1CT0I

Crystal structure of the omtky3 p1 variant omtky3-ser18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTSEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct0I00
2JXDA 1HPTA 1DS2I 1Y1BA 4OVOA 3SEKC 1OMUA 2N17A 1PJUA 1R0RI 2JYYA 2GKVA 2N71A 5DAEA 2ARPF 1Y1CA 1KMAA 2SGEI 1CGJI 1UVFA 1SGNI 2KMRA 1IY5A 1CHOI 1LR7A 1UVGA 1TBQR 3OVOA 2KMOA 1CGII 1UUCA 1CE3A 1AN1I 2QQDA 1HDLA 1M8CA 2P6AC 1N13A 2NU3I 1OMTA 2F3CI 2GKTI 4GI3C 2NU1I 1NUBA 2XRCA 1M8BA 2QQCA 3TJQA 1H0ZA 1TURA 1PPFI 1OYVI 2N52A 3QTLD 2V53A 2SGPI 1YU6C 1PCEA 1SGQI 1MT1A 2JZMA 1LR9A 1FYBA 2NU2I 1TBRR 1CSOI 1TIHA 2KMQA 2SGQI 2BUSA 2OVOA 2NU0I 2NU4I 4HGUA 1BMOA 1IW4A 1CT0I 1LR8A 2KCXA 1DS3I 3HH2C 1Z7KB 2KMPA 1TUSA 2LEOA 1SGEI 1SGPI 1CT4I 2SGFI 2SGDI 1HJAI 2ERWA 1BUSA 3B4VC 2GKRI 1OVOA 1CT2I 2WCYA 1SGDI 1TGSI 1IY6A 4SGBI 1YTPA 5JHWC 3SGBI 3SGQI 1SGYI 2M5XA 1SGRI 2B0UC
chains in the Genus database with same CATH superfamily
2CWFA 1XBTA 5E3PA 2JXDA 4A24A 2OZUA 1HPTA 2K9HA 1DS2I 3UGIA 1Y1BA 1FY7A 2WVJA 4OVOA 1OMUA 5FUWA 2N17A 3SEKC 1PJUA 3BJIA 1R0RI 2GVIA 2JYYA 4E1PA 3E2IA 3OXGA 5FUYA 2GKVA 4JCVE 2N71A 9WGAA 5DAEA 2E73A 2X52A 3MEKA 2ARPF 1W4RA 1Y1CA 1KMAA 1Z2IA 2SGEI 2GIVA 4MPIA 2B8TA 3OL0A 1CGJI 2PQ8A 1UVFA 1SGNI 1TBNA 2CJSC 2JW6A 2KMRA 1V1IA 2YQPA 3QAHA 5EX3A 1CHOI 3UEJA 1K7TA 1LR7A 1UVGA 1VDDA 1TBQR 1MJ9A 3TO9A 3OVOA 3VDUA 1CGII 1UUCA 2KMOA 2WGCA 1AN1I 3VE5A 2QQDA 1CE3A 1FAQA 2FNFX 2V1CA 1M8CA 1HDLA 2P6AC 1HEVA 4E1RA 5CCLA 1N13A 1RFHA 2NU3I 5J8CA 1IY5A 5E3RA 2X3TA 1OMTA 2F3CI 2GKTI 3R5AA 4GI3C 2NU1I 3QWPA 1NUBA 2CWHA 2XRCA 3R5DA 1Q9BA 1M8BA 2QQCA 3TJQA 1H0ZA 1TURA 2ROWA 1PPFI 1FARA 1OYVI 2ODDA 2N52A 4UXHA 1ULNA 3QTLD 1WGTA 2V53A 2SGPI 2CWGA 1YU6C 2ENZA 1WKXA 3TOBA 1K7UA 1TOTA 4UXJA 1PCEA 3OXLA 5FUXA 5J8FA 4B6DA 1SGQI 2RC4A 3TOAA 1MT1A 1MJAA 2JZMA 2A20A 1LR9A 2JA1A 3UOEA 1FYBA 2QPOA 1XX6A 3PDNA 2L8EA 2LB7A 2NU2I 1TBRR 1CSOI 1NXUA 1UHAA 1TIHA 2ELIA 2W0TA 4WP4A 2J9RA 2KMQA 2SGQI 1XA6A 5HI7A 2BUSA 1KBEA 3D00A 1TBOA 3CXLA 