2V53A

Crystal structure of a sparc-collagen complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
214
Chain Sequence
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPARC
publication title Structural Basis of Sequence-Specific Collagen Recognition by Sparc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2v53A02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v53A01
1PVAA 2M9GA 1KWOC 1MXEA 4PHMA 1IY5A 1B7TZ 5I8NA 1UHJA 4QJ3B 1L7ZA 1NCZA 1PALA 2MJWB 4CFQA 1H0ZA 1W7IB 2F8PA 2LAPA 2WCFA 1Q80A 1ZOTB 2KGRA 2ZNEA 1MR8A 4YGAA 1D1OA 5JJGA 4PHKA 4D1EA 4I5KA 2ZNDA 2COLB 4P5OE 2I2RE 1L2OB 2M8UA 4F0ZB 1BOCA 1KK7Z 2NU4I 2JT3A 2KOTA 2PMYA 4GGNA 1SKTA 5KU1A 1AHRA 1A75A 2IS9A 1CFDA 3TS5B 2LP3A 1TGSI 3NSOA 3O78A 5HKWA 1DJXA 3LCPC 2FCEA 1RFJA 4P2YB 1PJUA 1F8HA 1DJHA 1N13A 1M46A 1WLMA 3GOFA 1FF1A 3CZTX 2KBMA 1Y1XA 1YRTB 2M7NA 4E68A 1NYAA 3TDUA 2K7OA 2JXDA 5CSIA 5DKQA 1J7RA 2LP2A 2SGEI 1E8AA 2AUCA 4PHNA 4YI9A 1SL9A 1SGYI 2QQCA 2KSPA 4HRGA 1QJTA 1J7PA 3I5FC 1ZFSA 2LLTA 2KI4B 3ZWHA 5AXIA 3PATA 2I94A 1VRKA 3SIBA 1NX0A 2EC6C 3LK1A 1FI5A 2F2OA 1CFPA 1K9PA 1DTLA 2DOQA 1SGQI 1Y1UA 2HQ8A 1F70A 2JNXA 1M39A 1AUIB 1M8BA 3DF0B 3O2PA 2LLUA 1K93D 1LR7A 1YU6C 2H2KA 2M0RA 3WHUB 1MT1A 2KBIA 3OVOA 2PALA 1FPWA 4MZJA 1SK6D 1TCOB 2CBLA 5AANA 5CSFA 1JFKA 1J7OA 1XK4A 3M0WA 1CT0I 1JF2A 1F54A 1CGII 1MXLC 2P6BB 3HCMA 2JU0A 2KMRA 4ZCUA 3BOWB 2GKTI 2XRCA 2B1UA 5HLOA 3A8RA 4HREE 5K89A 1IH0A 1NUBA 1OQPA 3A4UB 1HPTA 1UHKA 2MAZA 1U5IB 1RWYA 4DUQA 1WY9A 3RM1A 1K96A 2M1UA 4NDBA 2I18A 1YR5A 2BECA 2E6WA 1G8IA 3KEVA 4FTGA 4QJ4B 3EK8A 2LMUA 3KPXA 1H4BA 2KDHA 3TDIA 2LVIA 2TN4A 4N1GA 1MQ1A 1B7TY 1WRKA 2PVBA 2K7CA 4MRXA 1CLLA 2ZN8A 2OS8C 1CM4A 1GJYA 1KSOA 1SCVA 3IQOA 1QX2A 5BPJA 1LXFC 3PN7C 2L98A 3TZ1A 2BUSA 1CT2I 2BL0B 3O4YA 3KF9A 4M2OA 2QACA 4MRYA 5JOLA 1DS3I 2ERWA 1J55A 1PK0D 2LANA 1KK7Y 4AOMA 2M3WA 1BU3A 3VRNA 1AJ4A 2E30A 1CDNA 1DMOA 5DAEA 1S36A 3I5GB 4OCIA 3OP0A 1CMGA 1SGEI 5HKZA 1K8UA 1JFJA 5IBWA 4USLA 1TIHA 1SGDI 2JZMA 2BCAA 1SMGA 2K2AA 2HQWA 2L50A 2LVVA 3CGAA 1NSHA 3I5HB 4MEWA 5CPVA 2ISDA 3SG7A 4ETOA 1FI6A 1QLKA 2M5XA 2JTZA 2KMPA 2SASA 1X02A 2KAXA 5ER4X 1TOPA 5HYDA 1XA5A 2WCYA 1TBQR 3EVUA 1IQ3A 2BCBA 3OX5A 3GK4X 4PALA 2KQYA 1C07A 2JTTA 1H8BA 2LVKA 3QRXA 1TCFA 1MWNA 2BBNA 3ICBA 2FOTA 2GKVA 3SGQI 2OTGC 3SG6A 4XYNA 3BQ3A 5HLVA 4I5NB 1S6CA 2PSRA 3F45A 5TNCA 3CR4X 3JVTC 1BUSA 2KYFA 1RTP1 4OKHA 3GK1A 4HGUA 2CT9A 3HH2C 3DD4A 3BUOB 2LMTA 4C0LA 1XFWO 4NDDA 5I2LA 2Y1NA 3FIAA 3IF7A 1S5GY 2MA2A 1XK4C 1NIWA 1KQMC 1SR6C 1V1GA 4YGEB 1PULA 3SEKC 4PE4A 2NLNA 1JF0A 1OYVI 1FYBA 3B4VC 2LC5A 1CDLA 2KYCA 4JPZB 1KK8C 1Z7KB 3HX4A 4NQGA 1NCXA 2BKIB 4C0KA 1SGNI 2HETA 3FWCA 3PN7B 1TURA 1BLQA 2OPOA 1DVIA 1R2UA 2WORA 1QATA 2QPTA 4ZCVA 2M7LA 2LV7A 3PLFB 5B8IB 1TRFA 3D0YA 4ORAB 4PE7A 5HKYA 3MSEB 4TNCA 1PVBA 1B4CA 5JHWC 1S3PA 2HPSA 3CWGA 1A2XA 2Y4QA 1DJYA 5D7FA 4DIRA 1RK9A 4GI3C 1SL7A 3NSIA 1OMRA 1NWDA 1CNPA 2GKRI 1TNQA 2GGZA 1CFCA 1QVIZ 1BR1B 1UHHA 4NDCA 2SCPA 4M2QA 4ORBB 3PSRA 2ZKMX 1QLSA 1ALVA 1CDPA 3I5IB 1SCMC 1SL8A 3TJQA 1JUOA 5GQQC 1DJIA 4MN0A 1G4YR 4XJKA 5F6TA 1LA0A 1B1GA 2JWWA 3DVMA 4A4BA 1UUCA 1CTRA 1EJ3A 1ODBA 5PALA 2BBMA 2NU0I 2KFFA 2VRGA 4YGCB 1ZMZA 4CPVA 1BR4B 1C7VA 1N0YA 1UVGA 3BUNB 4BY5A 3SJSA 1KWOB 1XO5A 1AJ5A 3KO0A 1B9AA 1PPFI 3VRQA 2LE9B 2BKHB 1ALWA 3H4SE 3WHTB 2LUCA 2OVOA 1A29A 1OZSA 1YTZC 1WDCC 3NXAA 4HRHA 3WXAA 1CFFA 1RECA 1M8CA 1IWQA 1EG3A 1JSAA 4U8DA 1WRLA 1RROA 2L0PA 4I5JA 1OVOA 2SGFI 4WRIA 1B8CA 1KQMB 2N71A 2LHIA 1YTPA 4OVNF 5I2OA 1JBAA 3GK2A 1DT7B 1HJAI 1MF8B 1DJGA 2G9BA 4ORCB 3OB1B 3BOWA 1F4QA 2Y5IA 4CIDA 3SG5A 2SGQI 4CLNA 3SG4A 1V1FA 1BT6A 4OVOA 1YVLA 2ZRSA 1OSAA 1QX7A 1CM1A 2NU2I 1DF0B 2CTNA 3PFVA 3VROA 1U5IA 3EKHA 5D69A 4BY4A 2GGMA 1IW4A 1KMAA 3OX6A 4DS7A 1GGZA 1XFVO 2WCEA 1KFUL 2SGPI 1N65A 1YX7A 1GGWA 1MUXA 4OV2A 2K2FA 1PCEA 2Q4UA 1QIWA 1UVFA 1UWOA 5ER5A 4AQIA 2N17A 2MLEC 2F33A 1AN1I 1L2OC 1SCMB 3PM8A 3I5FB 1SGPI 4QJ5B 2LEOA 2JPTA 2M97A 1IJ5A 2NZ0A 3OHMB 1Y1BA 1SGRI 1Y0VH 1QXPA 4GGFA 2EC6B 2L51A 4DRWA 3TS5C 2F3CI 4PHJA 2F3YA 1HT9A 2CNPA 1KFXL 1CB1A 4WQ3A 1LVCD 4YBHB 1B47A 1PSBA 1F71A 4PDZA 3BUWB 5CSNA 1IRJA 1J1EA 4IL1A 1UHIA 2LNKA 3LLEA 1SPYA 1TIZA 2CCMA 1EG4A 1N2DA 1TTXA 3AAJA 2L2EA 5DKRA 3TUYC 1YURA 3PALA 4ICBA 1QX5B 2EHBA 1YUSA 5I2QA 2PRUA 3D0YB 4YGBB 1ZUZA 1M45A 3NSLA 2H61A 2N52A 2A4JA 4GNKB 1CT4I 3BXKA 4GAOA 2FCDA 2KQ6A 1MHOA 4MSPA 3O6BA 2KI4C 1Y6WA 1JWDA 1B8LA 3LL8B 2L5XB 1OMUA 1K2HA 5AEQA 2JYYA 2MLFC 4M2PA 2HF5A 3CR2A 3TDZA 3BUXB 3BYAA 1QTXA 1YUUA 4R1EA 4OR9B 5AERA 1KQVA 2D8NA 2OS8B 1GQMA 1M63B 1QASA 2MBXA 4N1FA 2JQ6A 1QIVA 3CS1A 1EL4A 2KI6D 1CE3A 1A75B 2SGDI 3IQQA 1CDMA 1NP8A 3EK4A 3DVEA 1IJ6A 2JRFA 1B8RA 1YRUB 1R6PA 1XYDA 2JXLA 1XVJA 5KSZA 2KFGA 1Y1AA 2P6AC 4FQOA 1CSOI 1TNWA 1JC2A 2Y1MA 4PCWA 1OMVA 1QV0A 5J3XA 1KCYA 1OMTA 1NX1A 1CHOI 1TN4A 1CMFA 2M29A 1NX3A 1YUTA 2JC2A 4MBEA 2BE4A 2I7AA 3CR5X 4PE1A 5DKNA 1DJZA 1SRAA 1LR8A 1OOJA 2JULA 2KAYA 2KMOA 1QS7A 2O60A 1K94A 1CGJI 3AKAA 2MHHA 4N5XA 4XJKB 3EK7A 1ZACA 1SW8A 2L4IA 2LLSA 1DJWA 2BL0C 2OTGB 4GGFC 1HDLA 2KHNA 2L4HA 4I5LB 5KTYA 3TUYB 1Y1CA 2FJUB 1F4OA 1QV1A 2CXJA 4MLWA 2K0JA 3LK0A 2LUXA 2R2IA 3JVTB 2BCXA 2ZRTA 2NU1I 1A03A 3QTLD 1J7QA 1IQ5A 3I5GC 1SNLA 1KFUS 5CSJA 1F55A 1S6JA 1TBRR 2LHLA 1IY6A 2WC8A 1SBJA 4A4CA 2LCPA 1S1EA 1SR6B 3I5HC 1AK8A 3VRRA 2JT8A 3ZNIA 1SYMA 1FW4A 3DF0A 4AQJA 1LINA 2JZIA 2NXQA 2V53A 2K7BA 1S5GZ 1K95A 2KAVA 1KK8B 2H61C 2JOJA 4GPLB 4JQ0D 2RGIA 1BG1A 1K9UA 1EH2A 4UPGA 2K61A 1KFXS 1W7JB 2O5GA 4GFTA 4SGBI 1UURA 2LVJA 2MRDA 3AAKA 4WQ2A 4YI8A 3SGBI 1LR9A 4GUKA 4L9MA 1IKUA 1IGVA 1LA3A 3JTDC 3FWBA 2F2PA 4GBAA 2KFHA 3BUMB 2LM5A 2AMIA 2KMQA 3RLZA 5FYXA 1OZOA 1CLMA 1BODA 1SY9A 3SG2A 5AFPA 2NCOA 4C0JA 1TNXA 3KHEA 3NSKA 3OB2B 1WLZA 1DGVA 1NPQA 1YX8A 3EVRA 1AP4A 4YRUA 1C7WA 1XFYO 1DS2I 1NX2A 3FS7A 4JWQA 3VRPA 1FBVA 2B0UC 2WCBA 1DF0A 1DGUA 1TUSA 2ARPF 2JNFA 2ZFDA 4CFRA 1CLBA 2ZN9A 1G33A 3WNXB 1XFUO 1XFZO 2WNDA 4Q04A 3EKJA 4MVFA 1IG5A 1BMOA 1LKJA 1XFXO 1J1DA 2KI6C 3VGOA 1BJFA 1QVIY 1S6IA 2NCPA 3EVVA 4MZKA 2M49B 1RJVA 3DVKA 1WDCB 2GV5A 3CLNA 2K7DA 2LMVA 4HSZA 4YGDB 1YVHA 2G2BA 1K9KA 1UUSA 1WRZA 2EGDA 2PASA 1M31A 1NCYA 2KCXA 1UHNA 3C1VA 3SIAA 3I5IC 1A4PA 2NU3I 5G08A 3CTNA 2QQDA 2K8MB 2KNEA 1TNPA 1UP5A 1K90D 2JT0A 2KGBC 2JXCA 1OMDA 3K21A 2Q91A 1AVSA 3AKBA 1PSRA 4DCKA 3SG3A 4MZLA 1KSMA 1R0RI 2WOSA 4PE0A 3E3RA 2BE6A 3DVJA 3D10A 2M1KB 1CKKA 1PRWA 2AAOA 1BF5A 3JTDB 1HQVA 1S26D 1EXRA 2F3ZA 1OE9B
chains in the Genus database with same CATH superfamily
