1CT0I

Crystal structure of the omtky3 p1 variant omtky3-ser18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTSEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct0I00
5JHWC 2OVOA 1MT1A 2LEOA 2ERWA 2N71A 1SGNI 2QQDA 2V53A 1M8CA 1YU6C 3SGBI 2KMRA 1DS2I 1OVOA 1IY5A 4HGUA 2GKRI 2JXDA 1UVFA 2KCXA 2NU3I 2M5XA 4OVOA 1OYVI 1LR7A 1TURA 2NU2I 1TUSA 3SEKC 2SGQI 1KMAA 1OMTA 1SGYI 2N52A 2P6AC 1PJUA 2SGDI 2F3CI 1PPFI 3QTLD 2GKVA 4GI3C 5DAEA 1CT2I 3SGQI 1YTPA 1UVGA 2SGPI 3B4VC 1SGRI 2XRCA 1CE3A 1CT0I 1FYBA 2B0UC 2WCYA 1TIHA 3HH2C 1SGQI 1NUBA 1CGJI 1HJAI 1CSOI 1DS3I 3OVOA 1Y1BA 1UUCA 2KMOA 1SGEI 2NU1I 2KMPA 2QQCA 1CHOI 1TGSI 1AN1I 1IW4A 2NU4I 1SGPI 1N13A 1BUSA 1HDLA 1CT4I 1SGDI 2N17A 2SGFI 2ARPF 1BMOA 1HPTA 3TJQA 1PCEA 2NU0I 1TBQR 2JYYA 2SGEI 2JZMA 1M8BA 1IY6A 1H0ZA 1R0RI 1TBRR 1CGII 1Y1CA 4SGBI 1LR8A 2GKTI 1LR9A 1Z7KB 2BUSA 1OMUA 2KMQA
chains in the Genus database with same CATH superfamily
1FY7A 3E59A 5JHWC 2W0TA 2OVOA 1V1IA 1MT1A 2RC4A 2LEOA 2L8EA 2ERWA 2N71A 5FUYA 4DNCA 1SGNI 3MEKA 2CJSC 3FSXA 2GIVA 3OXFA 3RU0A 2QQDA 3OL0A 2QQEA 1M8CA 2V53A 3QAHA 1YU6C 3SGBI 3UOEA 2KMRA 1DS2I 3OXLA 1OVOA 1IY5A 2ENNA 5J8CA 4HGUA 2GKRI 1TOTA 2JXDA 3R5AA 2E5RA 5E3QA 1UVFA 2KCXA 2L7XA 2NU3I 2M5XA 4OVOA 1OYVI 2J87A 1TBNA 1Z2IA 1LR7A 2DB6A 1TURA 1K7UA 3UGIA 1WTJA 2A20A 2NU2I 1X4SA 1TUSA 1UHAA 3SEKC 1ULMA 1WGCA 2JA1A 2SGQI 1KMAA 1OMTA 1SGYI 2N52A 1K7TA 2P6AC 4UXHA 4WP4A 5CCMA 4JCVE 1PJUA 2YQPA 2SGDI 2F3CI 3TO7A 1PPFI 1S20A 3QTLD 3QWPA 3OXGA 1U5KA 2DIPA 3TOBA 3UGDA 3UGLA 1P9GA 2GKVA 4GI3C 2FNFX 5DAEA 1CT2I 1W4RA 3SGQI 3FC3A 2CWHA 4AMLA 2DKVA 2CWGA 5HQ8A 4E1PA 5J8FA 1YTPA 1UVGA 2SGPI 2LB7A 3B4VC 3BJIA 1PTRA 1MJBA 1ULNA 3TO9A 5HI7A 5EX0A 5CCLA 1SGRI 2XRCA 2JW6A 1CE3A 3KY9A 1Q9BA 1CT0I 1ULKA 1XA6A 3PDNA 1FYBA 2B0UC 2WCYA 3UEYA 4E1RA 1TIHA 4MPIA 3HH2C 1SGQI 2ENZA 1Y8FA 2WVJA 3UEJA 1NUBA 2X52A 1CGJI 1HJAI 2GVIA 1CSOI 3R5CA 9WGAA 1DS3I 4FKDA 3OVOA 2X3TA 1Y1BA 1UUCA 4UXJA 2KMOA 1XBTA 1K7VA 2OU2A 4B6DA 1SGEI 2NU1I 