2OVOA 2QQ0A 2LUYA 5FUVA 5CCMA 1KBFA 2NU0I 1X4SA 2NU4I 4HGUA 3RU0A 1BMOA 1WGCA 1IW4A 1R79A 1WTJA 1CT0I 1LR8A 2KCXA 3UGDA 3UEYA 5HQ8A 1DS3I 2RIJA 1Z7KB 2DKVA 2UVOA 3HH2C 2KMPA 1TUSA 1ULMA 2LEOA 1SGEI 3GOXA 1U5KA 1SGPI 1CT4I 2SGFI 3KY9A 2DB6A 2DIPA 3R5BA 1P9GA 2SGDI 5EX0A 1HJAI 2ERWA 3SGQI 3B4VC 1BUSA 2GKRI 1OVOA 2Y0MA 1CT2I 1X74A 2L7XA 3R5CA 1PTQA 3VDPA 2J87A 2N1AB 1MJBA 2WCYA 3OXFA 4L9MA 3UGLA 5E3QA 3FSXA 2VRWB 4AMLA 3TO6A 2QQEA 1SGDI 1TGSI 2ORVA 3TO7A 3UFFA 1IY6A 4SGBI 1YTPA 1Y8FA 2ENNA 4FKDA 2OD1A 4DNCA 2ORWA 1W3SA 5JHWC 3E59A 2OU2A 1P9ZA 2E5RA 1ULKA 2YUUA 1K7VA 7WGAA 3SGBI 1V1HA 2V1CC 1PTRA 1SGYI 1S20A 1SGRI 2B0UC 2M5XA 2UZ3A 3FSYA 4UXIA 3FC3A
chains in the Genus database with same CATH topology
1XBTA 2JXDA 4A24A 1HPTA 2K9HA 1DS2I 3UGIA 1Y1BA 2WVJA 4OVOA 1OMUA 5FUWA 2N17A 3SEKC 1PJUA 3BJIA 1R0RI 2GVIA 2JYYA 4E1PA 3OXGA 5FUYA 2GKVA 4JCVE 2N71A 5DAEA 2E73A 3MEKA 2ARPF 1W4RA 1Y1CA 1KMAA 2SGEI 2B8TA 3OL0A 1CGJI 3E2IA 1UVFA 1SGNI 1TBNA 2CJSC 2JW6A 2KMRA 1V1IA 2YQPA 5EX3A 3UEJA 1CHOI 1LR7A 1VDDA 1UVGA 1TBQR 3OVOA 3VDUA 1CGII 1UUCA 2KMOA 3VE5A 1AN1I 1CE3A 2QQDA 1FAQA 2FNFX 2V1CA 1M8CA 1HDLA 2P6AC 4E1RA 5CCLA 1N13A 1RFHA 2NU3I 1IY5A 1OMTA 2F3CI 2GKTI 4GI3C 2NU1I 3QWPA 1NUBA 2XRCA 1M8BA 2QQCA 3TJQA 1H0ZA 1TURA 2ROWA 1PPFI 1FARA 1OYVI 2ODDA 2N52A 4UXHA 3QTLD 2V53A 2SGPI 1YU6C 2ENZA 1TOTA 4UXJA 1PCEA 3OXLA 5FUXA 4B6DA 1SGQI 1MT1A 2JZMA 2A20A 1LR9A 2JA1A 1FYBA 2QPOA 1XX6A 3PDNA 2L8EA 2NU2I 1TBRR 1CSOI 1TIHA 2ELIA 2W0TA 2J9RA 2KMQA 2SGQI 1XA6A 5HI7A 2BUSA 1KBEA 3D00A 1TBOA 3CXLA 2OVOA 2QQ0A 2LUYA 5FUVA 5CCMA 1KBFA 2NU0I 1X4SA 2NU4I 4HGUA 3RU0A 1BMOA 1IW4A 1R79A 3UGDA 1CT0I 1LR8A 2KCXA 5HQ8A 3UEYA 1DS3I 3HH2C 1Z7KB 2KMPA 1TUSA 2LEOA 1SGEI 3GOXA 1U5KA 1SGPI 1CT4I 2SGFI 3KY9A 2DB6A 2DIPA 2SGDI 5EX0A 1HJAI 2ERWA 1BUSA 3B4VC 2GKRI 1OVOA 1CT2I 1X74A 2L7XA 1PTQA 3VDPA 2J87A 2N1AB 2WCYA 3OXFA 4L9MA 3UGLA 2VRWB 2QQEA 1SGDI 1TGSI 2ORVA 3UFFA 1IY6A 4SGBI 1YTPA 1Y8FA 2ENNA 4FKDA 2OD1A 5JHWC 2ORWA 1W3SA 