1KWOC 1NCZA 4WP4A 1PALA 4CFQA 5FUYA 1H0ZA 1Q80A 1ZOTB 2KGRA 4IJ7A 2L7XA 4D1EA 2ZNDA 2I2RE 1L2OB 2NU4I 2JT3A 2L5YA 1SKTA 3TS5B 3PM2A 2FCEA 2KBMA 4F7FA 2K7OA 2JXDA 3L47A 3R72A 2SGEI 1FY7A 2LLTA 3ZWHA 5CCLA 2I94A 1VRKA 1NX0A 2EC6C 1FI5A 2F2OA 1TWOA 2JNXA 1M8BA 3O2PA 1K93D 2KBIA 5AANA 5CSFA 1JFKA 1CT0I 1JF2A 3HCMA 3BOWB 2B1UA 1XX6A 3E2IA 5HLOA 5K89A 3D75A 1RWYA 3UGLA 2M1UA 3EK8A 2KDHA 2LVIA 2TN4A 1MQ1A 1B7TY 3D00A 2PVBA 4MRXA 2ZN8A 4FKDA 3PN7C 2L98A 3KF9A 2QACA 3BJHA 2LANA 2M3WA 1AJ4A 1CDNA 3OP0A 5HKZA 1JFJA 5IBWA 4USLA 2BCAA 1FI6A 5CPVA 2M5XA 2SASA 2KAXA 3OX5A 1H8BA 1C07A 2GKVA 1MWNA 4XYNA 1S6CA 2PSRA 3F45A 3JVTC 1RTP1 3DD4A 2MA2A 1OYVI 1JF0A 1FYBA 2DB6A 1KK8C 1Z7KB 2OU2A 3FWCA 1XFRA 1BLQA 1DVIA 1QATA 2XRCA 2LV7A 2LUYA 4PE7A 4TNCA 1S3PA 3CWGA 1A2XA 3NSIA 2GKRI 1CNPA 4NDCA 4ORBB 2L2CA 4XJKA 4YGCB 4CPVA 1BR4B 1AJ5A 1B9AA 2DIPA 4HRHA 1YTZC 3B86A 5EL2A 4OVNF 3GK2A 1DT7B 3N7HA 1Z2CB 3CZ2A 3K1EA 4CIDA 1F4QA 5HL1A 1Y8FA 3SG4A 4OVOA 4AMLA 1CM1A 2NU2I 3PFVA 5D69A 2WCEA 1KFUL 1N65A 2K2FA 1QIWA 5ER5A 1AN1I 3I5FB 4QJ5B 1IJ5A 1KBFA 1Y0VH 4DRWA 2P71A 4UXJA 1LVCD 2GIVA 3BUWB 2WC5A 3LLEA 3AAJA 5J8CA 3TUYC 3PALA 1LS8A 3FSXA 2N52A 1CT4I 2KQ6A 2KI4C 1JWDA 1B8LA 3LL8B 3FC3A 5AEQA 2MLFC 4M2PA 3TDZA 3BUXB 3R5BA 5AERA 2D8NA 1KBEA 4N1FA 4INXA 1CE3A 1NP8A 3EK4A 1IJ6A 2K9HA 2JXLA 1R6PA 2RIJA 1JC2A 2Y1MA 1OMVA 1QV0A 5J3XA 4INWA 1CHOI 1TN4A 3D74A 3R1OA 4PE1A 5DKNA 2K60A 4N5XA 4XJKB 2QQ0A 4GGFC 1F4OA 1QV1A 2LUXA 2BCXA 3QTLD 1A03A 1IQ5A 5FUVA 2WC8A 4A4CA 2LCPA 3I5HC 5DICA 1SYMA 1FW4A 2KAVA 2H61C 2JOJA 2K61A 1KFXS 3SGBI 1LR9A 1IKUA 1LA3A 3QWPA 1CLMA 5D3OA 2YGUA 5AFPA 4C0JA 1X4SA 3NSKA 1WLZA 4YRUA 1XFYO 3VRPA 2B0UC 1TUSA 4B6DA 2QDIA 1ULKA 4CFRA 3L4AA 3EKJA 3QAHA 1LKJA 2CWFA 2M49B 3DVKA 2K7DA 2G2BA 1K9KA 1UUSA 2EGDA 2PASA 2KCXA 1A4PA 2NU3I 2K8MB 2KNEA 1TNPA 1UP5A 1K90D 2JT0A 1Z4HA 4DCKA 2BE6A 3DVJA 1BF5A 1HQVA 3D0YA 1S26D 1EXRA 1MXEA 1B7TZ 5I8NA 1L7ZA 2MJWB 2OZUA 1W7IB 2F8PA 2WCFA 1D1OA 2ZNEA 4I5KA 2COLB 4A24A 3OXGA 3D73A 4GGNA 1A75A 2IS9A 1CFDA 2LP3A 2OD1A 5HKWA 1DJXA 4P2YB 3D76A 1DJHA 4E68A 2W0TA 5CSIA 1E8AA 2AUCA 4YI9A 1SL9A 1SGYI 1DEKA 2CWHA 2KSPA 1J7PA 3UO9A 5HI7A 3OBVA 1CFPA 1SGQI 1Y1UA 1F70A 1T14A 3DZTA 1LR7A 2H2KA 1MT1A 1SK6D 2CBLA 1J7OA 2P6BB 4ZCUA 2GKTI 1IH0A 3A8RA 1U5IB 4DUQA 5EX3A 2I18A 4FTGA 3KEVA 4QJ4B 3TDIA 2CJSC 1SCVA 1QX2A 1P9GA 2BL0B 2QEBA 1DS3I 1FAQA 1KK7Y 2Y0MA 3VRNA 3DYEA 2QEOA 3I5GB 4OCIA 1CMGA 1K8UA 3CZ0A 1SGDI 1SMGA 2K2AA 2L50A 2ISDA 5HKYA 4MEWA 2WCJA 1QLKA 2KMPA 1X02A 5HYDA 1XA5A 1TBQR 3EVUA 2BCBA 3GK4X 1W3SA 2JTTA 3QRXA 2BBNA 2FOTA 3SGQI 3SG6A 4I5NB 3CR4X 1BUSA 3GK1A 4HGUA 2CT9A 4KYNA 1NIWA 1KQMC 2N1AB 1SR6C 3B4VC 2PQ8A 3B87A 2LC5A 1UHAA 1NCXA 2HETA 3PN7B 4ZCVA 5B8IB 3MSEB 5FI7A 1B4CA 2Y4QA 1DJYA 1RK9A 2P70A 1OMRA 2GGZA 2RC4A 1QVIZ 1BR1B 1UHHA 2SCPA 1ALVA 1CDPA 3I5IB 1SCMC 1JUOA 2E73A 4MN0A 5F6TA 1LA0A 1B1GA 3CYZA 1C7VA 1N0YA 3BFBA 3KO0A 3VRQA 2YQPA 3WHTB 2LUCA 2OVOA 2WC6A 1JSAA 1RROA 4I5JA 2SGFI 1YTPA 1JBAA 1DJGA 1TBNA 4ORCB 1NXUA 1BT6A 3B88A 4UXIA 2CTNA 3VROA 2UVOA 4DS7A 1MJBA 1MUXA 2UZ3A 1L2OC 2LEOA 2JPTA 1Q9BA 4GGFA 3TS5C 4PHJA 1WTJA 2F3YA 4WQ3A 4YBHB 2VRWB 1PSBA 3FE6A 4PDZA 1IRJA 1J1EA 1UHIA 2LNKA 2CCMA 2L2EA 5DKRA 1YURA 2EHBA 2H61A 2FCDA 1MHOA 3L4LA 1Y6WA 3BFHA 2L5XB 3EG5B 3BYAA 1QTXA 4OR9B 2OS8B 1GQMA 2KLEA 3S0AA 2JQ6A 1QIVA 2KI6D 2SGDI 1CDMA 3DVEA 2BNXA 1B8RA 1XVJA 2P6AC 4FQOA 1NX3A 1YUTA 3CR5X 1SRAA 1OOJA 2JULA 1QS7A 1CGJI 3AKAA 2MHHA 2L4IA 1DJWA 2OTGB 2KHNA 3TUYB 3D78A 2E5RA 2K0JA 2R2IA 5CSJA 2ROWA 1F55A 1IY6A 3NHTA 2JT8A 3DF0A 4AQJA 2K7BA 1S5GZ 1K95A 4JQ0D 4GPLB 2O5GA 3AAKA 2MRDA 4L9MA 3JTDC 3FWBA 3BUMB 3RLZA 2NCOA 1TNXA 3OB2B 1DGVA 1NPQA 2JPOA 1YX8A 1C7WA 1NX2A 3R5CA 1FBVA 1DF0A 1OW4A 1XFZO 4MVFA 1SSEB 1QVIY 1S6IA 1WDCB 2LMVA 3TOAA 4YGDB 1NCYA 5G08A 3IVTA 2KGBC 3K21A 3S0GA 1AVSA 3SG3A 4PE0A 3E3RA 3KY9A 2KLDA 2DKVA 1J7QA 2M9GA 1V1IA 1DELA 4QJ3B 2ELIA 2LAPA 4YGAA 4PHKA 1ORGA 4P5OE 2M8UA 4F0ZB 1KK7Z 2KOTA 2V1CC 5KU1A 1TGSI 3NSOA 3O78A 1RFJA 2FNFX 1PJUA 3S0DA 1N13A 1M46A 5I94A 1WLMA 3GOFA 1FF1A 3CZTX 2BAPA 2M7NA 3TDUA 1J7RA 2LP2A 4PHNA 2QQCA 1QJTA 3I5FC 1ZFSA 3PATA 3SIBA 3LK1A 2HQ8A 1M39A 2H8VA 1AUIB 3DF0B 4JD9A 2LLUA 3WHUB 3OVOA 2PALA 1FPWA 2YUUA 1F54A 1CGII 1MXLC 2JU0A 3RZSA 1NUBA 3A4UB 1HPTA 2LB7A 1UHKA 1WY9A 1K96A 1YR5A 2E6WA 1H4BA 3KPXA 4N1GA 1WRKA 2K7CA 5FI2A 1PTQA 1CLLA 1CM4A 3IQOA 5BPJA 3O4YA 1WGCA 4M2OA 5JOLA 1J55A 1PK0D 4AOMA 1R79A 1BU3A 2FJYA 2E30A 5DAEA 1DMOA 1S36A 1K7TA 1TIHA 2HQWA 3CGAA 2LVVA 2JTZA 5ER4X 1TOPA 1ULNA 2WCYA 1IQ3A 3D77A 3ICBA 5HLVA 3S0FA 3R5AA 2KYFA 4OKHA 1TBOA 3BFAA 3HH2C 1OOFA 3BUOB 2LMTA 5I2LA 3SS3A 2Y1NA 3FIAA 1XBTA 3IF7A 3UNWA 2WGCA 1S5GY 3B7AA 1XK4C 1V1GA 1PULA 3SEKC 2NLNA 1WKXA 2B8TA 3HX4A 4NQGA 2BKIB 4C0KA 1R2UA 2WORA 2PQLA 4ORAB 3SS5A 5JHWC 4DIRA 5EX0A 5E3QA 2QPOA 1TNQA 2GVIA 3PSRA 2ZKMX 1QLSA 1TOTA 1DJIA 1UUCA 1CTRA 1EJ3A 1ODBA 2NU0I 2VRGA 3UOEA 1UVGA 4BY5A 3SJSA 1KWOB 1XO5A 1PPFI 3MEKA 3H4SE 3WXAA 3UEYA 4U8DA 1OVOA 4WRIA 1B8CA 1KQMB 2CWGA 5E3RA 1MF8B 2G9BA 3BOWA 2Y5IA 1FARA 2SGQI 1DQEA 4CLNA 1OSAA 2GTEA 3UFFA 3EKHA 3OX6A 1GGZA 1YX7A 3CXLA 1PCEA 3E59A 3R5DA 2Q4UA 1UWOA 4AQIA 2N17A 1SCMB 2M97A 3UGIA 1SGRI 2A20A 2ORWA 2EC6B 2F3CI 1KFXL 3BJIA 1CB1A 1F71A 2WCKA 4IL1A 1OOIX 1TIZA 1EG4A 4ICBA 1QX5B 1GM0A 1YUSA 2PRUA 3D0YB 4YGBB 1M45A 4GNKB 4MSPA 2KPHA 3R1PA 2JW6A 1YUUA 1KQVA 1ULMA 1M63B 1EL4A 1A75B 2JRFA 1XYDA 5KSZA 2KFGA 1Y1AA 1CSOI 1W9ZA 1TNWA 4PCWA 1C3ZA 1CMFA 2JC2A 4MBEA 1LR8A 2KAYA 1Z2IA 2O60A 1K94A 3EK7A 1ZACA 2LLSA 2BL0C 1HDLA 2L4HA 4I5LB 1OOHA 1Y1CA 2FJUB 2CXJA 4MLWA 3JVTB 3NGVA 3I5GC 1KFUS 3UGDA 1S6JA 3VB1A 2LHLA 1S1EA 3ZNIA 1S20A 3FSYA 1KK8B 1EH2A 4UPGA 4DNCA 4GFTA 4SGBI 1UURA 4YI8A 4WQ2A 1IGVA 2F2PA 4GBAA 2KFHA 3OL0A 2LM5A 2KMQA 1BODA 5FYXA 2V1CA 3B6XA 1AP4A 2QEVA 1DS2I 1DGUA 3FE9A 1XFUO 4Q04A 1IG5A 3VGOA 1XFXO 1J1DA 2KI6C 3EVVA 4UXHA 1RJVA 3CLNA 4HSZA 5FUXA 1YVHA 1WRZA 1M31A 1UHNA 3C1VA 3I5IC 3TOBA 2Q91A 1R0RI 1PSRA 4MZLA 5J8FA 3D10A 1QWVA 1PRWA 3JTDB 4NDBA 1OE9B 4JKTA 1PVAA 4PHMA 1IY5A 1UHJA 3OGNA 1MR8A 5JJGA 1BOCA 3DXLA 2PMYA 1AHRA 5CCMA 3RU0A 3LCPC 2L8EA 1F8HA 9WGAA 1Y1XA 1YRTB 1NYAA 3CZ1A 5DKQA 4HRGA 3GOXA 2KI4B 5AXIA 2ENNA 3R1VA 1K9PA 1DTLA 2DOQA 2PYQA 1YU6C 2M0RA 4MZJA 2JA1A 1TCOB 1XK4A 3M0WA 2ORVA 2KMRA 4HREE 1OQPA 2MAZA 3S0BA 3TO6A 3RM1A 2BECA 1G8IA 2LMUA 2OS8C 1GJYA 1KSOA 1LXFC 3TZ1A 2BUSA 1CT2I 4MRYA 5HQ8A 2ENZA 2ERWA 1U5KA 1SGEI 2JZMA 1V1HA 4ETOA 3I5HB 1NSHA 3SG7A 3S0EA 2X3TA 3VDUA 4PALA 2KQYA 2LVKA 1TCFA 3OXFA 2OTGC 3BQ3A 5TNCA 1W4RA 3PDNA 3CABA 5E3PA 4C0LA 1XFWO 4NDDA 4YGEB 1VDDA 4PE4A 1TUZA 1CDLA 2KYCA 4JPZB 