2KMPA 3E2IA 2QQCA 2V1CA 2WGCA 2UVOA 5FUXA 1CHOI 3TO6A 1TGSI 2B8TA 2QPOA 3R5DA 1AN1I 2ORVA 2NU4I 1SGPI 1RFHA 1IW4A 3GOXA 1N13A 3R5BA 4L9MA 3VDUA 1KBEA 1BUSA 1CT4I 1WKXA 1SGDI 2ROWA 1HDLA 2N17A 2SGFI 2ARPF 4UXIA 3VDPA 3FSYA 2ORWA 1BMOA 5EX3A 1HPTA 1NXUA 1V1HA 3TOAA 1MJ9A 5E3PA 5FUVA 3TJQA 1PCEA 2NU0I 1MJAA 2RIJA 2UZ3A 1TBQR 2JYYA 2ODDA 2SGEI 2E73A 2JZMA 1M8BA 1IY6A 1X74A 1HEVA 2V1CC 1FAQA 1W3SA 2LUYA 2QQ0A 1VDDA 2VRWB 3CXLA 7WGAA 1KBFA 3D00A 1H0ZA 5E3RA 1R0RI 1TBRR 1TBOA 1CGII 1WGTA 2OD1A 2OZUA 3VE5A 2N1AB 1Y1CA 4SGBI 3UFFA 1LR8A 1R79A 2K9HA 1P9ZA 5FUWA 4A24A 2J9RA 2YUUA 2ELIA 2GKTI 1XX6A 1PTQA 2Y0MA 1LR9A 1Z7KB 2BUSA 1OMUA 1FARA 2KMQA 2CWFA 2PQ8A
chains in the Genus database with same CATH topology
3E59A 5JHWC 2W0TA 2OVOA 1V1IA 1MT1A 2LEOA 2L8EA 2ERWA 2N71A 5FUYA 1SGNI 3MEKA 2CJSC 3OXFA 3RU0A 2QQDA 3OL0A 2QQEA 1M8CA 2V53A 1YU6C 3SGBI 2KMRA 1DS2I 3OXLA 1OVOA 1IY5A 2ENNA 4HGUA 2GKRI 1TOTA 2JXDA 2E5RA 1UVFA 2KCXA 2L7XA 2NU3I 2M5XA 4OVOA 1OYVI 2J87A 1TBNA 1LR7A 2DB6A 1TURA 3UGIA 2A20A 2NU2I 1X4SA 1TUSA 3SEKC 2JA1A 2SGQI 1KMAA 1OMTA 1SGYI 2N52A 2P6AC 4UXHA 5CCMA 4JCVE 1PJUA 2YQPA 2SGDI 2F3CI 1PPFI 3QTLD 3QWPA 3OXGA 1U5KA 2DIPA 3UGDA 3UGLA 2GKVA 4GI3C 2FNFX 5DAEA 1CT2I 1W4RA 3SGQI 3FC3A 5HQ8A 4E1PA 1YTPA 1UVGA 2SGPI 3BJIA 3B4VC 1PTRA 5HI7A 5EX0A 5CCLA 1SGRI 2XRCA 2JW6A 1CE3A 3KY9A 1XA6A 1CT0I 3PDNA 1FYBA 2B0UC 2WCYA 3UEYA 4E1RA 1TIHA 3HH2C 1SGQI 2ENZA 1Y8FA 2WVJA 3UEJA 1NUBA 1CGJI 1HJAI 2GVIA 1CSOI 1DS3I 4FKDA 3OVOA 4UXJA 1Y1BA 1UUCA 2KMOA 1XBTA 4B6DA 1SGEI 2NU1I 2KMPA 3E2IA 2QQCA 2V1CA 5FUXA 1CHOI 1TGSI 2B8TA 2QPOA 1AN1I 2ORVA 2NU4I 1SGPI 1RFHA 1IW4A 3GOXA 1N13A 4L9MA 3VDUA 1BUSA 1KBEA 1HDLA 1CT4I 2ROWA 1SGDI 2N17A 2SGFI 2ARPF 4UXIA 3VDPA 2ORWA 1BMOA 5EX3A 1HPTA 1V1HA 5FUVA 3TJQA 1PCEA 2NU0I 2UZ3A 1TBQR 2JYYA 2ODDA 2SGEI 2E73A 2JZMA 1M8BA 1IY6A 1X74A 2V1CC 1FAQA 1W3SA 2LUYA 2QQ0A 1VDDA 2VRWB 3CXLA 1KBFA 3D00A 1H0ZA 1R0RI 1TBRR 1TBOA 1CGII 2OD1A 3VE5A 2N1AB 1Y1CA 4SGBI 3UFFA 1LR8A 