3E59A 2E5RA 2YUUA 3SGBI 1V1HA 2V1CC 1PTRA 1SGYI 1SGRI 2B0UC 2M5XA 2UZ3A 4UXIA 3SGQI 3FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXD A;  1HPT A;  1DS2 I;  1Y1B A;  4OVO A;  3SEK C;  1OMU A;  2N17 A;  1PJU A;  1R0R I;  2JYY A;  2GKV A;  2N71 A;  5DAE A;  2ARP F;  1Y1C A;  1KMA A;  2SGE I;  1CGJ I;  1UVF A;  1SGN I;  2KMR A;  1IY5 A;  1CHO I;  1LR7 A;  1UVG A;  1TBQ R;  3OVO A;  2KMO A;  1CGI I;  1UUC A;  1CE3 A;  1AN1 I;  2QQD A;  1HDL A;  1M8C A;  2P6A C;  1N13 A;  2NU3 I;  1OMT A;  2F3C I;  2GKT I;  4GI3 C;  2NU1 I;  1NUB A;  2XRC A;  1M8B A;  2QQC A;  3TJQ A;  1H0Z A;  1TUR A;  1PPF I;  1OYV I;  2N52 A;  3QTL D;  2V53 A;  2SGP I;  1YU6 C;  1PCE A;  1SGQ I;  1MT1 A;  2JZM A;  1LR9 A;  1FYB A;  2NU2 I;  1TBR R;  1CSO I;  1TIH A;  2KMQ A;  2SGQ I;  2BUS A;  2OVO A;  2NU0 I;  2NU4 I;  4HGU A;  1BMO A;  1IW4 A;  1CT0 I;  1LR8 A;  2KCX A;  1DS3 I;  3HH2 C;  1Z7K B;  2KMP A;  1TUS A;  2LEO A;  1SGE I;  1SGP I;  1CT4 I;  2SGF I;  2SGD I;  1HJA I;  2ERW A;  1BUS A;  3B4V C;  2GKR I;  1OVO A;  1CT2 I;  2WCY A;  1SGD I;  1TGS I;  1IY6 A;  4SGB I;  1YTP A;  5JHW C;  3SGB I;  3SGQ I;  1SGY I;  2M5X A;  1SGR I;  2B0U C; 
#chains in the Genus database with same CATH topology
 2CWF A;  1XBT A;  5E3P A;  2JXD A;  4A24 A;  2OZU A;  1HPT A;  2K9H A;  1DS2 I;  3UGI A;  1Y1B A;  1FY7 A;  2WVJ A;  4OVO A;  1OMU A;  5FUW A;  2N17 A;  3SEK C;  1PJU A;  3BJI A;  1R0R I;  2GVI A;  2JYY A;  4E1P A;  3E2I A;  3OXG A;  5FUY A;  2GKV A;  4JCV E;  2N71 A;  9WGA A;  5DAE A;  2E73 A;  2X52 A;  3MEK A;  2ARP F;  1W4R A;  1Y1C A;  1KMA A;  1Z2I A;  2SGE I;  2GIV A;  4MPI A;  2B8T A;  3OL0 A;  1CGJ I;  2PQ8 A;  1UVF A;  1SGN I;  1TBN A;  2CJS C;  2JW6 A;  2KMR A;  1V1I A;  2YQP A;  3QAH A;  5EX3 A;  1CHO I;  3UEJ A;  1K7T A;  1LR7 A;  1UVG A;  1VDD A;  1TBQ R;  1MJ9 A;  3TO9 A;  3OVO A;  3VDU A;  1CGI I;  1UUC A;  2KMO A;  2WGC A;  1AN1 I;  3VE5 A;  2QQD A;  1CE3 A;  1FAQ A;  2FNF X;  2V1C A;  1M8C A;  1HDL