98B 2V1UA 5HH1A 5FUWA 4LX9A 3ASOH 5DCMA 2R7WA 2HC9A 2M4GA 3E59A 4NJQA 1Z91A 3GLXA 1IF1A 3TTHA 4XONA 3F21A 2K27A 4XN3A 3VYRB 3VEPA 4B44A 4G7HF 3ZQCA 3WGGA 1FT7A 4FD6A 1OISA 4RAFA 1V1HA 2LY1A 2Z9OA 2R5ZB 2QQ9A 3I0TA 2V1NA 4L0YB 4RB1A 1JXSA 4BAYA 2ZJPF 4ZYDA 1IOIA 1UMQA 3MZYA 1JGGA 2XDVA 4DJLA 3RDIA 2R1IA 5DWNA 1HDDC 1ELLP 3OMYA 2QF7A 3HM5A 2LR8A 4KNYA 1TTYA 1CSOI 4IRHA 1AYEA 1S7FA 4OC3A 1Y39A 3B7IA 2Y75A 5CVRA 3AL0B 4ZYQA 4OLLA 2R3SA 4J19A 1J9IA 3VDXA 3RU0A 3AFHA 3T5XA 2LKXA 2VASA 2PJ1A 2F5FA 3PIOF 2GA2A 4ESJA 1UCRA 2V1DA 3OYDA 1FTZA 3KIOA 1H8AC 5JM6A 1FWZA 3PNVA 5DYMA 5HDGA 4L18B 5FD6A 1V3FA 2JSPA 4QIWN 1FOYA 3EC4A 1BW6A 5AG4A 1JQGA 1SMTA 2W82A 2P6EA 2ESNA 3QP6A 1OMUA 2CWHA 2NU2I 4H6UA 4XKCA 5LGUA 4R9MA 3RZDJ 2QPOA 5FKNA 2KIFA 2LBFA 4MFQA 3JUWA 3HPGA 2AJ6A 1K79A 3VB2A 4QTRA 2PLYA 4PXEA 4EGYA 4AG7A 1Y6IA 2DB6A 3OIQA 2N52A 4N0BA 4HNXB 3OYNA 2B58A 2CSOA 2OD5A 2MBFA 2XEGA 2DFEA 2OZ6A 2HVRA 4YRVA 4NGNA 2PMZN 3BZ6A 2EV0A 3C2GA 4Y49C 2A05A 4AIHA 3CDXA 3SFZA 4E7JA 2GANA 4PGGA 2E36A 1ZGWA 1F4KA 3QTLD 2PJ8A 3IU1A 3HHGA 1RUOA 1U5TB 1QU3A 3RO0A 4AG9A 1Z6RA 2OAZA 4N4OB 2BZTA 2XAFA 5CVVA 3WGHA 4HNTA 1HSTA 2STWA 2WCYA 3WR7A 3F3XA 3M1CA 4OMZA 4EJVA 2VI7A 4W9YA 4BUPA 2GXBA 5DEQA 2N8GA 3E6DA 2PIYA 1OQYA 3RKWA 4C3HJ 2HQNA 4BEHA 3M8EA 4RA2A 4ZYAA 3TDZC 2YGWA 4CYQA 3R5DA 3MN2A 1D5YA 2V8VA 3LSKA 4Q48A 2VXDA 3VOEA 2SGQI 3H5ZA 5F49A 2GVIA 3EUKL 2N1AB 2GREA 3PB8X 2DDBA 1YQEA 2QKLB 3BDDA 1QRYA 2KMRA 4H6ZA 1PCEA 1BUSA 4UXIA 1CPXA 3D8PA 5HS9A 3A03A 3BPVA 2WWYA 3CCMI 1BR2A 3B6CA 3EYYA 1LEBA 1ULMA 4R3KA 1XJOA 4WX9A 2DPSA 2KFDA 3V7ZA 3PNYA 3AG1H 1W0UA 2Z0ZA 5L3BA 1ZLHA 2Z3OA 4YFKF 4U7DA 2WBMA 3HUGB 4UFVA 1UUCA 4JP0A 3NEUA 2FD5A 4HOBA 2R5YB 1QSMA 2EV6A 1K83J 4AWXB 1TL8A 2YQPA 4AIDA 1D3YA 1W5SA 1BLLE 4A0YA 4L5EA 1QGPA 1SGPI 1B8IB 1YTPA 3T1BA 3ZPLA 3BR1A 4MCQA 2X48A 2E5RA 1FOKA 3A0BC 1YLEA 1IAWA 1VNDA 2JMWA 4A0ZA 1GV2A 1G2HA 4J00A 3KP7A 3F8NA 1IGBA 3OY9A 3IRRA 3BLYA 3CT9A 2MFZA 4MFJA 3V42A 1XSXA 5BOXA 1SMYF 2BW3B 2ZW6A 4XBFA 3HUVA 4HW0A 1YQAA 4D0PA 3KPHA 3KYDB 1CM0A 2Z3NA 2LB7A 4G9YA 4I6ZA 2E1OA 4EJUA 3W6JB 4DYRA 3SXYA 3BJIA 4FX4A 3EFAA 2JK3A 1TWAJ 1SAXA 1H8LA 5F6FA 1W7PA 3HOYJ 3EO4A 2W25A 2B4BA 3B73A 3CJQB 