1R79A 2K9HA 5FUWA 4A24A 2J9RA 2YUUA 2ELIA 2GKTI 1XX6A 1PTQA 1LR9A 1Z7KB 2BUSA 1OMUA 1FARA 2KMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHW C;  2OVO A;  1MT1 A;  2LEO A;  2ERW A;  2N71 A;  1SGN I;  2QQD A;  2V53 A;  1M8C A;  1YU6 C;  3SGB I;  2KMR A;  1DS2 I;  1OVO A;  1IY5 A;  4HGU A;  2GKR I;  2JXD A;  1UVF A;  2KCX A;  2NU3 I;  2M5X A;  4OVO A;  1OYV I;  1LR7 A;  1TUR A;  2NU2 I;  1TUS A;  3SEK C;  2SGQ I;  1KMA A;  1OMT A;  1SGY I;  2N52 A;  2P6A C;  1PJU A;  2SGD I;  2F3C I;  1PPF I;  3QTL D;  2GKV A;  4GI3 C;  5DAE A;  1CT2 I;  3SGQ I;  1YTP A;  1UVG A;  2SGP I;  3B4V C;  1SGR I;  2XRC A;  1CE3 A;  1CT0 I;  1FYB A;  2B0U C;  2WCY A;  1TIH A;  3HH2 C;  1SGQ I;  1NUB A;  1CGJ I;  1HJA I;  1CSO I;  1DS3 I;  3OVO A;  1Y1B A;  1UUC A;  2KMO A;  1SGE I;  2NU1 I;  2KMP A;  2QQC A;  1CHO I;  1TGS I;  1AN1 I;  1IW4 A;  2NU4 I;  1SGP I;  1N13 A;  1BUS A;  1HDL A;  1CT4 I;  1SGD I;  2N17 A;  2SGF I;  2ARP F;  1BMO A;  1HPT A;  3TJQ A;  1PCE A;  2NU0 I;  1TBQ R;  2JYY A;  2SGE I;  2JZM A;  1M8B A;  1IY6 A;  1H0Z A;  1R0R I;  1TBR R;  1CGI I;  1Y1C A;  4SGB I;  1LR8 A;  2GKT I;  1LR9 A;  1Z7K B;  2BUS A;  1OMU A;  2KMQ A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  3E59 A;  5JHW C;  2W0T A;  2OVO A;  1V1I A;  1MT1 A;  2RC4 A;  2LEO A;  2L8E A;  2ERW A;  2N71 A;  5FUY A;  4DNC A;  1SGN I;  3MEK A;  2CJS C;  3FSX A;  2GIV A;  3OXF A;  3RU0 A;  2QQD A;  3OL0 A;  2QQE A;  1M8C A;  2V53 A;  3QAH A;  1YU6 C;  3SGB I;  3UOE A;  2KMR A;  1DS2 I;  3OXL A;  1OVO A;  1IY5 A;  2ENN A;  5J8C A;  4HGU A;  2GKR I;  1TOT A;  2JXD A;  3R5A A;  2E5R A;  5E3Q A;  1UVF A;  2KCX A;  2L7X A;  2NU3 I;  2M5X A;  4OVO A;  1OYV I;  2J87 A;  1TBN A;  1Z2I A;  1LR7 A;  2DB6 A;  1TUR A;  1K7U A;  3UGI A;  1WTJ A;  2A20 A;  2NU2 I;  1X4S A;  1TUS A;  1UHA A;  3SEK C;  1ULM A;  1WGC A;  2JA1 A;  2SGQ I;  1KMA A;  1OMT A;  1SGY I;  2N52 A;  1K7T A;  2P6A C;  4UXH A;  4WP4 A;  5CCM A;  4JCV E;  1PJU A;  