A;  2P6A C;  1HEV A;  4E1R A;  5CCL A;  1N13 A;  1RFH A;  2NU3 I;  5J8C A;  1IY5 A;  5E3R A;  2X3T A;  1OMT A;  2F3C I;  2GKT I;  3R5A A;  4GI3 C;  2NU1 I;  3QWP A;  1NUB A;  2CWH A;  2XRC A;  3R5D A;  1Q9B A;  1M8B A;  2QQC A;  3TJQ A;  1H0Z A;  1TUR A;  2ROW A;  1PPF I;  1FAR A;  1OYV I;  2ODD A;  2N52 A;  4UXH A;  1ULN A;  3QTL D;  1WGT A;  2V53 A;  2SGP I;  2CWG A;  1YU6 C;  2ENZ A;  1WKX A;  3TOB A;  1K7U A;  1TOT A;  4UXJ A;  1PCE A;  3OXL A;  5FUX A;  5J8F A;  4B6D A;  1SGQ I;  2RC4 A;  3TOA A;  1MT1 A;  1MJA A;  2JZM A;  2A20 A;  1LR9 A;  2JA1 A;  3UOE A;  1FYB A;  2QPO A;  1XX6 A;  3PDN A;  2L8E A;  2LB7 A;  2NU2 I;  1TBR R;  1CSO I;  1NXU A;  1UHA A;  1TIH A;  2ELI A;  2W0T A;  4WP4 A;  2J9R A;  2KMQ A;  2SGQ I;  1XA6 A;  5HI7 A;  2BUS A;  1KBE A;  3D00 A;  1TBO A;  3CXL A;  2OVO A;  2QQ0 A;  2LUY A;  5FUV A;  5CCM A;  1KBF A;  2NU0 I;  1X4S A;  2NU4 I;  4HGU A;  3RU0 A;  1BMO A;  1WGC A;  1IW4 A;  1R79 A;  1WTJ A;  1CT0 I;  1LR8 A;  2KCX A;  3UGD A;  3UEY A;  5HQ8 A;  1DS3 I;  2RIJ A;  1Z7K B;  2DKV A;  2UVO A;  3HH2 C;  2KMP A;  1TUS A;  1ULM A;  2LEO A;  1SGE I;  3GOX A;  1U5K A;  1SGP I;  1CT4 I;  2SGF I;  3KY9 A;  2DB6 A;  2DIP A;  3R5B A;  1P9G A;  2SGD I;  5EX0 A;  1HJA I;  2ERW A;  3SGQ I;  3B4V C;  1BUS A;  2GKR I;  1OVO A;  2Y0M A;  1CT2 I;  1X74 A;  2L7X A;  3R5C A;  1PTQ A;  3VDP A;  2J87 A;  2N1A B;  1MJB A;  2WCY A;  3OXF A;  4L9M A;  3UGL A;  5E3Q A;  3FSX A;  2VRW B;  4AML A;  3TO6 A;  2QQE A;  1SGD I;  1TGS I;  2ORV A;  3TO7 A;  3UFF A;  1IY6 A;  4SGB I;  1YTP A;  1Y8F A;  2ENN A;  4FKD A;  2OD1 A;  4DNC A;  2ORW A;  1W3S A;  5JHW C;  3E59 A;  2OU2 A;  1P9Z A;  2E5R A;  1ULK A;  2YUU A;  1K7V A;  7WGA A;  3SGB I;  1V1H A;  2V1C C;  1PTR A;  1SGY I;  1S20 A;  1SGR I;  2B0U C;  2M5X A;  2UZ3 A;  3FSY A;  4UXI A;  3FC3 A; 
#chains in the Genus database with same CATH homology