1D1AA 3EETA 3BT9A 4Y13A 5J8CA 4XK4A 4M3DA 2E19A 1R36A 2XC7A 1R9TJ 1QZEA 5JHWC 1I6XA 3BQYA 3FWEA 3G1LA 5ILSA 1A5JA 3HLPA 4RB2C 1ZGAA 2XAUA 3BR2A 3IUOA 4EEFG 5THWA 4XOPA 3WG7H 4RGRA 5K8NA 2GFQA 1IXSB 1BBYA 1Z0XA 4XRSG 1I1GA 2JTVA 5BPIA 1YJ9I 3F22A 4B6DA 2KISA 4AYBN 3SJGA 2HQYA 3G3SA 4XNHC 5M5WJ 4X5KA 3M4OJ 4A69C 4PSWA 2FS5A 3PFOA 1S72I 2CS3A 3PB4X 4MQ9F 2IA1A 3KP4A 4P4JA 5CJ9A 3WODF 3L2RA 2O5RA 2QECA 2ZXVA 2JA7J 4W97A 1JUPA 5IP6A 1XBTA 3H8FA 4ORFA 8CPAA 4L9NA 5LEKA 2W1OA 4A6EA 4IOAF 4LIUA 1TXRA 2KZVA 5AG5A 2BY1A 5L3GA 3SI2A 1ITYA 2PJCA 3DCFA 1N13A 4NGMA 1IRFA 1AKHA 2XB0X 2Z3YA 4P6YA 5EYRA 5E17F 1FSEA 2KJBA 2ZXWH 3ZR8X 5E18F 3FRMA 1KYZA 2MSYA 3GXOA 3KFWX 4UVCA 5D4RA 2FOWA 1FZPB 2HTSA 3M8JA 2VXZA 2Y0MA 2VT2A 2PMZA 2WAQA 4PUSA 2M3AA 2E1MB 2GZWA 1IC8A 4EJTA 3GF2A 3DKWA 1Q2DA 2J9RA 4C3IJ 3PDNA 2H5MA 2ODDA 3U2RA 1Y7RA 1MJ9A 2NVQJ 1KQ8A 3EPZA 2K02A 3LA7A 1B72B 4Q5SF 4N4NB 2A3SA 3I59A 3T8TA 2V6EA 2WTEA 4R57A 1HW5A 3JRCA 3VSLA 5JLWA 2WB1N 3SGQI 2EIJH 3FEEA 5B1AH 4XMYA 4BMHA 4QPOA 4ZYEA 4M72A 2OCEA 2PJRA 1SVOA 5JR3A 4FUUA 1HQCA 3OYCA 4YGOA 3TP3A 3V7SA 2LYCA 5ICGA 3L09A 2ELIA 2XRCA 4II3A 3H3VK 3FVLA 2QENA 3KP2A 3ONQA 2F3CI 1T33A 2VKEA 2HDCA 5DD4A 3NARA 5HS7A 1WVRA 2UXXA 3FXRA 2REFA 5HVFA 1VQMI 1LDJA 1W36D 4ANJA 1YS7A 4BH9A 2DBBA 1I1SA 4MHGA 1FNOA 1HKSA 4MLOA 5FUVA 1STZA 2C6CA 3S1QJ 5LFAA 4LMYA 1OYYA 1V5GA 4DGWB 2SGEI 4UWIA 2R7DA 1ZARA 1OCZH 1BPNA 1QA6A 2AHQA 4A37A 1TQIA 1X1AA 3TJQA 1QVUA 4CGNA 4II2A 2FX0A 3FIXA 2DAOA 2M87A 2X1DA 4F93B 2I79A 2L7KA 3WU1B 1GXPA 2P5LC 3V4GA 5HVHA 2W0TA 4IEJA 2FSRA 2Z3LA 3BY6A 1SD4A 2ZPAA 5H84A 4JYWA 5D4SA 4JXQA 2EINH 2Q4VA 1Z3YA 5HVQC 1BC7C 2GE3A 2TCTA 3TE4A 2IMOA 1FP2A 2NS0A 5E1WA 2CWGA 3LL7A 4LLGF 3RYPA 5DM7F 2RB7A 3GCMA 3AKZA 5K5RA 2ZO4A 1N75A 4IVNA 3GZ6A 1LFUP 2M9HA 3JRUA 3CESA 1U78A 3KP3A 3DSBA 3VWEA 4A94A 1UVFA 2CUJA 3D7DA 4RN7A 3CCUI 4K3NA 2V1XA 4CGPA 3FBIB 1FJLA 1ETOA 3E1SA 3SEZA 3CUOA 4QC6A 1ZLKA 4FISA 3PBEA 2YNDA 4WCGA 2QBYA 3AG4H 3H4QA 2OZHA 1MSEC 1QPIA 4HRIA 3S8PA 3ZQQA 4RS2A 1KZFA 2JPCA 1U5KA 4C30A 1PU9A 4Y3OA 1PTRA 1MZBA 2VJIA 2KIQA 2HU9A 4OADA 1S7OA 1ZG7A 4LB6B 1B6BA 1KGSA 1R23A 3DPTA 3J81K 2PE3A 4KOXA 4R7MA 1I12A 4YU9A 2BV6A 1JKOC 1JGSA 3CF2A 