1SGNI 1TURA 3SS4A 2OPOA 2J87A 2QPTA 2M7LA 3PLFB 1TRFA 1PVBA 2HPSA 5D7FA 4GI3C 1SL7A 1NWDA 1CFCA 1X74A 2ODDA 4M2QA 3TJQA 1SL8A 5GQQC 1G4YR 2X52A 2JWWA 3DVMA 4A4BA 5PALA 2BBMA 3CDNA 2KFFA 1ZMZA 3BUNB 2LE9B 2BKHB 1ALWA 7WGAA 1A29A 1OZSA 1K7UA 1WDCC 2WCHA 3NXAA 4FQTA 1CFFA 1RECA 1M8CA 1IWQA 1EG3A 1WRLA 3V2LA 2L0PA 4MPIA 2N71A 2LHIA 5I2OA 2QQEA 1HJAI 3OB1B 3SG5A 3Q8IA 5FUWA 1V1FA 1YVLA 2ZRSA 1QX7A 1DC1A 1DF0B 4BY4A 1IW4A 1U5IA 2GGMA 1KMAA 1XFVO 5FI6A 2SGPI 1GGWA 4OV2A 1UVFA 2MLEC 2F33A 3PM8A 1SGPI 2NZ0A 3OHMB 1Y1BA 1QXPA 2L51A 4OZDA 1PTRA 1HT9A 2QEHA 2CNPA 1B47A 5CSNA 1C3YA 2J9RA 1SPYA 1N2DA 1TTXA 5I2QA 1ZUZA 3NSLA 2A4JA 3BXKA 4GAOA 3O6BA 1OMUA 2WCLA 1K2HA 2JYYA 2HF5A 3CR2A 4R1EA 3DY9A 2MBXA 1QASA 3CS1A 3FE8A 3IQQA 1TUJA 1YRUB 1OOGA 1KCYA 3O4XA 1OMTA 1NX1A 2M29A 2WCMA 2BE4A 2I7AA 1DJZA 2KMOA 1MJAA 1SW8A 5KTYA 3TO7A 4PT1A 1HEVA 1WGTA 3QMEA 3LK0A 2NU1I 2ZRTA 1SNLA 1TBRR 1SBJA 1SR6B 1AK8A 3VRRA 3OXLA 3PJIA 1LINA 2JZIA 2NXQA 2V53A 3VDPA 1BG1A 1K7VA 2RGIA 1K9UA 1W7JB 2LVJA 4GUKA 4E1RA 3UEJA 2AMIA 1OZOA 1SY9A 3SG2A 2ERBA 3KHEA 3EVRA 1IIOA 2WVJA 3FS7A 4JWQA 2WCBA 2ARPF 2JNFA 2ZFDA 1CLBA 2ZN9A 1G33A 3WNXB 1MJ9A 2WNDA 1XA6A 3VE5A 1BMOA 1P28A 1BJFA 2NCPA 4MZKA 2GV5A 1P9ZA 3SIAA 3NHIA 4E1PA 3CTNA 2QQDA 2JXCA 1OMDA 3AKBA 1KSMA 2WOSA 1CKKA 2M1KB 2AAOA 1RFHA 4JCVE 3TO9A 2F3ZA
chains in the Genus database with same CATH topology
1PVAA 2M9GA 1KWOC 1MXEA 4PHMA 1IY5A 1B7TZ 5I8NA 1V1IA 1UHJA 4QJ3B 1L7ZA 2ELIA 1NCZA 1PALA 2MJWB 4CFQA 5FUYA 1H0ZA 1W7IB 2F8PA 2LAPA 2WCFA 1Q80A 1ZOTB 2KGRA 2ZNEA 1MR8A 4YGAA 1D1OA 5JJGA 2L7XA 4PHKA 4D1EA 4I5KA 2ZNDA 2COLB 4P5OE 2I2RE 1L2OB 2M8UA 4F0ZB 1BOCA 1KK7Z 2NU4I 2JT3A 2KOTA 4A24A 2PMYA 3OXGA 4GGNA 1SKTA 2V1CC 5KU1A 1AHRA 1A75A 5CCMA 2IS9A 1CFDA 3TS5B 2LP3A 1TGSI 3NSOA 3O78A 5HKWA 1DJXA 3LCPC 2OD1A 3RU0A 2FCEA 1RFJA 2FNFX 4P2YB 1PJUA 2L8EA 1F8HA 1DJHA 1N13A 1M46A 1WLMA 3GOFA 1FF1A 3CZTX 2KBMA 1Y1XA 1YRTB 2M7NA 4E68A 1NYAA 2W0TA 3TDUA 2K7OA 2JXDA 5CSIA 5DKQA 1J7RA 2LP2A 2SGEI 1E8AA 2AUCA 4PHNA 4YI9A 1SL9A 1SGYI 2QQCA 2KSPA 4HRGA 1QJTA 1J7PA 3GOXA 3I5FC 1ZFSA 2LLTA 2KI4B 3ZWHA 5AXIA 3PATA 5CCLA 2I94A 5HI7A 1VRKA 3SIBA 1NX0A 2EC6C 2ENNA 3LK1A 1FI5A 2F2OA 1CFPA 1K9PA 1DTLA 2DOQA 1SGQI 1Y1UA 2HQ8A 1F70A 2JNXA 1M39A 1AUIB 1M8BA 3DF0B 3O2PA 2LLUA 1K93D 1LR7A 1YU6C 2H2KA 2M0RA 3WHUB 1MT1A 2KBIA 3OVOA 2PALA 1FPWA 4MZJA 2JA1A 1SK6D 1TCOB 2CBLA 5AANA 5CSFA 1JFKA 2YUUA 1J7OA 1XK4A 3M0WA 1CT0I 1JF2A 1F54A 1CGII 1MXLC 2P6BB 3HCMA 2JU0A 2KMRA 2ORVA 4ZCUA 3BOWB 2GKTI 2XRCA 2B1UA 1XX6A 3E2IA 5HLOA 3A8RA 4HREE 5K89A 1IH0A 1NUBA 1OQPA 3A4UB 1HPTA 1UHKA 2MAZA 1U5IB 1RWYA 3UGLA 4DUQA 1WY9A 3RM1A 1K96A 2M1UA 5EX3A 4NDBA 2I18A 1YR5A 2BECA 2E6WA 1G8IA 3KEVA 4FTGA 4QJ4B 3EK8A 2LMUA 3KPXA 1H4BA 2KDHA 3TDIA 2LVIA 2TN4A 4N1GA 2CJSC 1MQ1A 1B7TY 1WRKA 3D00A 2PVBA 2K7CA 4MRXA 1PTQA 1CLLA 2ZN8A 2OS8C 1CM4A 1GJYA 1KSOA 1SCVA 3IQOA 4FKDA 1QX2A 5BPJA 1LXFC 3PN7C 2L98A 3TZ1A 2BUSA 1CT2I 2BL0B 3O4YA 3KF9A 4M2OA 2QACA 4MRYA 5JOLA 1DS3I 2ENZA 5HQ8A 2ERWA 1J55A 1PK0D 1FAQA 2LANA 1KK7Y 4AOMA 2M3WA 1BU3A 1R79A 3VRNA 1AJ4A 2E30A 1CDNA 1DMOA 1U5KA 5DAEA 1S36A 3I5GB 4OCIA 3OP0A 1CMGA 1SGEI 5HKZA 1K8UA 1JFJA 5IBWA 4USLA 1TIHA 1SGDI 2JZMA 2BCAA 1SMGA 1V1HA 2K2AA 2HQWA 2L50A 2LVVA 3CGAA 1NSHA 3I5HB 4MEWA 5CPVA 2ISDA 3SG7A 4ETOA 1FI6A 1QLKA 2M5XA 2JTZA 2KMPA 2SASA 3VDUA 1X02A 2KAXA 5ER4X 1TOPA 5HYDA 1XA5A 2WCYA 1TBQR 3EVUA 1IQ3A 2BCBA 3OX5A 3GK4X 4PALA 2KQYA 1C07A 2JTTA 1H8BA 1W3SA 2LVKA 3QRXA 1TCFA 1MWNA 2BBNA 3ICBA 2FOTA 2GKVA 3OXFA 3SGQI 2OTGC 3SG6A 4XYNA 3BQ3A 5HLVA 4I5NB 1S6CA 2PSRA 3F45A 5TNCA 1W4RA 3CR4X 3JVTC 3PDNA 2KYFA 1BUSA 1RTP1 4OKHA 1TBOA 3GK1A 4HGUA 2CT9A 3HH2C 3DD4A 3BUOB 2LMTA 4C0LA 1XFWO 4NDDA 5I2LA 2Y1NA 3FIAA 1XBTA 3IF7A 1S5GY 2MA2A 1XK4C 1NIWA 1KQMC 2N1AB 1SR6C 1V1GA 4YGEB 1PULA 1VDDA 3SEKC 4PE4A 2NLNA 1JF0A 1OYVI 1FYBA 3B4VC 2DB6A 2LC5A 1CDLA 2KYCA 4JPZB 1KK8C 1Z7KB 2B8TA 3HX4A 4NQGA 1NCXA 2BKIB 4C0KA 1SGNI 2HETA 3FWCA 3PN7B 1TURA 1BLQA 2OPOA 1DVIA 1R2UA 2WORA 2J87A 1QATA 2QPTA 4ZCVA 2M7LA 2LV7A 3PLFB 5B8IB 1TRFA 3D0YA 4ORAB 4PE7A 5HKYA 3MSEB 2LUYA 4TNCA 1PVBA 1B4CA 5JHWC 1S3PA 2HPSA 3CWGA 1A2XA 2Y4QA 1DJYA 5D7FA 4DIRA 1RK9A 5EX0A 4GI3C 1SL7A 3NSIA 1OMRA 1NWDA 1CNPA 2GKRI 1TNQA 2QPOA 2GGZA 1CFCA 1X74A 2ODDA 1QVIZ 2GVIA 1BR1B 1UHHA 4NDCA 2SCPA 4M2QA 4ORBB 3PSRA 2ZKMX 1QLSA 1ALVA 1CDPA 3I5IB 1SCMC 1SL8A 3TJQA 1JUOA 1TOTA 2E73A 5GQQC 1DJIA 4MN0A 1G4YR 4XJKA 5F6TA 1LA0A 1B1GA 2JWWA 3DVMA 4A4BA 1UUCA 1CTRA 1EJ3A 1ODBA 5PALA 2BBMA 2NU0I 2KFFA 2VRGA 4YGCB 1ZMZA 4CPVA 1BR4B 1C7VA 1N0YA 1UVGA 3BUNB 4BY5A 3SJSA 1KWOB 1XO5A 1AJ5A 3KO0A 1B9AA 1PPFI 2DIPA 3VRQA 2LE9B 2BKHB 1ALWA 3H4SE 2YQPA 3WHTB 2LUCA 2OVOA 3MEKA 1A29A 1OZSA 1YTZC 1WDCC 3NXAA 4HRHA 3WXAA 1CFFA 1RECA 1M8CA 3UEYA 1IWQA 1EG3A 1JSAA 4U8DA 1WRLA 1RROA 2L0PA 4I5JA 1OVOA 2SGFI 4WRIA 1B8CA 1KQMB 2N71A 2LHIA 1YTPA 4OVNF 5I2OA 1JBAA 3GK2A 2QQEA 1DT7B 1HJAI 1MF8B 1DJGA 2G9BA 1TBNA 4ORCB 3OB1B 3BOWA 1F4QA 2Y5IA 4CIDA 1FARA 3SG5A 1Y8FA 2SGQI 4CLNA 3SG4A 5FUWA 1V1FA 1BT6A 4OVOA 1YVLA 2ZRSA 1OSAA 4UXIA 1QX7A 1CM1A 3UFFA 2NU2I 1DF0B 2CTNA 3PFVA 3VROA 1U5IA 3EKHA 5D69A 4BY4A 2GGMA 1IW4A 1KMAA 3OX6A 4DS7A 1GGZA 1XFVO 2WCEA 1KFUL 2SGPI 1N65A 1YX7A 1GGWA 3CXLA 1MUXA 4OV2A 2K2FA 1PCEA 2Q4UA 3E59A 1QIWA 1UVFA 1UWOA 5ER5A 4AQIA 2N17A 2MLEC 2F33A 2UZ3A 1AN1I 1L2OC 1SCMB 3PM8A 3I5FB 1SGPI 4QJ5B 2LEOA 2JPTA 2M97A 1IJ5A 3UGIA 2NZ0A 3OHMB 1Y1BA 1KBFA 1SGRI 1Y0VH 1QXPA 2A20A 4GGFA 2ORWA 2EC6B 2L51A 4DRWA 3TS5C 1PTRA 2F3CI 4PHJA 2F3YA 1HT9A 2CNPA 1KFXL 3BJIA 4UXJA 1CB1A 4WQ3A 1LVCD 4YBHB 2VRWB 1B47A 1PSBA 1F71A 4PDZA 3BUWB 5CSNA 1IRJA 1J1EA 4IL1A 2J9RA 1UHIA 2LNKA 3LLEA 1SPYA 1TIZA 2CCMA 1EG4A 1N2DA 1TTXA 3AAJA 2L2EA 5DKRA 3TUYC 1YURA 3PALA 4ICBA 1QX5B 2EHBA 1YUSA 5I2QA 2PRUA 3D0YB 4YGBB 1ZUZA 1M45A 3NSLA 2H61A 2N52A 2A4JA 4GNKB 1CT4I 3BXKA 4GAOA 2FCDA 2KQ6A 1MHOA 4MSPA 3O6BA 2KI4C 1Y6WA 1JWDA 1B8LA 3LL8B 2L5XB 3FC3A 1OMUA 1K2HA 5AEQA 2JYYA 2MLFC 4M2PA 2HF5A 2JW6A 3CR2A 3TDZA 3BUXB 3BYAA 1QTXA 1YUUA 4R1EA 4OR9B 5AERA 1KQVA 2D8NA 2OS8B 1GQMA 1M63B 1QASA 2MBXA 1KBEA 4N1FA 2JQ6A 1QIVA 3CS1A 1EL4A 2KI6D 1CE3A 1A75B 2SGDI 3IQQA 1CDMA 1NP8A 3EK4A 3DVEA 1IJ6A 2K9HA 2JRFA 1B8RA 1YRUB 1R6PA 1XYDA 2JXLA 1XVJA 5KSZA 2KFGA 1Y1AA 2P6AC 4FQOA 1CSOI 1TNWA 1JC2A 2Y1MA 4PCWA 1OMVA 1QV0A 5J3XA 1KCYA 1OMTA 1NX1A 1CHOI 1TN4A 1CMFA 2M29A 1NX3A 1YUTA 2JC2A 4MBEA 2BE4A 2I7AA 3CR5X 4PE1A 5DKNA 1DJZA 1SRAA 1LR8A 1OOJA 2JULA 2KAYA 2KMOA 1QS7A 2O60A 1K94A 1CGJI 3AKAA 2MHHA 4N5XA 4XJKB 3EK7A 1ZACA 1SW8A 2L4IA 2LLSA 1DJWA 2BL0C 2OTGB 4GGFC 