2V53A

Crystal structure of a sparc-collagen complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
214
Chain Sequence
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords SPARC
publication title Structural Basis of Sequence-Specific Collagen Recognition by Sparc.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2v53A02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v53A01
1M46A 2KDHA 2L50A 4YGCB 2ZN9A 3EVRA 4PHJA 2GKRI 4JPZB 1OZOA 2SGQI 2LP2A 2PSRA 2JXCA 1CT4I 1OOJA 3EKHA 2EGDA 4PE0A 3PN7C 3OB2B 3BXKA 2L4HA 1M31A 3NSOA 2KI4B 2JTTA 1DJGA 2A4JA 2HQ8A 3CLNA 1SL7A 2WC8A 4SGBI 1F4OA 2L51A 1XFZO 2F3CI 3BUNB 1A75B 1S6JA 2M29A 3A8RA 1W7JB 3TS5C 2JRFA 1PCEA 4IL1A 5CSFA 3KHEA 4YGBB 1TURA 1S3PA 4QJ5B 1UVGA 1PPFI 3BOWB 2MLEC 1IJ5A 3CR2A 1DJXA 2KHNA 4M2QA 1PULA 1CGII 3OX5A 1B7TZ 2Q91A 4DUQA 2WCFA 1TIZA 2E6WA 4GPLB 4Q04A 1DTLA 1DJYA 2ERWA 3GK2A 4PHKA 1Y1BA 1F54A 2CT9A 2PMYA 2AMIA 3A4UB 1MT1A 2H61C 2VRGA 1N13A 1TOPA 1SCMB 5FYXA 1ZUZA 5HKWA 1FPWA 3QTLD 3TDUA 1SGEI 3B4VC 2JWWA 1HQVA 1RROA 4AQIA 3IQOA 4OKHA 4MRYA 1SCVA 2N71A 1K94A 1MR8A 2BE6A 2QACA 1S26D 2JYYA 3EKJA 1J7QA 1QX2A 4YBHB 1G8IA 1RK9A 3VRRA 1L2OC 3JTDC 5GQQC 2LANA 1S5GY 2M9GA 1GGWA 1UVFA 3SG6A 1F55A 1MXEA 2COLB 2WORA 1NPQA 1QX5B 1S6CA 1WLZA 2K0JA 4NDDA 3WNXB 1KK8C 1YUTA 1XO5A 1IWQA 5DAEA 3TJQA 2NXQA 3OX6A 1S1EA 3LLEA 2JPTA 3NSKA 2Q4UA 3OHMB 1UHKA 1Y1AA 4PE1A 1LINA 4PHNA 1JSAA 1UUCA 3I5IB 1K95A 2F33A 1H0ZA 5G08A 2O60A 2QPTA 2K7CA 1CM1A 1PJUA 1RFJA 3BUWB 3K21A 1QASA 1EG4A 1EXRA 1XFVO 1LR9A 1R6PA 1IRJA 4XJKB 1J7OA 1XK4C 4ORBB 1UHIA 1DJZA 2PRUA 3D10A 4AOMA 1RWYA 1J55A 1KK7Y 1V1FA 4WQ2A 4CIDA 2EC6C 1CB1A 1SPYA 2BKHB 2LP3A 3KEVA 1CNPA 2JULA 1K9KA 3H4SE 2N52A 3IF7A 1TIHA 4M2PA 1IW4A 2NU0I 3JVTC 3WXAA 1ALVA 1MXLC 1NCZA 1XK4A 2D8NA 2LNKA 1YX7A 1H4BA 2ZRTA 2G2BA 3SIBA 2LMUA 5KU1A 1TBRR 2BUSA 5JHWC 1OMVA 1L7ZA 4USLA 2L5XB 4PE4A 2OS8B 2P6AC 1TTXA 2GKTI 3OB1B 2BL0C 3DF0B 1KFUS 1BR1B 1NP8A 3LK1A 1QVIZ 1IGVA 2L0PA 2KMRA 1CKKA 2NZ0A 3OP0A 2KI4C 2KGRA 3DD4A 1RJVA 1D1OA 1IJ6A 1OMTA 1AUIB 1QATA 2Y4QA 1HJAI 4L9MA 3GOFA 3I5HB 