2YQP A;  2SGD I;  2F3C I;  3TO7 A;  1PPF I;  1S20 A;  3QTL D;  3QWP A;  3OXG A;  1U5K A;  2DIP A;  3TOB A;  3UGD A;  3UGL A;  1P9G A;  2GKV A;  4GI3 C;  2FNF X;  5DAE A;  1CT2 I;  1W4R A;  3SGQ I;  3FC3 A;  2CWH A;  4AML A;  2DKV A;  2CWG A;  5HQ8 A;  4E1P A;  5J8F A;  1YTP A;  1UVG A;  2SGP I;  2LB7 A;  3B4V C;  3BJI A;  1PTR A;  1MJB A;  1ULN A;  3TO9 A;  5HI7 A;  5EX0 A;  5CCL A;  1SGR I;  2XRC A;  2JW6 A;  1CE3 A;  3KY9 A;  1Q9B A;  1CT0 I;  1ULK A;  1XA6 A;  3PDN A;  1FYB A;  2B0U C;  2WCY A;  3UEY A;  4E1R A;  1TIH A;  4MPI A;  3HH2 C;  1SGQ I;  2ENZ A;  1Y8F A;  2WVJ A;  3UEJ A;  1NUB A;  2X52 A;  1CGJ I;  1HJA I;  2GVI A;  1CSO I;  3R5C A;  9WGA A;  1DS3 I;  4FKD A;  3OVO A;  2X3T A;  1Y1B A;  1UUC A;  4UXJ A;  2KMO A;  1XBT A;  1K7V A;  2OU2 A;  4B6D A;  1SGE I;  2NU1 I;  2KMP A;  3E2I A;  2QQC A;  2V1C A;  2WGC A;  2UVO A;  5FUX A;  1CHO I;  3TO6 A;  1TGS I;  2B8T A;  2QPO A;  3R5D A;  1AN1 I;  2ORV A;  2NU4 I;  1SGP I;  1RFH A;  1IW4 A;  3GOX A;  1N13 A;  3R5B A;  4L9M A;  3VDU A;  1KBE A;  1BUS A;  1CT4 I;  1WKX A;  1SGD I;  2ROW A;  1HDL A;  2N17 A;  2SGF I;  2ARP F;  4UXI A;  3VDP A;  3FSY A;  2ORW A;  1BMO A;  5EX3 A;  1HPT A;  1NXU A;  1V1H A;  3TOA A;  1MJ9 A;  5E3P A;  5FUV A;  3TJQ A;  1PCE A;  2NU0 I;  1MJA A;  2RIJ A;  2UZ3 A;  1TBQ R;  2JYY A;  2ODD A;  2SGE I;  2E73 A;  2JZM A;  1M8B A;  1IY6 A;  1X74 A;  1HEV A;  2V1C C;  1FAQ A;  1W3S A;  2LUY A;  2QQ0 A;  1VDD A;  2VRW B;  3CXL A;  7WGA A;  1KBF A;  3D00 A;  1H0Z A;  5E3R A;  1R0R I;  1TBR R;  1TBO A;  1CGI I;  1WGT A;  2OD1 A;  2OZU A;  3VE5 A;  2N1A B;  1Y1C A;  4SGB I;  3UFF A;  1LR8 A;  1R79 A;  2K9H A;  1P9Z A;  5FUW A;  4A24 A;  2J9R A;  2YUU A;  2ELI A;  2GKT I;  1XX6 A;  1PTQ A;  2Y0M A;  1LR9 A;  1Z7K B;  2BUS A;  1OMU A;  1FAR A;  2KMQ A;  2CWF A;  2PQ8 A; 
#chains in the Genus database with same CATH homology