2QQ0A 1HDLA 2KHNA 2L4HA 4I5LB 5KTYA 3TUYB 1Y1CA 2E5RA 2FJUB 1F4OA 1QV1A 2CXJA 4MLWA 2K0JA 3LK0A 2LUXA 2R2IA 3JVTB 2BCXA 2ZRTA 2NU1I 1A03A 3QTLD 1J7QA 1IQ5A 3I5GC 1SNLA 1KFUS 5CSJA 2ROWA 3UGDA 1F55A 1S6JA 1TBRR 2LHLA 1IY6A 5FUVA 2WC8A 1SBJA 4A4CA 2LCPA 1S1EA 1SR6B 3I5HC 1AK8A 3VRRA 2JT8A 3OXLA 3ZNIA 1SYMA 1FW4A 3DF0A 4AQJA 1LINA 2JZIA 2NXQA 2V53A 2K7BA 1S5GZ 1K95A 2KAVA 1KK8B 2H61C 2JOJA 4GPLB 4JQ0D 2RGIA 1BG1A 3VDPA 1K9UA 1EH2A 4UPGA 2K61A 1KFXS 1W7JB 2O5GA 4GFTA 4SGBI 1UURA 2LVJA 2MRDA 3AAKA 4WQ2A 4YI8A 3SGBI 1LR9A 4GUKA 4L9MA 1IKUA 4E1RA 1IGVA 1LA3A 3JTDC 3FWBA 3QWPA 2F2PA 4GBAA 2KFHA 3OL0A 3BUMB 3UEJA 2LM5A 2AMIA 2KMQA 3RLZA 5FYXA 1OZOA 1CLMA 1BODA 2V1CA 1SY9A 3SG2A 5AFPA 2NCOA 4C0JA 1X4SA 1TNXA 3KHEA 3NSKA 3OB2B 1WLZA 1DGVA 1NPQA 1YX8A 3EVRA 1AP4A 4YRUA 2WVJA 1C7WA 1XFYO 1DS2I 1NX2A 3FS7A 4JWQA 3VRPA 1FBVA 2B0UC 2WCBA 1DF0A 1DGUA 1TUSA 4B6DA 2ARPF 2JNFA 2ZFDA 4CFRA 1CLBA 2ZN9A 1G33A 3WNXB 1XFUO 1XFZO 2WNDA 1XA6A 4Q04A 3EKJA 4MVFA 3VE5A 1IG5A 1BMOA 1LKJA 1XFXO 1J1DA 2KI6C 3VGOA 1BJFA 1QVIY 1S6IA 2NCPA 3EVVA 4MZKA 2M49B 4UXHA 1RJVA 3DVKA 1WDCB 2GV5A 3CLNA 2K7DA 2LMVA 4HSZA 5FUXA 4YGDB 1YVHA 2G2BA 1K9KA 1UUSA 1WRZA 2EGDA 2PASA 1M31A 1NCYA 2KCXA 1UHNA 3C1VA 3SIAA 3I5IC 1A4PA 2NU3I 5G08A 4E1PA 3CTNA 2QQDA 2K8MB 2KNEA 1TNPA 1UP5A 1K90D 2JT0A 2KGBC 2JXCA 1OMDA 3K21A 2Q91A 1AVSA 3AKBA 1PSRA 4DCKA 3SG3A 4MZLA 1KSMA 1R0RI 2WOSA 4PE0A 3E3RA 3KY9A 2BE6A 3DVJA 3D10A 2M1KB 1CKKA 1PRWA 2AAOA 1BF5A 1RFHA 4JCVE 3JTDB 1HQVA 1S26D 1EXRA 2F3ZA 1OE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVA A;  2M9G A;  1KWO C;  1MXE A;  4PHM A;  1IY5 A;  1B7T Z;  5I8N A;  1UHJ A;  4QJ3 B;  1L7Z A;  1NCZ A;  1PAL A;  2MJW B;  4CFQ A;  1H0Z A;  1W7I B;  2F8P A;  2LAP A;  2WCF A;  1Q80 A;  1ZOT B;  2KGR A;  2ZNE A;  1MR8 A;  4YGA A;  1D1O A;  5JJG A;  4PHK A;  4D1E A;  4I5K A;  2ZND A;  2COL B;  4P5O E;  2I2R E;  1L2O B;  2M8U A;  4F0Z B;  1BOC A;  1KK7 Z;  2NU4 I;  2JT3 A;  2KOT A;  2PMY A;  4GGN A;  1SKT A;  5KU1 A;  1AHR A;  1A75 A;  2IS9 A;  1CFD A;  3TS5 B;  2LP3 A;  1TGS I;  3NSO A;  3O78 A;  5HKW A;  1DJX A;  3LCP C;  2FCE A;  1RFJ A;  4P2Y B;  1PJU A;  1F8H A;  1DJH A;  1N13 A;  1M46 A;  1WLM A;  3GOF A;  1FF1 A;  3CZT X;  2KBM A;  1Y1X A;  1YRT B;  2M7N A;  4E68 A;  1NYA A;  3TDU A;  2K7O A;  2JXD A;  5CSI A;  5DKQ A;  1J7R A;  2LP2 A;  2SGE I;  1E8A A;  2AUC A;  4PHN A;  4YI9 A;  1SL9 A;  1SGY I;  2QQC A;  2KSP A;  4HRG A;  1QJT A;  1J7P A;  3I5F C;  1ZFS A;  2LLT A;  2KI4 B;  3ZWH A;  5AXI A;  3PAT A;  2I94 A;  1VRK A;  3SIB A;  1NX0 A;  2EC6 C;  3LK1 A;  1FI5 A;  2F2O A;  1CFP A;  1K9P A;  1DTL A;  2DOQ A;  1SGQ I;  1Y1U A;  2HQ8 A;  1F70 A;  2JNX A;  1M39 A;  1AUI B;  1M8B A;  3DF0 B;  3O2P A;  2LLU A;  1K93 D;  1LR7 A;  1YU6 C;  2H2K A;  2M0R A;  3WHU B;  1MT1 A;  2KBI A;  3OVO A;  2PAL A;  1FPW A;  4MZJ A;  1SK6 D;  1TCO B;  2CBL A;  5AAN A;  5CSF A;  1JFK A;  1J7O A;  1XK4 A;  3M0W A;  1CT0 I;  1JF2 A;  1F54 A;  1CGI I;  1MXL C;  2P6B B;  3HCM A;  2JU0 A;  2KMR A;  4ZCU A;  3BOW B;  2GKT I;  2XRC A;  2B1U A;  5HLO A;  3A8R A;  4HRE E;  5K89 A;  1IH0 A;  1NUB A;  1OQP A;  3A4U B;  1HPT A;  1UHK A;  2MAZ A;  1U5I B;  1RWY A;  4DUQ A;  1WY9 A;  3RM1 A;  1K96 A;  2M1U A;  4NDB A;  2I18 A;  1YR5 A;  2BEC A;  2E6W A;  1G8I A;  3KEV A;  4FTG A;  4QJ4 B;  3EK8 A;  2LMU A;  3KPX A;  1H4B A;  2KDH A;  3TDI A;  2LVI A;  2TN4 A;  4N1G A;  1MQ1 A;  1B7T Y;  1WRK A;  2PVB A;  2K7C A;  4MRX A;  1CLL A;  2ZN8 A;  2OS8 C;  1CM4 A;  1GJY A;  1KSO A;  1SCV A;  3IQO A;  1QX2 A;  5BPJ A;  1LXF C;  3PN7 C;  2L98 A;  3TZ1 A;  2BUS A;  1CT2 I;  2BL0 B;  3O4Y A;  3KF9 A;  4M2O A;  2QAC A;  4MRY A;  5JOL A;  1DS3 I;  2ERW A;  1J55 A;  1PK0 D;  2LAN A;  1KK7 Y;  4AOM A;  2M3W A;  1BU3 A;  3VRN A;  1AJ4 A;  2E30 A;  1CDN A;  1DMO A;  5DAE A;  1S36 A;  3I5G B;  4OCI A;  3OP0 A;  1CMG A;  1SGE I;  5HKZ A;  1K8U A;  1JFJ A;  5IBW A;  4USL A;  1TIH A;  1SGD I;  2JZM A;  2BCA A;  1SMG A;  2K2A A;  2HQW A;  2L50 A;  2LVV A;  3CGA A;  1NSH A;  3I5H B;  4MEW A;  5CPV A;  2ISD A;  3SG7 A;  4ETO A;  1FI6 A;  1QLK A;  2M5X A;  2JTZ A;  2KMP A;  2SAS A;  1X02 A;  2KAX A;  5ER4 X;  1TOP A;  5HYD A;  1XA5 A;  2WCY A;  1TBQ R;  3EVU A;  1IQ3 A;  2BCB A;  3OX5 A;  3GK4 X;  4PAL A;  2KQY A;  1C07 A;  2JTT A;  1H8B A;  2LVK A;  3QRX A;  1TCF A;  1MWN A;  2BBN A;  3ICB A;  2FOT A;  2GKV A;  3SGQ I;  2OTG C;  3SG6 A;  4XYN A;  3BQ3 A;  5HLV A;  4I5N B;  1S6C A;  2PSR A;  3F45 A;  5TNC A;  3CR4 X;  3JVT C;  1BUS A;  2KYF A;  1RTP 1;  4OKH A;  3GK1 A;  4HGU A;  2CT9 A;  3HH2 C;  3DD4 A;  3BUO B;  2LMT A;  4C0L A;  1XFW O;  4NDD A;  5I2L A;  2Y1N A;  3FIA A;  3IF7 A;  1S5G Y;  2MA2 A;  1XK4 C;  1NIW A;  1KQM C;  1SR6 C;  1V1G A;  4YGE B;  1PUL A;  3SEK C;  4PE4 A;  2NLN A;  1JF0 A;  1OYV I;  1FYB A;  3B4V C;  2LC5 A;  1CDL A;  2KYC A;  4JPZ B;  1KK8 C;  1Z7K B;  3HX4 A;  4NQG A;  1NCX A;  2BKI B;  4C0K A;  1SGN I;  2HET A;  3FWC A;  3PN7 B;  1TUR A;  1BLQ A;  2OPO A;  1DVI A;  1R2U A;  2WOR A;  1QAT A;  2QPT A;  4ZCV A;  2M7L A;  2LV7 A;  3PLF B;  5B8I B;  1TRF A;  3D0Y A;  4ORA B;  4PE7 A;  5HKY A;  3MSE B;  4TNC A;  1PVB A;  1B4C A;  5JHW C;  1S3P A;  2HPS A;  3CWG A;  1A2X A;  2Y4Q A;  1DJY A;  5D7F A;  4DIR A;  1RK9 A;  4GI3 C;  1SL7 A;  3NSI A;  1OMR A;  1NWD A;  1CNP A;  2GKR I;  1TNQ A;  2GGZ A;  1CFC A;  1QVI Z;  1BR1 B;  1UHH A;  4NDC A;  2SCP A;  4M2Q A;  4ORB B;  3PSR A;  2ZKM X;  1QLS A;  1ALV A;  1CDP A;  3I5I B;  1SCM C;  1SL8 A;  3TJQ A;  1JUO A;  5GQQ C;  1DJI A;  4MN0 A;  1G4Y R;  4XJK A;  5F6T A;  1LA0 A;  1B1G A;  2JWW A;  3DVM A;  4A4B A;  1UUC A;  1CTR A;  1EJ3 A;  1ODB A;  5PAL A;  2BBM A;  2NU0 I;  2KFF A;  2VRG A;  4YGC B;  1ZMZ A;  4CPV A;  1BR4 B;  1C7V A;  1N0Y A;  1UVG A;  3BUN B;  4BY5 A;  3SJS A;  1KWO B;  1XO5 A;  1AJ5 A;  3KO0 A;  1B9A A;  1PPF I;  3VRQ A;  2LE9 B;  2BKH B;  1ALW A;  3H4S E;  3WHT B;  2LUC A;  2OVO A;  1A29 A;  1OZS A;  1YTZ C;  1WDC C;  3NXA A;  4HRH A;  3WXA A;  1CFF A;  1REC A;  1M8C A;  1IWQ A;  1EG3 A;  1JSA A;  4U8D A;  1WRL A;  1RRO A;  2L0P A;  4I5J A;  1OVO A;  2SGF I;  4WRI A;  1B8C A;  1KQM B;  2N71 A;  2LHI A;  1YTP A;  4OVN F;  5I2O A;  1JBA A;  3GK2 A;  1DT7 B;  1HJA I;  1MF8 B;  1DJG A;  2G9B A;  4ORC B;  3OB1 B;  3BOW A;  1F4Q A;  2Y5I A;  4CID A;  3SG5 A;  2SGQ I;  4CLN A;  3SG4 A;  1V1F A;  1BT6 A;  4OVO A;  1YVL A;  2ZRS A;  1OSA A;  1QX7 A;  1CM1 A;  2NU2 I;  1DF0 B;  2CTN A;  3PFV A;  3VRO A;  1U5I A;  