1PSBA 1C7VA 1QLSA 1QV0A 1UP5A 4CPVA 2SGPI 3CGAA 4PALA 1K8UA 3PSRA 1YVLA 1CHOI 1CFDA 3NSIA 4GNKB 5AERA 4UPGA 5CPVA 4MEWA 2BE4A 1RECA 2I18A 2KOTA 5DKNA 5AFPA 4GFTA 2NU2I 1XFYO 2M97A 2KFGA 1A75A 4PHMA 4MVFA 2KMPA 3AKAA 3CR4X 2M3WA 1FW4A 1QTXA 4QJ4B 4MBEA 1GJYA 4GGNA 3KF9A 3BOWA 3FWBA 3BUOB 1JC2A 4HGUA 2ZNEA 2WNDA 3F45A 3EVUA 1UURA 1WRLA 4U8DA 1QV1A 1MF8B 1SCMC 2LVIA 1CDPA 5CSJA 1JBAA 1ODBA 2OTGB 1N2DA 3E3RA 2JQ6A 3SIAA 4YRUA 5HLOA 5AANA 4A4BA 4N5XA 2FCEA 3TUYC 1A03A 2B0UC 1DS2I 2MBXA 1SW8A 2JT3A 4WQ3A 3I5GB 1EG3A 1DMOA 3RM1A 3I5FB 1JFKA 4JWQA 2KQ6A 2KQYA 1OZSA 2NLNA 3SG4A 1HT9A 2SGDI 2KI6D 4ICBA 4FQOA 2WCEA 3BQ3A 1XYDA 3TZ1A 1M45A 1PK0D 2E30A 3O6BA 1KSMA 1XVJA 1XFXO 2LLUA 3CR5X 1Y1CA 2M1UA 5ER5A 2MLFC 1TNWA 2KYCA 1YURA 1IKUA 4F0ZB 1EL4A 2L4IA 4HRHA 1K2HA 1QLKA 1ZACA 5I2LA 2AUCA 4OCIA 1LA0A 1A2XA 2LE9B 3GK1A 1WLMA 4NDCA 2GKVA 1R2UA 1SGDI 2JTZA 1XFWO 1VRKA 1XA5A 2RGIA 4ZCUA 3SG2A 4OVNF 4R1EA 5ER4X 3FWCA 2JC2A 3I5IC 4HSZA 1K9PA 1WDCC 2HPSA 5HYDA 1TBQR 4DRWA 5F6TA 2LC5A 4TNCA 1LR8A 1NCXA 2PALA 1KMAA 1KFUL 1U5IA 1FYBA 4YI9A 1R0RI 1UUSA 2ZNDA 3RLZA 1AJ4A 1NIWA 4ORCB 1TNQA 2JXLA 4QJ3B 5D69A 1ZFSA 4N1GA 3PN7B 3EVVA 1YVHA 2M0RA 1BJFA 1YRTB 3IQQA 1LA3A 1TCOB 1B9AA 2HF5A 2KNEA 4XJKA 3VRQA 1DT7B 1Y1UA 2BECA 2HQWA 4OV2A 1K93D 2LM5A 2WOSA 4P5OE 1AN1I 1TGSI 1CMFA 2GV5A 2F2OA 3SG5A 4DCKA 1PALA 1LKJA 1S36A 1NX1A 4AQJA 5I8NA 1KQMC 1SL9A 2CXJA 2MHHA 4PCWA 2QQCA 1B8RA 1M39A 5J3XA 3CS1A 4C0KA 4N1FA 5AXIA 1CT2I 2JU0A 3BYAA 1Y1XA 1BG1A 1OVOA 1Y0VH 4I5LB 1NUBA 2BBMA 1BOCA 2BCXA 2NU1I 2K7BA 2I94A 2KMQA 3LCPC 3AAKA 3DVMA 1ALWA 1QVIY 1SR6C 2I7AA 1KWOC 1YRUB 1FBVA 2KAYA 2Y1NA 2AAOA 1OQPA 2LMVA 3D0YB 3DF0A 3I5HC 3DVJA 4MZJA 2ISDA 3SG3A 1KCYA 3LL8B 3C1VA 4MZKA 5AEQA 3BUXB 4ZCVA 1J7PA 3AAJA 4MRXA 1N0YA 1TN4A 2FJUB 2XRCA 1JUOA 5KTYA 4GBAA 3HH2C 3AKBA 1J1EA 2K61A 1Q80A 3ZWHA 1CFFA 1F8HA 1PVBA 4CFQA 4I5NB 4GAOA 1DJIA 4BY4A 2SASA 2PVBA 4I5JA 4NQGA 2LCPA 1E8AA 2K7OA 3PM8A 5B8IB 2OPOA 4D1EA 2V53A 2M8UA 1UWOA 4ETOA 1Y6WA 1J7RA 2KYFA 1YR5A 4XYNA 3MSEB 2M5XA 1QXPA 2DOQA 2JOJA 2FOTA 3HX4A 2F2PA 4YI8A 4GUKA 