4H89A 4AYBA 4WXHA 4YEJA 3H9GA 2XF7A 1S7AA 3FH4A 4B8XA 4HNWB 3HBLA 5TISC 2VRWB 2VQYA 1RIOH 5TGTA 2FA5A 3BJ8A 4AVCA 1R00A 2P6SA 4MRIA 2ZOGA 3V8KA 3HG9A 1WJAA 2M5XA 5D5WB 3K4NA 4IXAA 4LK1F 1X4PA 2ELHA 1M8CA 2PIZA 1C0WA 1HKQA 2QYOA 4BNCA 3MFKA 3I9V2 5DCMB 2OQGA 2XKPA 4KMUX 2Y9ZA 3D1NI 2NMTA 1ZLJA 1D1BA 5BWAB 4E0AA 2PCUA 1ZYRF 1TGSI 1P4AA 4R3LA 4DYQA 3LSRA 1PUEE 1DPUA 4JOMA 1FYLA 5E3RA 3MRUA 1TKJA 2X85A 4OIPF 4BJ6C 4B6ZA 1KA8A 2CJSC 3BG6A 1CGPA 1VF9A 1WJDA 3CUQA 4XRFA 1APLC 3ZQFA 1IGNA 3L2CA 3IU2A 4KUAA 2XEJA 3MQ0A 1VTNC 1P0HA 2VE9A 4FD4A 2L7FP 2VPLA 3WT4A 4CRYB 2XRNA 5H6RA 2K86A 3GFJA
chains in the Genus database with same CATH topology
3BJOA 4HNYB 3QRFF 4P9FA 4UWJA 3CUQC 4KIGA 2PI0A 4GYGA 4JXRA 1Q1HA 3J81Z 3HTSB 2ISYA 4FD5A 2L3DA 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 4KOVA 4OU0A 5E20A 2W85A 4Y49B 1NE9A 5IX3A 3DP7A 2L4AA 4IJAA 2CW0F 1T0FA 1LEAA 2CY2A 4CHUA 2FL4A 3E6CC 1A04A 1XGOA 1ZRFA 4MEYF 4OAEA 4KS9A 2B3VA 3H3ZA 4PCQA 1BI1A 1QBJA 2P6GA 4B5OA 5E96A 4HZFA 4Y17A 4M3SA 4U7BA 4PGHA 1E2XA 4MY0A 2W24A 4ENMA 4KOSA 4F6AA 1KU3A 4IF4A 1ON2A 4N9HA 2IW5A 1V4RA 3GX4X 4KLVA 1R7JA 2PBIA 3KEQA 4LLLA 3CXQA 1Z7UA 2DQRA 2G7UA 1ZHFA 5D6EA 2P8TA 2HUZA 2XUBA 4C68A 4KICA 4ETSA 1IXRC 4QB9A 5IV0A 4EVYA 1FNNA 4MI4A 3ABUA 1IB1E 1N71A 4RGXA 3EDPA 1IN4A 1IICA 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 4A95A 1G3SA 4PV6A 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 3K69A 1G3TA 3FXQA 3KKWA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 4P96A 3SQNA 5CVIA 1XSDA 2UWMA 2XGXA 3CO7C 5CLSA 1W7PB 3MCZA 4IPAA 1ZGJA 4XNHB 1T38A 5JHUA 4MHDA 4A31A 3IWZA 4KLWA 2FSWA 5J8FA 1RNLA 1USTA 5F46A 4RS8A 2D1VA 2J8NA 3K1NA 4EGZA 1NHAA 3KZYA 3EXNA 4U0YA 1QSOA 1EV7A 4KN4X 5HDKA 1REPC 5I0CA 3KP5A 3COAC 4U0WA 3BJAA 3LAJA 3W6XA 5FFZA 4XPDC 1O3TA 2B0LA 1R5GA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4EM1A 3KETA 1ZREA 1B6AA 5L3DA 2O61A 2FNPA 3G3ZA 3MZHA 2EWNA 3RPUA 2PEXA 2IP2A 1I5ZA 5DV5A 4K30A 3I59B 2DPDA 2FBKA 2J5OA 2YNEA 1ZG1A 2R98A 5ICCA 1XDSA 1YREA 1O3QA 1NSLA 2FE7A 1W7PD 1XMKA 3HRSA 1V0CA 5AONA 5F47A 1PUAA 4NEXA 3F8FA 5ILVA 4WF2A 1OPCA 4BXUA 4M71A 3LSTA 3HRMA 2GA1A 3B8GA 1TLHB 2A07F