3EKH A;  5D69 A;  4BY4 A;  2GGM A;  1IW4 A;  1KMA A;  3OX6 A;  4DS7 A;  1GGZ A;  1XFV O;  2WCE A;  1KFU L;  2SGP I;  1N65 A;  1YX7 A;  1GGW A;  1MUX A;  4OV2 A;  2K2F A;  1PCE A;  2Q4U A;  1QIW A;  1UVF A;  1UWO A;  5ER5 A;  4AQI A;  2N17 A;  2MLE C;  2F33 A;  1AN1 I;  1L2O C;  1SCM B;  3PM8 A;  3I5F B;  1SGP I;  4QJ5 B;  2LEO A;  2JPT A;  2M97 A;  1IJ5 A;  2NZ0 A;  3OHM B;  1Y1B A;  1SGR I;  1Y0V H;  1QXP A;  4GGF A;  2EC6 B;  2L51 A;  4DRW A;  3TS5 C;  2F3C I;  4PHJ A;  2F3Y A;  1HT9 A;  2CNP A;  1KFX L;  1CB1 A;  4WQ3 A;  1LVC D;  4YBH B;  1B47 A;  1PSB A;  1F71 A;  4PDZ A;  3BUW B;  5CSN A;  1IRJ A;  1J1E A;  4IL1 A;  1UHI A;  2LNK A;  3LLE A;  1SPY A;  1TIZ A;  2CCM A;  1EG4 A;  1N2D A;  1TTX A;  3AAJ A;  2L2E A;  5DKR A;  3TUY C;  1YUR A;  3PAL A;  4ICB A;  1QX5 B;  2EHB A;  1YUS A;  5I2Q A;  2PRU A;  3D0Y B;  4YGB B;  1ZUZ A;  1M45 A;  3NSL A;  2H61 A;  2N52 A;  2A4J A;  4GNK B;  1CT4 I;  3BXK A;  4GAO A;  2FCD A;  2KQ6 A;  1MHO A;  4MSP A;  3O6B A;  2KI4 C;  1Y6W A;  1JWD A;  1B8L A;  3LL8 B;  2L5X B;  1OMU A;  1K2H A;  5AEQ A;  2JYY A;  2MLF C;  4M2P A;  2HF5 A;  3CR2 A;  3TDZ A;  3BUX B;  3BYA A;  1QTX A;  1YUU A;  4R1E A;  4OR9 B;  5AER A;  1KQV A;  2D8N A;  2OS8 B;  1GQM A;  1M63 B;  1QAS A;  2MBX A;  4N1F A;  2JQ6 A;  1QIV A;  3CS1 A;  1EL4 A;  2KI6 D;  1CE3 A;  1A75 B;  2SGD I;  3IQQ A;  1CDM A;  1NP8 A;  3EK4 A;  3DVE A;  1IJ6 A;  2JRF A;  1B8R A;  1YRU B;  1R6P A;  1XYD A;  2JXL A;  1XVJ A;  5KSZ A;  2KFG A;  1Y1A A;  2P6A C;  4FQO A;  1CSO I;  1TNW A;  1JC2 A;  2Y1M A;  4PCW A;  1OMV A;  1QV0 A;  5J3X A;  1KCY A;  1OMT A;  1NX1 A;  1CHO I;  1TN4 A;  1CMF A;  2M29 A;  1NX3 A;  1YUT A;  2JC2 A;  4MBE A;  2BE4 A;  2I7A A;  3CR5 X;  4PE1 A;  5DKN A;  1DJZ A;  1SRA A;  1LR8 A;  1OOJ A;  2JUL A;  2KAY A;  2KMO A;  1QS7 A;  2O60 A;  1K94 A;  1CGJ I;  3AKA A;  2MHH A;  4N5X A;  4XJK B;  3EK7 A;  1ZAC A;  1SW8 A;  2L4I A;  2LLS A;  1DJW A;  2BL0 C;  2OTG B;  4GGF C;  1HDL A;  2KHN A;  2L4H A;  4I5L B;  5KTY A;  3TUY B;  1Y1C A;  2FJU B;  1F4O A;  1QV1 A;  2CXJ A;  4MLW A;  2K0J A;  3LK0 A;  2LUX A;  2R2I A;  3JVT B;  2BCX A;  2ZRT A;  2NU1 I;  1A03 A;  3QTL D;  1J7Q A;  1IQ5 A;  3I5G C;  1SNL A;  1KFU S;  5CSJ A;  1F55 A;  1S6J A;  1TBR R;  2LHL A;  1IY6 A;  2WC8 A;  1SBJ A;  4A4C A;  2LCP A;  1S1E A;  1SR6 B;  3I5H C;  1AK8 A;  3VRR A;  2JT8 A;  3ZNI A;  1SYM A;  1FW4 A;  3DF0 A;  4AQJ A;  1LIN A;  2JZI A;  2NXQ A;  2V53 A;  2K7B A;  1S5G Z;  1K95 A;  2KAV A;  1KK8 B;  2H61 C;  2JOJ A;  4GPL B;  4JQ0 D;  2RGI A;  1BG1 A;  1K9U A;  1EH2 A;  4UPG A;  2K61 A;  1KFX S;  1W7J B;  2O5G A;  4GFT A;  4SGB I;  1UUR A;  2LVJ A;  2MRD A;  3AAK A;  4WQ2 A;  4YI8 A;  3SGB I;  1LR9 A;  4GUK A;  4L9M A;  1IKU A;  1IGV A;  1LA3 A;  3JTD C;  3FWB A;  2F2P A;  4GBA A;  2KFH A;  3BUM B;  2LM5 A;  2AMI A;  2KMQ A;  3RLZ A;  5FYX A;  1OZO A;  1CLM A;  1BOD A;  1SY9 A;  3SG2 A;  5AFP A;  2NCO A;  4C0J A;  1TNX A;  3KHE A;  3NSK A;  3OB2 B;  1WLZ A;  1DGV A;  1NPQ A;  1YX8 A;  3EVR A;  1AP4 A;  4YRU A;  1C7W A;  1XFY O;  1DS2 I;  1NX2 A;  3FS7 A;  4JWQ A;  3VRP A;  1FBV A;  2B0U C;  2WCB A;  1DF0 A;  1DGU A;  1TUS A;  2ARP F;  2JNF A;  2ZFD A;  4CFR A;  1CLB A;  2ZN9 A;  1G33 A;  3WNX B;  1XFU O;  1XFZ O;  2WND A;  4Q04 A;  3EKJ A;  4MVF A;  1IG5 A;  1BMO A;  1LKJ A;  1XFX O;  1J1D A;  2KI6 C;  3VGO A;  1BJF A;  1QVI Y;  1S6I A;  2NCP A;  3EVV A;  4MZK A;  2M49 B;  1RJV A;  3DVK A;  1WDC B;  2GV5 A;  3CLN A;  2K7D A;  2LMV A;  4HSZ A;  4YGD B;  1YVH A;  2G2B A;  1K9K A;  1UUS A;  1WRZ A;  2EGD A;  2PAS A;  1M31 A;  1NCY A;  2KCX A;  1UHN A;  3C1V A;  3SIA A;  3I5I C;  1A4P A;  2NU3 I;  5G08 A;  3CTN A;  2QQD A;  2K8M B;  2KNE A;  1TNP A;  1UP5 A;  1K90 D;  2JT0 A;  2KGB C;  2JXC A;  1OMD A;  3K21 A;  2Q91 A;  1AVS A;  3AKB A;  1PSR A;  4DCK A;  3SG3 A;  4MZL A;  1KSM A;  1R0R I;  2WOS A;  4PE0 A;  3E3R A;  2BE6 A;  3DVJ A;  3D10 A;  2M1K B;  1CKK A;  1PRW A;  2AAO A;  1BF5 A;  3JTD B;  1HQV A;  1S26 D;  1EXR A;  2F3Z A;  1OE9 B; 
#chains in the Genus database with same CATH topology
 1KWO C;  1NCZ A;  4WP4 A;  1PAL A;  4CFQ A;  5FUY A;  1H0Z A;  1Q80 A;  1ZOT B;  2KGR A;  4IJ7 A;  2L7X A;  4D1E A;  2ZND A;  2I2R E;  1L2O B;  2NU4 I;  2JT3 A;  2L5Y A;  1SKT A;  3TS5 B;  3PM2 A;  2FCE A;  2KBM A;  4F7F A;  2K7O A;  2JXD A;  3L47 A;  3R72 A;  2SGE I;  1FY7 A;  2LLT A;  3ZWH A;  5CCL A;  2I94 A;  1VRK A;  1NX0 A;  2EC6 C;  1FI5 A;  2F2O A;  1TWO A;  2JNX A;  1M8B A;  3O2P A;  1K93 D;  2KBI A;  5AAN A;  5CSF A;  1JFK A;  1CT0 I;  1JF2 A;  3HCM A;  3BOW B;  2B1U A;  1XX6 A;  3E2I A;  5HLO A;  5K89 A;  3D75 A;  1RWY A;  3UGL A;  2M1U A;  3EK8 A;  2KDH A;  2LVI A;  2TN4 A;  1MQ1 A;  1B7T Y;  3D00 A;  2PVB A;  4MRX A;  2ZN8 A;  4FKD A;  3PN7 C;  2L98 A;  3KF9 A;  2QAC A;  3BJH A;  2LAN A;  2M3W A;  1AJ4 A;  1CDN A;  3OP0 A;  5HKZ A;  1JFJ A;  5IBW A;  4USL A;  2BCA A;  1FI6 A;  5CPV A;  2M5X A;  2SAS A;  2KAX A;  3OX5 A;  1H8B A;  1C07 A;  2GKV A;  1MWN A;  4XYN A;  1S6C A;  2PSR A;  3F45 A;  3JVT C;  1RTP 1;  3DD4 A;  2MA2 A;  1OYV I;  1JF0 A;  1FYB A;  2DB6 A;  1KK8 C;  1Z7K B;  2OU2 A;  3FWC A;  1XFR A;  1BLQ A;  1DVI A;  1QAT A;  2XRC A;  2LV7 A;  2LUY A;  4PE7 A;  4TNC A;  1S3P A;  3CWG A;  1A2X A;  3NSI A;  2GKR I;  1CNP A;  4NDC A;  4ORB B;  2L2C A;  4XJK A;  4YGC B;  4CPV A;  1BR4 B;  1AJ5 A;  1B9A A;  2DIP A;  4HRH A;  1YTZ C;  3B86 A;  5EL2 A;  4OVN F;  3GK2 A;  1DT7 B;  3N7H A;  1Z2C B;  3CZ2 A;  3K1E A;  4CID A;  1F4Q A;  5HL1 A;  1Y8F A;  3SG4 A;  4OVO A;  4AML A;  1CM1 A;  2NU2 I;  3PFV A;  5D69 A;  2WCE A;  1KFU L;  1N65 A;  2K2F A;  1QIW A;  5ER5 A;  1AN1 I;  3I5F B;  4QJ5 B;  1IJ5 A;  1KBF A;  1Y0V H;  4DRW A;  2P71 A;  4UXJ A;  1LVC D;  2GIV A;  3BUW B;  2WC5 A;  3LLE A;  3AAJ A;  5J8C A;  3TUY C;  3PAL A;  1LS8 A;  3FSX A;  2N52 A;  1CT4 I;  2KQ6 A;  2KI4 C;  1JWD A;  1B8L A;  3LL8 B;  3FC3 A;  5AEQ A;  2MLF C;  4M2P A;  3TDZ A;  3BUX B;  3R5B A;  5AER A;  2D8N A;  1KBE A;  4N1F A;  4INX A;  1CE3 A;  1NP8 A;  3EK4 A;  1IJ6 A;  2K9H A;  2JXL A;  1R6P A;  2RIJ A;  1JC2 A;  2Y1M A;  1OMV A;  1QV0 A;  5J3X A;  4INW A;  1CHO I;  1TN4 A;  3D74 A;  3R1O A;  4PE1 A;  5DKN A;  2K60 A;  4N5X A;  4XJK B;  2QQ0 A;  4GGF C;  1F4O A;  1QV1 A;  2LUX A;  2BCX A;  3QTL D;  1A03 A;  1IQ5 A;  5FUV A;  2WC8 A;  4A4C A;  2LCP A;  3I5H C;  5DIC A;  1SYM A;  1FW4 A;  2KAV A;  2H61 C;  2JOJ A;  2K61 A;  1KFX S;  3SGB I;  1LR9 A;  1IKU A;  1LA3 