 1XBT A;  2JXD A;  4A24 A;  1HPT A;  2K9H A;  1DS2 I;  3UGI A;  1Y1B A;  2WVJ A;  4OVO A;  1OMU A;  5FUW A;  2N17 A;  3SEK C;  1PJU A;  3BJI A;  1R0R I;  2GVI A;  2JYY A;  4E1P A;  3OXG A;  5FUY A;  2GKV A;  4JCV E;  2N71 A;  5DAE A;  2E73 A;  3MEK A;  2ARP F;  1W4R A;  1Y1C A;  1KMA A;  2SGE I;  2B8T A;  3OL0 A;  1CGJ I;  3E2I A;  1UVF A;  1SGN I;  1TBN A;  2CJS C;  2JW6 A;  2KMR A;  1V1I A;  2YQP A;  5EX3 A;  3UEJ A;  1CHO I;  1LR7 A;  1VDD A;  1UVG A;  1TBQ R;  3OVO A;  3VDU A;  1CGI I;  1UUC A;  2KMO A;  3VE5 A;  1AN1 I;  1CE3 A;  2QQD A;  1FAQ A;  2FNF X;  2V1C A;  1M8C A;  1HDL A;  2P6A C;  4E1R A;  5CCL A;  1N13 A;  1RFH A;  2NU3 I;  1IY5 A;  1OMT A;  2F3C I;  2GKT I;  4GI3 C;  2NU1 I;  3QWP A;  1NUB A;  2XRC A;  1M8B A;  2QQC A;  3TJQ A;  1H0Z A;  1TUR A;  2ROW A;  1PPF I;  1FAR A;  1OYV I;  2ODD A;  2N52 A;  4UXH A;  3QTL D;  2V53 A;  2SGP I;  1YU6 C;  2ENZ A;  1TOT A;  4UXJ A;  1PCE A;  3OXL A;  5FUX A;  4B6D A;  1SGQ I;  1MT1 A;  2JZM A;  2A20 A;  1LR9 A;  2JA1 A;  1FYB A;  2QPO A;  1XX6 A;  3PDN A;  2L8E A;  2NU2 I;  1TBR R;  1CSO I;  1TIH A;  2ELI A;  2W0T A;  2J9R A;  2KMQ A;  2SGQ I;  1XA6 A;  5HI7 A;  2BUS A;  1KBE A;  3D00 A;  1TBO A;  3CXL A;  2OVO A;  2QQ0 A;  2LUY A;  5FUV A;  5CCM A;  1KBF A;  2NU0 I;  1X4S A;  2NU4 I;  4HGU A;  3RU0 A;  1BMO A;  1IW4 A;  1R79 A;  3UGD A;  1CT0 I;  1LR8 A;  2KCX A;  5HQ8 A;  3UEY A;  1DS3 I;  3HH2 C;  1Z7K B;  2KMP A;  1TUS A;  2LEO A;  1SGE I;  3GOX A;  1U5K A;  1SGP I;  1CT4 I;  2SGF I;  3KY9 A;  2DB6 A;  2DIP A;  2SGD I;  5EX0 A;  1HJA I;  2ERW A;  1BUS A;  3B4V C;  2GKR I;  1OVO A;  1CT2 I;  1X74 A;  2L7X A;  1PTQ A;  3VDP A;  2J87 A;  2N1A B;  2WCY A;  3OXF A;  4L9M A;  3UGL A;  2VRW B;  2QQE A;  1SGD I;  1TGS I;  2ORV A;  3UFF A;  1IY6 A;  4SGB I;  1YTP A;  1Y8F A;  2ENN A;  4FKD A;  2OD1 A;  5JHW C;  2ORW A;  1W3S A;  3E59 A;  2E5R A;  2YUU A;  3SGB I;  1V1H A;  2V1C C;  1PTR A;  1SGY I;  1SGR I;  2B0U C;  2M5X A;  2UZ3 A;  4UXI A;  3SGQ I;  3FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...