 3E59 A;  5JHW C;  2W0T A;  2OVO A;  1V1I A;  1MT1 A;  2LEO A;  2L8E A;  2ERW A;  2N71 A;  5FUY A;  1SGN I;  3MEK A;  2CJS C;  3OXF A;  3RU0 A;  2QQD A;  3OL0 A;  2QQE A;  1M8C A;  2V53 A;  1YU6 C;  3SGB I;  2KMR A;  1DS2 I;  3OXL A;  1OVO A;  1IY5 A;  2ENN A;  4HGU A;  2GKR I;  1TOT A;  2JXD A;  2E5R A;  1UVF A;  2KCX A;  2L7X A;  2NU3 I;  2M5X A;  4OVO A;  1OYV I;  2J87 A;  1TBN A;  1LR7 A;  2DB6 A;  1TUR A;  3UGI A;  2A20 A;  2NU2 I;  1X4S A;  1TUS A;  3SEK C;  2JA1 A;  2SGQ I;  1KMA A;  1OMT A;  1SGY I;  2N52 A;  2P6A C;  4UXH A;  5CCM A;  4JCV E;  1PJU A;  2YQP A;  2SGD I;  2F3C I;  1PPF I;  3QTL D;  3QWP A;  3OXG A;  1U5K A;  2DIP A;  3UGD A;  3UGL A;  2GKV A;  4GI3 C;  2FNF X;  5DAE A;  1CT2 I;  1W4R A;  3SGQ I;  3FC3 A;  5HQ8 A;  4E1P A;  1YTP A;  1UVG A;  2SGP I;  3BJI A;  3B4V C;  1PTR A;  5HI7 A;  5EX0 A;  5CCL A;  1SGR I;  2XRC A;  2JW6 A;  1CE3 A;  3KY9 A;  1XA6 A;  1CT0 I;  3PDN A;  1FYB A;  2B0U C;  2WCY A;  3UEY A;  4E1R A;  1TIH A;  3HH2 C;  1SGQ I;  2ENZ A;  1Y8F A;  2WVJ A;  3UEJ A;  1NUB A;  1CGJ I;  1HJA I;  2GVI A;  1CSO I;  1DS3 I;  4FKD A;  3OVO A;  4UXJ A;  1Y1B A;  1UUC A;  2KMO A;  1XBT A;  4B6D A;  1SGE I;  2NU1 I;  2KMP A;  3E2I A;  2QQC A;  2V1C A;  5FUX A;  1CHO I;  1TGS I;  2B8T A;  2QPO A;  1AN1 I;  2ORV A;  2NU4 I;  1SGP I;  1RFH A;  1IW4 A;  3GOX A;  1N13 A;  4L9M A;  3VDU A;  1BUS A;  1KBE A;  1HDL A;  1CT4 I;  2ROW A;  1SGD I;  2N17 A;  2SGF I;  2ARP F;  4UXI A;  3VDP A;  2ORW A;  1BMO A;  5EX3 A;  1HPT A;  1V1H A;  5FUV A;  3TJQ A;  1PCE A;  2NU0 I;  2UZ3 A;  1TBQ R;  2JYY A;  2ODD A;  2SGE I;  2E73 A;  2JZM A;  1M8B A;  1IY6 A;  1X74 A;  2V1C C;  1FAQ A;  1W3S A;  2LUY A;  2QQ0 A;  1VDD A;  2VRW B;  3CXL A;  1KBF A;  3D00 A;  1H0Z A;  1R0R I;  1TBR R;  1TBO A;  1CGI I;  2OD1 A;  3VE5 A;  2N1A B;  1Y1C A;  4SGB I;  3UFF A;  1LR8 A;  1R79 A;  2K9H A;  5FUW A;  4A24 A;  2J9R A;  2YUU A;  2ELI A;  2GKT I;  1XX6 A;  1PTQ A;  1LR9 A;  1Z7K B;  2BUS A;  1OMU A;  1FAR A;  2KMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...