A;  3QWP A;  1CLM A;  5D3O A;  2YGU A;  5AFP A;  4C0J A;  1X4S A;  3NSK A;  1WLZ A;  4YRU A;  1XFY O;  3VRP A;  2B0U C;  1TUS A;  4B6D A;  2QDI A;  1ULK A;  4CFR A;  3L4A A;  3EKJ A;  3QAH A;  1LKJ A;  2CWF A;  2M49 B;  3DVK A;  2K7D A;  2G2B A;  1K9K A;  1UUS A;  2EGD A;  2PAS A;  2KCX A;  1A4P A;  2NU3 I;  2K8M B;  2KNE A;  1TNP A;  1UP5 A;  1K90 D;  2JT0 A;  1Z4H A;  4DCK A;  2BE6 A;  3DVJ A;  1BF5 A;  1HQV A;  3D0Y A;  1S26 D;  1EXR A;  1MXE A;  1B7T Z;  5I8N A;  1L7Z A;  2MJW B;  2OZU A;  1W7I B;  2F8P A;  2WCF A;  1D1O A;  2ZNE A;  4I5K A;  2COL B;  4A24 A;  3OXG A;  3D73 A;  4GGN A;  1A75 A;  2IS9 A;  1CFD A;  2LP3 A;  2OD1 A;  5HKW A;  1DJX A;  4P2Y B;  3D76 A;  1DJH A;  4E68 A;  2W0T A;  5CSI A;  1E8A A;  2AUC A;  4YI9 A;  1SL9 A;  1SGY I;  1DEK A;  2CWH A;  2KSP A;  1J7P A;  3UO9 A;  5HI7 A;  3OBV A;  1CFP A;  1SGQ I;  1Y1U A;  1F70 A;  1T14 A;  3DZT A;  1LR7 A;  2H2K A;  1MT1 A;  1SK6 D;  2CBL A;  1J7O A;  2P6B B;  4ZCU A;  2GKT I;  1IH0 A;  3A8R A;  1U5I B;  4DUQ A;  5EX3 A;  2I18 A;  4FTG A;  3KEV A;  4QJ4 B;  3TDI A;  2CJS C;  1SCV A;  1QX2 A;  1P9G A;  2BL0 B;  2QEB A;  1DS3 I;  1FAQ A;  1KK7 Y;  2Y0M A;  3VRN A;  3DYE A;  2QEO A;  3I5G B;  4OCI A;  1CMG A;  1K8U A;  3CZ0 A;  1SGD I;  1SMG A;  2K2A A;  2L50 A;  2ISD A;  5HKY A;  4MEW A;  2WCJ A;  1QLK A;  2KMP A;  1X02 A;  5HYD A;  1XA5 A;  1TBQ R;  3EVU A;  2BCB A;  3GK4 X;  1W3S A;  2JTT A;  3QRX A;  2BBN A;  2FOT A;  3SGQ I;  3SG6 A;  4I5N B;  3CR4 X;  1BUS A;  3GK1 A;  4HGU A;  2CT9 A;  4KYN A;  1NIW A;  1KQM C;  2N1A B;  1SR6 C;  3B4V C;  2PQ8 A;  3B87 A;  2LC5 A;  1UHA A;  1NCX A;  2HET A;  3PN7 B;  4ZCV A;  5B8I B;  3MSE B;  5FI7 A;  1B4C A;  2Y4Q A;  1DJY A;  1RK9 A;  2P70 A;  1OMR A;  2GGZ A;  2RC4 A;  1QVI Z;  1BR1 B;  1UHH A;  2SCP A;  1ALV A;  1CDP A;  3I5I B;  1SCM C;  1JUO A;  2E73 A;  4MN0 A;  5F6T A;  1LA0 A;  1B1G A;  3CYZ A;  1C7V A;  1N0Y A;  3BFB A;  3KO0 A;  3VRQ A;  2YQP A;  3WHT B;  2LUC A;  2OVO A;  2WC6 A;  1JSA A;  1RRO A;  4I5J A;  2SGF I;  1YTP A;  1JBA A;  1DJG A;  1TBN A;  4ORC B;  1NXU A;  1BT6 A;  3B88 A;  4UXI A;  2CTN A;  3VRO A;  2UVO A;  4DS7 A;  1MJB A;  1MUX A;  2UZ3 A;  1L2O C;  2LEO A;  2JPT A;  1Q9B A;  4GGF A;  3TS5 C;  4PHJ A;  1WTJ A;  2F3Y A;  4WQ3 A;  4YBH B;  2VRW B;  1PSB A;  3FE6 A;  4PDZ A;  1IRJ A;  1J1E A;  1UHI A;  2LNK A;  2CCM A;  2L2E A;  5DKR A;  1YUR A;  2EHB A;  2H61 A;  2FCD A;  1MHO A;  3L4L A;  1Y6W A;  3BFH A;  2L5X B;  3EG5 B;  3BYA A;  1QTX A;  4OR9 B;  2OS8 B;  1GQM A;  2KLE A;  3S0A A;  2JQ6 A;  1QIV A;  2KI6 D;  2SGD I;  1CDM A;  3DVE A;  2BNX A;  1B8R A;  1XVJ A;  2P6A C;  4FQO A;  1NX3 A;  1YUT A;  3CR5 X;  1SRA A;  1OOJ A;  2JUL A;  1QS7 A;  1CGJ I;  3AKA A;  2MHH A;  2L4I A;  1DJW A;  2OTG B;  2KHN A;  3TUY B;  3D78 A;  2E5R A;  2K0J A;  2R2I A;  5CSJ A;  2ROW A;  1F55 A;  1IY6 A;  3NHT A;  2JT8 A;  3DF0 A;  4AQJ A;  2K7B A;  1S5G Z;  1K95 A;  4JQ0 D;  4GPL B;  2O5G A;  3AAK A;  2MRD A;  4L9M A;  3JTD C;  3FWB A;  3BUM B;  3RLZ A;  2NCO A;  1TNX A;  3OB2 B;  1DGV A;  1NPQ A;  2JPO A;  1YX8 A;  1C7W A;  1NX2 A;  3R5C A;  1FBV A;  1DF0 A;  1OW4 A;  1XFZ O;  4MVF A;  1SSE B;  1QVI Y;  1S6I A;  1WDC B;  2LMV A;  3TOA A;  4YGD B;  1NCY A;  5G08 A;  3IVT A;  2KGB C;  3K21 A;  3S0G A;  1AVS A;  3SG3 A;  4PE0 A;  3E3R A;  3KY9 A;  2KLD A;  2DKV A;  1J7Q A;  2M9G A;  1V1I A;  1DEL A;  4QJ3 B;  2ELI A;  2LAP A;  4YGA A;  4PHK A;  1ORG A;  4P5O E;  2M8U A;  4F0Z B;  1KK7 Z;  2KOT A;  2V1C C;  5KU1 A;  1TGS I;  3NSO A;  3O78 A;  1RFJ A;  2FNF X;  1PJU A;  3S0D A;  1N13 A;  1M46 A;  5I94 A;  1WLM A;  3GOF A;  1FF1 A;  3CZT X;  2BAP A;  2M7N A;  3TDU A;  1J7R A;  2LP2 A;  4PHN A;  2QQC A;  1QJT A;  3I5F C;  1ZFS A;  3PAT A;  3SIB A;  3LK1 A;  2HQ8 A;  1M39 A;  2H8V A;  1AUI B;  3DF0 B;  4JD9 A;  2LLU A;  3WHU B;  3OVO A;  2PAL A;  1FPW A;  2YUU A;  1F54 A;  1CGI I;  1MXL C;  2JU0 A;  3RZS A;  1NUB A;  3A4U B;  1HPT A;  2LB7 A;  1UHK A;  1WY9 A;  1K96 A;  1YR5 A;  2E6W A;  1H4B A;  3KPX A;  4N1G A;  1WRK A;  2K7C A;  5FI2 A;  1PTQ A;  1CLL A;  1CM4 A;  3IQO A;  5BPJ A;  3O4Y A;  1WGC A;  4M2O A;  5JOL A;  1J55 A;  1PK0 D;  4AOM A;  1R79 A;  1BU3 A;  2FJY A;  2E30 A;  5DAE A;  1DMO A;  1S36 A;  1K7T A;  1TIH A;  2HQW A;  3CGA A;  2LVV A;  2JTZ A;  5ER4 X;  1TOP A;  1ULN A;  2WCY A;  1IQ3 A;  3D77 A;  3ICB A;  5HLV A;  3S0F A;  3R5A A;  2KYF A;  4OKH A;  1TBO A;  3BFA A;  3HH2 C;  1OOF A;  3BUO B;  2LMT A;  5I2L A;  3SS3 A;  2Y1N A;  3FIA A;  1XBT A;  3IF7 A;  3UNW A;  2WGC A;  1S5G Y;  3B7A A;  1XK4 C;  1V1G A;  1PUL A;  3SEK C;  2NLN A;  1WKX A;  2B8T A;  3HX4 A;  4NQG A;  2BKI B;  4C0K A;  1R2U A;  2WOR A;  2PQL A;  4ORA B;  3SS5 A;  5JHW C;  4DIR A;  5EX0 A;  5E3Q A;  2QPO A;  1TNQ A;  2GVI A;  3PSR A;  2ZKM X;  1QLS A;  1TOT A;  1DJI A;  1UUC A;  1CTR A;  1EJ3 A;  1ODB A;  2NU0 I;  2VRG A;  3UOE A;  1UVG A;  4BY5 A;  3SJS A;  1KWO B;  1XO5 A;  1PPF I;  3MEK A;  3H4S E;  3WXA A;  3UEY A;  4U8D A;  1OVO A;  4WRI A;  1B8C A;  1KQM B;  2CWG A;  5E3R A;  1MF8 B;  2G9B A;  3BOW A;  2Y5I A;  1FAR A;  2SGQ I;  1DQE A;  4CLN A;  1OSA A;  2GTE A;  3UFF A;  3EKH A;  3OX6 A;  1GGZ A;  1YX7 A;  3CXL A;  1PCE A;  3E59 A;  3R5D A;  2Q4U A;  1UWO A;  4AQI A;  2N17 A;  1SCM B;  2M97 A;  3UGI A;  1SGR I;  2A20 A;  2ORW A;  2EC6 B;  2F3C I;  1KFX L;  3BJI A;  1CB1 A;  1F71 A;  2WCK A;  4IL1 A;  1OOI X;  1TIZ A;  1EG4 A;  4ICB A;  1QX5 B;  1GM0 A;  1YUS A;  2PRU A;  3D0Y B;  4YGB B;  1M45 A;  4GNK B;  4MSP A;  2KPH A;  3R1P A;  2JW6 A;  1YUU A;  1KQV A;  1ULM A;  1M63 B;  1EL4 A;  1A75 B;  2JRF A;  1XYD A;  5KSZ A;  2KFG A;  1Y1A A;  1CSO I;  1W9Z A;  1TNW A;  4PCW A;  1C3Z A;  1CMF A;  2JC2 A;  4MBE A;  1LR8 A;  2KAY A;  1Z2I A;  2O60 A;  1K94 A;  3EK7 A;  1ZAC A;  2LLS A;  2BL0 C;  1HDL A;  2L4H A;  4I5L B;  1OOH A;  1Y1C A;  2FJU B;  2CXJ A;  4MLW A;  3JVT B;  3NGV A;  3I5G C;  1KFU S;  3UGD A;  1S6J A;  3VB1 A;  2LHL A;  1S1E A;  3ZNI A;  1S20 A;  3FSY A;  1KK8 B;  1EH2 A;  4UPG A;  4DNC A;  4GFT A;  4SGB I;  1UUR A;  4YI8 A;  4WQ2 A;  1IGV A;  2F2P A;  4GBA A;  2KFH A;  3OL0 A;  2LM5 A;  2KMQ A;  1BOD A;  5FYX A;  2V1C A;  3B6X A;  1AP4 A;  2QEV A;  1DS2 I;  1DGU A;  3FE9 A;  1XFU O;  4Q04 A;  1IG5 A;  3VGO A;  1XFX O;  1J1D A;  2KI6 C;  3EVV A;  4UXH A;  1RJV A;  3CLN A;  4HSZ A;  5FUX A;  1YVH A;  1WRZ A;  1M31 A;  1UHN A;  3C1V A;  3I5I C;  3TOB A;  2Q91 A;  1R0R I;  1PSR A;  4MZL A;  5J8F A;  3D10 A;  1QWV A;  1PRW A;  3JTD B;  4NDB A;  1OE9 B;  4JKT A;  1PVA A;  4PHM A;  1IY5 A;  1UHJ A;  3OGN A;  1MR8 A;  5JJG A;  1BOC A;  3DXL A;  2PMY A;  1AHR A;  5CCM A;  3RU0 A;  3LCP C;  2L8E A;  1F8H A;  9WGA A;  1Y1X A;  1YRT B;  1NYA A;  3CZ1 A;  5DKQ A;  4HRG A;  3GOX A;  2KI4 B;  5AXI A;  2ENN A;  3R1V A;  1K9P A;  1DTL A;  2DOQ A;  2PYQ A;  1YU6 C;  2M0R A;  4MZJ A;  2JA1 A;  1TCO B;  1XK4 A;  3M0W A;  2ORV A;  2KMR A;  4HRE E;  1OQP A;  2MAZ A;  3S0B A;  3TO6 A;  3RM1 A;  2BEC A;  1G8I A;  2LMU A;  2OS8 C;  1GJY A;  1KSO A;  1LXF C;  3TZ1 A;  2BUS A;  1CT2 I;  4MRY A;  5HQ8 A;  2ENZ A;  2ERW A;  1U5K A;  1SGE I;  2JZM A;  1V1H A;  4ETO A;  3I5H B;  1NSH A;  3SG7 A;  3S0E A;  2X3T A;  3VDU A;  4PAL A;  2KQY A;  2LVK A;  1TCF A;  3OXF A;  2OTG C;  3BQ3 A;  5TNC A;  1W4R A;  3PDN A;  3CAB A;  5E3P A;  4C0L A;  1XFW O;  4NDD A;  4YGE B;  1VDD A;  4PE4 A;  1TUZ A;  1CDL A;  2KYC A;  4JPZ B;  1SGN I;  1TUR A;  3SS4 A;  2OPO A;  2J87 A;  2QPT A;  2M7L A;  3PLF B;  1TRF A;  1PVB A;  2HPS A;  5D7F A;  4GI3 C;  1SL7 A;  1NWD A;  1CFC A;  1X74 A;  2ODD A;  4M2Q A;  3TJQ A;  1SL8 A;  5GQQ C;  1G4Y R;  2X52 A;  2JWW A;  3DVM A;  4A4B A;  5PAL A;  2BBM A;  3CDN A;  2KFF A;  1ZMZ A;  3BUN B;  2LE9 B;  2BKH B;  1ALW A;  7WGA A;  1A29 A;  1OZS A;  1K7U A;  1WDC C;  2WCH A;  3NXA A;  4FQT A;  1CFF A;  1REC A;  1M8C A;  1IWQ A;  1EG3 A;  1WRL A;  3V2L A;  2L0P A;  4MPI A;  2N71 A;  2LHI A;  5I2O A;  2QQE A;  1HJA I;  3OB1 B;  3SG5 A;  3Q8I A;  5FUW A;  1V1F A;  1YVL A;  2ZRS A;  1QX7 A;  1DC1 A;  1DF0 B;  4BY4 A;  1IW4 A;  1U5I A;  2GGM A;  1KMA A;  1XFV O;  5FI6 A;  2SGP I;  1GGW A;  4OV2 A;  1UVF A;  2MLE C;  2F33 A;  3PM8 A;  1SGP I;  2NZ0 A;  3OHM B;  1Y1B A;  1QXP A;  2L51 A;  4OZD A;  1PTR A;  1HT9 A;  2QEH A;  2CNP A;  1B47 A;  5CSN A;  1C3Y A;  2J9R A;  1SPY A;  1N2D A;  1TTX A;  5I2Q A;  1ZUZ A;  3NSL A;  2A4J A;  3BXK A;  4GAO A;  3O6B A;  1OMU A;  2WCL A;  1K2H A;  2JYY A;  2HF5 A;  3CR2 A;  4R1E A;  3DY9 A;  2MBX A;  1QAS A;  3CS1 A;  3FE8 A;  3IQQ A;  1TUJ A;  1YRU B;  1OOG A;  1KCY A;  3O4X A;  1OMT A;  1NX1 A;  2M29 A;  2WCM A;  2BE4 A;  2I7A A;  1DJZ A;  2KMO A;  1MJA A;  1SW8 A;  5KTY A;  3TO7 A;  4PT1 A;  1HEV A;  1WGT A;  3QME A;  3LK0 A;  2NU1 I;  2ZRT A;  1SNL A;  1TBR R;  1SBJ A;  1SR6 B;  1AK8 A;  3VRR A;  3OXL A;  3PJI A;  1LIN A;  2JZI A;  2NXQ A;  2V53 A;  3VDP A;  1BG1 A;  1K7V A;  2RGI A;  1K9U A;  1W7J B;  2LVJ A;  4GUK A;  4E1R A;  3UEJ A;  2AMI A;  1OZO A;  1SY9 A;  3SG2 A;  2ERB A;  3KHE A;  3EVR A;  1IIO A;  2WVJ A;  3FS7 A;  4JWQ A;  2WCB A;  2ARP F;  2JNF A;  2ZFD A;  1CLB A;  2ZN9 A;  1G33 A;  3WNX B;  1MJ9 A;  2WND A;  1XA6 A;  3VE5 A;  1BMO A;  1P28 A;  1BJF A;  2NCP A;  4MZK A;  2GV5 A;  1P9Z A;  3SIA A;  3NHI A;  4E1P A;  3CTN A;  2QQD A;  2JXC A;  1OMD A;  3AKB A;  1KSM A;  2WOS A;  1CKK A;  2M1K B;  2AAO A;  1RFH A;  4JCV E;  3TO9 A;  2F3Z A; 
#chains in the Genus database with same CATH homology
 1PVA A;  2M9G A;  1KWO C;  1MXE A;  4PHM A;  1IY5 A;  1B7T Z;  5I8N A;  1V1I A;  1UHJ A;  4QJ3 B;  1L7Z A;  2ELI A;  1NCZ A;  1PAL A;  2MJW B;  4CFQ A;  5FUY A;  1H0Z A;  1W7I B;  2F8P A;  2LAP A;  2WCF A;  1Q80 A;  1ZOT B;  2KGR A;  2ZNE A;  1MR8 A;  4YGA A;  1D1O A;  5JJG A;  2L7X A;  4PHK A;  4D1E A;  4I5K A;  2ZND A;  2COL B;  4P5O E;  2I2R E;  1L2O B;  2M8U A;  4F0Z B;  1BOC A;  1KK7 Z;  2NU4 I;  2JT3 A;  2KOT A;  4A24 A;  2PMY A;  3OXG A;  4GGN A;  1SKT A;  2V1C C;  5KU1 A;  1AHR A;  1A75 A;  5CCM A;  2IS9 A;  1CFD A;  3TS5 B;  2LP3 A;  1TGS I;  3NSO A;  3O78 A;  5HKW A;  1DJX A;  3LCP C;  2OD1 A;  3RU0 A;  2FCE A;  1RFJ A;  2FNF X;  4P2Y B;  1PJU A;  2L8E A;  1F8H A;  1DJH A;  1N13 A;  1M46 A;  1WLM A;  3GOF A;  1FF1 A;  3CZT X;  2KBM A;  1Y1X A;  1YRT B;  2M7N A;  4E68 A;  1NYA A;  2W0T A;  3TDU A;  2K7O A;  2JXD A;  5CSI A;  5DKQ A;  1J7R A;  2LP2 A;  2SGE I;  1E8A A;  2AUC A;  4PHN A;  4YI9 A;  1SL9 A;  1SGY I;  2QQC A;  2KSP A;  4HRG A;  1QJT A;  1J7P A;  3GOX A;  3I5F C;  1ZFS A;  2LLT A;  2KI4 B;  3ZWH A;  5AXI A;  3PAT A;  5CCL A;  2I94 A;  5HI7 A;  1VRK A;  3SIB A;  1NX0 A;  2EC6 C;  2ENN A;  3LK1 A;  1FI5 A;  2F2O A;  1CFP A;  1K9P A;  1DTL A;  2DOQ A;  1SGQ I;  1Y1U A;  2HQ8 A;  1F70 A;  2JNX A;  1M39 A;  1AUI B;  1M8B A;  3DF0 B;  3O2P A;  2LLU A;  1K93 D;  1LR7 A;  1YU6 C;  2H2K A;  2M0R A;  3WHU B;  1MT1 A;  2KBI A;  3OVO A;  2PAL A;  1FPW A;  4MZJ A;  2JA1 A;  1SK6 D;  1TCO B;  2CBL A;  5AAN A;  5CSF A;  1JFK A;  2YUU A;  1J7O A;  1XK4 A;  3M0W A;  1CT0 I;  1JF2 A;  1F54 A;  1CGI I;  1MXL C;  2P6B B;  3HCM A;  2JU0 A;  2KMR A;  2ORV A;  4ZCU A;  3BOW B;  2GKT I;  2XRC A;  2B1U A;  1XX6 A;  3E2I A;  5HLO A;  3A8R A;  4HRE E;  5K89 A;  1IH0 A;  1NUB A;  1OQP A;  3A4U B;  1HPT A;  1UHK A;  2MAZ A;  1U5I B;  1RWY A;  3UGL A;  4DUQ A;  1WY9 A;  3RM1 A;  1K96 A;  2M1U A;  5EX3 A;  4NDB A;  2I18 A;  1YR5 A;  2BEC A;  2E6W A;  1G8I A;  3KEV A;  4FTG A;  4QJ4 B;  3EK8 A;  2LMU A;  3KPX A;  1H4B A;  2KDH A;  3TDI A;  2LVI A;  2TN4 A;  4N1G A;  2CJS C;  1MQ1 A;  1B7T Y;  1WRK A;  3D00 A;  2PVB A;  2K7C A;  4MRX A;  1PTQ A;  1CLL A;  2ZN8 A;  2OS8 C;  1CM4 A;  1GJY A;  1KSO A;  1SCV A;  3IQO A;  4FKD A;  1QX2 A;  5BPJ A;  1LXF C;  3PN7 C;  2L98 A;  3TZ1 A;  2BUS A;  1CT2 I;  2BL0 B;  3O4Y A;  3KF9 A;  4M2O A;  2QAC A;  4MRY A;  5JOL A;  1DS3 I;  2ENZ A;  5HQ8 A;  2ERW A;  1J55 A;  1PK0 D;  1FAQ A;  2LAN A;  1KK7 Y;  4AOM A;  2M3W A;  1BU3 A;  1R79 A;  3VRN A;  1AJ4 A;  2E30 A;  1CDN A;  1DMO A;  1U5K A;  5DAE A;  1S36 A;  3I5G B;  4OCI A;  3OP0 A;  1CMG A;  1SGE I;  5HKZ A;  1K8U A;  1JFJ A;  5IBW A;  4USL A;  1TIH A;  1SGD I;  2JZM A;  2BCA A;  1SMG A;  1V1H A;  2K2A A;  2HQW A;  2L50 A;  2LVV A;  3CGA A;  1NSH A;  3I5H B;  4MEW A;  5CPV A;  2ISD A;  3SG7 A;  4ETO A;  1FI6 A;  1QLK A;  2M5X A;  2JTZ A;  2KMP A;  2SAS A;  3VDU A;  1X02 A;  2KAX A;  5ER4 X;  1TOP A;  5HYD A;  1XA5 A;  2WCY A;  1TBQ R;  3EVU A;  1IQ3 A;  2BCB A;  3OX5 A;  3GK4 X;  4PAL A;  2KQY A;  1C07 A;  2JTT A;  1H8B A;  1W3S A;  2LVK A;  3QRX A;  1TCF A;  1MWN A;  2BBN A;  3ICB A;  2FOT A;  2GKV A;  3OXF A;  3SGQ I;  2OTG C;  3SG6 A;  4XYN A;  3BQ3 A;  5HLV A;  4I5N B;  1S6C A;  2PSR A;  3F45 A;  5TNC A;  1W4R A;  3CR4 X;  3JVT C;  3PDN A;  2KYF A;  1BUS A;  1RTP 1;  4OKH A;  1TBO A;  3GK1 A;  4HGU A;  2CT9 A;  3HH2 C;  3DD4 A;  3BUO B;  2LMT A;  4C0L A;  1XFW O;  4NDD A;  5I2L A;  2Y1N A;  3FIA A;  1XBT A;  3IF7 A;  1S5G Y;  2MA2 A;  1XK4 C;  1NIW A;  1KQM C;  2N1A B;  1SR6 C;  1V1G A;  4YGE B;  1PUL A;  1VDD A;  3SEK C;  4PE4 A;  2NLN A;  1JF0 A;  1OYV I;  1FYB A;  3B4V C;  2DB6 A;  2LC5 A;  1CDL A;  2KYC A;  4JPZ B;  1KK8 C;  1Z7K B;  2B8T A;  3HX4 A;  4NQG A;  1NCX A;  2BKI B;  4C0K A;  1SGN I;  2HET A;  3FWC A;  3PN7 B;  1TUR A;  1BLQ A;  2OPO A;  1DVI A;  1R2U A;  2WOR A;  2J87 A;  1QAT A;  2QPT A;  4ZCV A;  2M7L A;  2LV7 A;  3PLF B;  5B8I B;  1TRF A;  3D0Y A;  4ORA B;  4PE7 A;  5HKY A;  3MSE B;  2LUY A;  4TNC A;  1PVB A;  1B4C A;  5JHW C;  1S3P A;  2HPS A;  3CWG A;  1A2X A;  2Y4Q A;  1DJY A;  5D7F A;  4DIR A;  1RK9 A;  5EX0 A;  4GI3 C;  1SL7 A;  3NSI A;  1OMR A;  1NWD A;  1CNP A;  2GKR I;  1TNQ A;  2QPO A;  2GGZ A;  1CFC A;  1X74 A;  2ODD A;  1QVI Z;  2GVI A;  1BR1 B;  1UHH A;  4NDC A;  2SCP A;  4M2Q A;  4ORB B;  3PSR A;  2ZKM X;  1QLS A;  1ALV A;  1CDP A;  3I5I B;  1SCM C;  1SL8 A;  3TJQ A;  1JUO A;  1TOT A;  2E73 A;  5GQQ C;  1DJI A;  4MN0 A;  1G4Y R;  4XJK A;  5F6T A;  1LA0 A;  1B1G A;  2JWW A;  3DVM A;  4A4B A;  1UUC A;  1CTR A;  1EJ3 A;  1ODB A;  5PAL A;  2BBM A;  2NU0 I;  2KFF A;  2VRG A;  4YGC B;  1ZMZ A;  4CPV A;  1BR4 B;  1C7V A;  1N0Y A;  1UVG A;  3BUN B;  4BY5 A;  3SJS A;  1KWO B;  1XO5 A;  1AJ5 A;  3KO0 A;  1B9A A;  1PPF I;  2DIP A;  3VRQ A;  2LE9 B;  2BKH B;  1ALW A;  3H4S E;  2YQP A;  3WHT B;  2LUC A;  2OVO A;  3MEK A;  1A29 A;  1OZS A;  1YTZ C;  1WDC C;  3NXA A;  4HRH A;  3WXA A;  1CFF A;  1REC A;  1M8C A;  3UEY A;  1IWQ A;  1EG3 A;  1JSA A;  4U8D A;  1WRL A;  1RRO A;  2L0P A;  4I5J A;  1OVO A;  2SGF I;  4WRI A;  1B8C A;  1KQM B;  2N71 A;  2LHI A;  1YTP A;  4OVN F;  5I2O A;  1JBA A;  3GK2 A;  2QQE A;  1DT7 B;  1HJA I;  1MF8 B;  1DJG A;  2G9B A;  1TBN A;  4ORC B;  3OB1 B;  3BOW A;  1F4Q A;  2Y5I A;  4CID A;  1FAR A;  3SG5 A;  1Y8F A;  2SGQ I;  4CLN A;  3SG4 A;  5FUW A;  1V1F A;  1BT6 A;  4OVO A;  1YVL A;  2ZRS A;  1OSA A;  4UXI A;  1QX7 A;  1CM1 A;  3UFF A;  2NU2 I;  1DF0 B;  2CTN A;  3PFV A;  3VRO A;  1U5I A;  3EKH A;  5D69 A;  4BY4 A;  2GGM A;  1IW4 A;  1KMA A;  3OX6 A;  4DS7 A;  1GGZ A;  1XFV O;  2WCE A;  1KFU L;  2SGP I;  1N65 A;  1YX7 A;  1GGW A;  3CXL A;  1MUX A;  4OV2 A;  2K2F A;  1PCE A;  2Q4U A;  3E59 A;  1QIW A;  1UVF A;  1UWO A;  5ER5 A;  4AQI A;  2N17 A;  2MLE C;  2F33 A;  2UZ3 A;  1AN1 I;  1L2O C;  1SCM B;  3PM8 A;  3I5F B;  1SGP I;  4QJ5 B;  2LEO A;  2JPT A;  2M97 A;  1IJ5 A;  3UGI A;  2NZ0 A;  3OHM B;  1Y1B A;  1KBF A;  1SGR I;  1Y0V H;  1QXP A;  2A20 A;  4GGF A;  2ORW A;  2EC6 B;  2L51 A;  4DRW A;  3TS5 C;  1PTR A;  2F3C I;  4PHJ A;  2F3Y A;  1HT9 A;  2CNP A;  1KFX L;  3BJI A;  4UXJ A;  1CB1 A;  4WQ3 A;  1LVC D;  4YBH B;  2VRW B;  1B47 A;  1PSB A;  1F71 A;  4PDZ A;  3BUW B;  5CSN A;  1IRJ A;  1J1E A;  4IL1 A;  2J9R A;  1UHI A;  2LNK A;  3LLE A;  1SPY A;  1TIZ A;  2CCM A;  1EG4 A;  1N2D A;  1TTX A;  3AAJ A;  2L2E A;  5DKR A;  3TUY C;  1YUR A;  3PAL A;  4ICB A;  1QX5 B;  2EHB A;  1YUS A;  5I2Q A;  2PRU A;  3D0Y B;  4YGB B;  1ZUZ A;  1M45 A;  3NSL A;  2H61 A;  2N52 A;  2A4J A;  4GNK B;  1CT4 I;  3BXK A;  4GAO A;  2FCD A;  2KQ6 A;  1MHO A;  4MSP A;  3O6B A;  2KI4 C;  1Y6W A;  1JWD A;  1B8L A;  3LL8 B;  2L5X B;  3FC3 A;  1OMU A;  1K2H A;  5AEQ A;  2JYY A;  2MLF C;  4M2P A;  2HF5 A;  2JW6 A;  3CR2 A;  3TDZ A;  3BUX B;  3BYA A;  1QTX A;  1YUU A;  4R1E A;  4OR9 B;  5AER A;  1KQV A;  2D8N A;  2OS8 B;  1GQM A;  1M63 B;  1QAS A;  2MBX A;  1KBE A;  4N1F A;  2JQ6 A;  1QIV A;  3CS1 A;  1EL4 A;  2KI6 D;  1CE3 A;  1A75 B;  2SGD I;  3IQQ A;  1CDM A;  1NP8 A;  3EK4 A;  3DVE A;  1IJ6 A;  2K9H A;  2JRF A;  1B8R A;  1YRU B;  1R6P A;  1XYD A;  2JXL A;  1XVJ A;  5KSZ A;  2KFG A;  1Y1A A;  2P6A C;  4FQO A;  1CSO I;  1TNW A;  1JC2 A;  2Y1M A;  4PCW A;  1OMV A;  1QV0 A;  5J3X A;  1KCY A;  1OMT A;  1NX1 A;  1CHO I;  1TN4 A;  1CMF A;  2M29 A;  1NX3 A;  1YUT A;  2JC2 A;  4MBE A;  2BE4 A;  2I7A A;  3CR5 X;  4PE1 A;  5DKN A;  1DJZ A;  1SRA A;  1LR8 A;  1OOJ A;  2JUL A;  2KAY A;  2KMO A;  1QS7 A;  2O60 A;  1K94 A;  1CGJ I;  3AKA A;  2MHH A;  4N5X A;  4XJK B;  3EK7 A;  1ZAC A;  1SW8 A;  2L4I A;  2LLS A;  1DJW A;  2BL0 C;  2OTG B;  4GGF C;  2QQ0 A;  1HDL A;  2KHN A;  2L4H A;  4I5L B;  5KTY A;  3TUY B;  1Y1C A;  2E5R A;  2FJU B;  1F4O A;  1QV1 A;  2CXJ A;  4MLW A;  2K0J A;  3LK0 A;  2LUX A;  2R2I A;  3JVT B;  2BCX A;  2ZRT A;  2NU1 I;  1A03 A;  3QTL D;  1J7Q A;  1IQ5 A;  3I5G C;  1SNL A;  1KFU S;  5CSJ A;  2ROW A;  3UGD A;  1F55 A;  1S6J A;  1TBR R;  2LHL A;  1IY6 A;  5FUV A;  2WC8 A;  1SBJ A;  4A4C A;  2LCP A;  1S1E A;  1SR6 B;  3I5H C;  1AK8 A;  3VRR A;  2JT8 A;  3OXL A;  3ZNI A;  1SYM A;  1FW4 A;  3DF0 A;  4AQJ A;  1LIN A;  2JZI A;  2NXQ A;  2V53 A;  2K7B A;  1S5G Z;  1K95 A;  2KAV A;  1KK8 B;  2H61 C;  2JOJ A;  4GPL B;  4JQ0 D;  2RGI A;  1BG1 A;  3VDP A;  1K9U A;  1EH2 A;  4UPG A;  2K61 A;  1KFX S;  1W7J B;  2O5G A;  4GFT A;  4SGB I;  1UUR A;  2LVJ A;  2MRD A;  3AAK A;  4WQ2 A;  4YI8 A;  3SGB I;  1LR9 A;  4GUK A;  4L9M A;  1IKU A;  4E1R A;  1IGV A;  1LA3 A;  3JTD C;  3FWB A;  3QWP A;  2F2P A;  4GBA A;  2KFH A;  3OL0 A;  3BUM B;  3UEJ A;  2LM5 A;  2AMI A;  2KMQ A;  3RLZ A;  5FYX A;  1OZO A;  1CLM A;  1BOD A;  2V1C A;  1SY9 A;  3SG2 A;  5AFP A;  2NCO A;  4C0J A;  1X4S A;  1TNX A;  3KHE A;  3NSK A;  3OB2 B;  1WLZ A;  1DGV A;  1NPQ A;  1YX8 A;  3EVR A;  1AP4 A;  4YRU A;  2WVJ A;  1C7W A;  1XFY O;  1DS2 I;  1NX2 A;  3FS7 A;  4JWQ A;  3VRP A;  1FBV A;  2B0U C;  2WCB A;  1DF0 A;  1DGU A;  1TUS A;  4B6D A;  2ARP F;  2JNF A;  2ZFD A;  4CFR A;  1CLB A;  2ZN9 A;  1G33 A;  3WNX B;  1XFU O;  1XFZ O;  2WND A;  1XA6 A;  4Q04 A;  3EKJ A;  4MVF A;  3VE5 A;  1IG5 A;  1BMO A;  1LKJ A;  1XFX O;  1J1D A;  2KI6 C;  3VGO A;  1BJF A;  1QVI Y;  1S6I A;  2NCP A;  3EVV A;  4MZK A;  2M49 B;  4UXH A;  1RJV A;  3DVK A;  1WDC B;  2GV5 A;  3CLN A;  2K7D A;  2LMV A;  4HSZ A;  5FUX A;  4YGD B;  1YVH A;  2G2B A;  1K9K A;  1UUS A;  1WRZ A;  2EGD A;  2PAS A;  1M31 A;  1NCY A;  2KCX A;  1UHN A;  3C1V A;  3SIA A;  3I5I C;  1A4P A;  2NU3 I;  5G08 A;  4E1P A;  3CTN A;  2QQD A;  2K8M B;  2KNE A;  1TNP A;  1UP5 A;  1K90 D;  2JT0 A;  2KGB C;  2JXC A;  1OMD A;  3K21 A;  2Q91 A;  1AVS A;  3AKB A;  1PSR A;  4DCK A;  3SG3 A;  4MZL A;  1KSM A;  1R0R I;  2WOS A;  4PE0 A;  3E3R A;  3KY9 A;  2BE6 A;  3DVJ A;  3D10 A;  2M1K B;  1CKK A;  1PRW A;  2AAO A;  1BF5 A;  1RFH A;  4JCV E;  3JTD B;  1HQV A;  1S26 D;  1EXR A;  2F3Z A;  1OE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...