2LLTA 3I5FC 2KCXA 1TNPA 4OVOA 2LUXA 3CWGA 4OR9B 5JJGA 1SRAA 1YX8A 5CSIA 2WCYA 1BMOA 2ZKMX 1TNXA 2LUCA 3EK4A 3BUMB 2P6BB 1B47A 1N65A 2F3ZA 1CM4A 1AK8A 1DF0B 2KFHA 1B7TY 2HETA 3NSLA 3M0WA 2BCAA 2EHBA 1SKTA 1F71A 2Y1MA 1FF1A 3PFVA 5JOLA 1F70A 2BBNA 1PRWA 2EC6B 1JFJA 1SGPI 3SJSA 2BKIB 1AP4A 2NCPA 1MHOA 2JT0A 2WCBA 5DKRA 1JF0A 5HKZA 3EK7A 1NWDA 5IBWA 2TN4A 2LHIA 2JT8A 2M7NA 1QJTA 1CDMA 1QIVA 2SCPA 2F8PA 4MZLA 5CSNA 1CFCA 1TRFA 4GGFC 2LVKA 1CGJI 4A4CA 5I2QA 1ZMZA 4CLNA 2BL0B 5BPJA 1CLBA 1TUSA 2NU4I 4GGFA 3CTNA 1IG5A 1GGZA 1FI5A 2N17A 1RTP1 2ZRSA 4PDZA 1CLLA 4BY5A 2MRDA 1GQMA 1UHJA 4MSPA 4YGDB 2NU3I 4DIRA 2G9BA 3QRXA 2K7DA 2R2IA 3OVOA 1AHRA 1YTZC 2K2AA 2ZFDA 3EK8A 1SGQI 1OYVI 1SBJA 2O5GA 1ZOTB 1B8LA 4C0JA 1CDNA 1K90D 2PASA 1BLQA 1CSOI 1S6IA 1XFUO 1B4CA 1MWNA 1CFPA 1IQ3A 3O4YA 2CNPA 2M1KB 1BR4B 1DVIA 1LVCD 1A4PA 1WRKA 1OE9B 3PATA 3VRNA 5I2OA 1SGNI 1LR7A 1NCYA 2SGFI 2NCOA 4HREE 1KFXS 3WHTB 1NSHA 1CT0I 1NX2A 3TUYB 2Y5IA 1W7IB 4C0LA 1A29A 3D0YA 1WRZA 1H8BA 2CTNA 1SNLA 3TS5B 1SMGA 1IY6A 2H61A 5TNCA 1JF2A 5K89A 1WY9A 4P2YB 1C7WA 1NX3A 1SGYI 2OS8C 1YU6C 1EH2A 1K9UA 5D7FA 3VROA 1DJHA 3VRPA 1AVSA 1PVAA 3KPXA 3VGOA 1FI6A 5PALA 3SG7A 1B8CA 3TDIA 4MLWA 2CCMA 3ZNIA 2H2KA 1TCFA 2JNXA 3CZTX 2BCBA 1KQVA 1V1GA 2KGBC 4CFRA 1IQ5A 2KSPA 2LHLA 1BUSA 3FS7A 3LK0A 3HCMA 1J1DA 1G33A 2LV7A 2SGEI 4MN0A 2JXDA 1X02A 4HRGA 1U5IB 2F3YA 1HDLA 2K8MB 2MJWB 2KMOA 1K96A 1KSOA 1CMGA 3O78A 2LEOA 2LLSA 1M8CA 1SK6D 1IY5A 1WDCB 2FCDA 3SGQI 1QS7A 1M8BA 1BU3A 1DS3I 1S5GZ 3DVEA 2I2RE 1UHNA 2KAVA 3WHUB 2L98A 1NX0A 2MA2A 1OMRA 2KBIA 5HLVA 1L2OB 2L2EA 2CBLA 1YUUA 2MAZA 1EJ3A 3JTDB 4YGEB 2M7LA 1F4QA 1BODA 1YUSA 1B1GA 1M63B 3SEKC 2IS9A 2K2FA 2OTGC 2M49B 1Z7KB 2KFFA 3KO0A 1DF0A 2GGZA 1UHHA 1C07A 1CE3A 3I5GC 1KK8B 2GGMA 1BT6A 4NDBA 1LXFC 1SY9A 3FIAA 3O2PA 1QIWA 5DKQA 1G4YR 2KI6C 4PE7A 2B1UA 1JWDA 1DGUA 2QQDA 4I5KA 1AJ5A 1KQMB 3NXAA 4FTGA 4WRIA 1DGVA 3ICBA 1CLMA 1OSAA 1PSRA 2KBMA 2LMTA 2ZN8A 4YGAA 3SGBI 1SYMA 2JZMA 1CDLA 1KK7Z 1MUXA 5HKYA 2ARPF 3PLFB 1OMDA 2KAXA 2JZIA 4E68A 3PALA 1SR6B 1OMUA 1KWOB 1CTRA 1NYAA 3DVKA 1KFXL 2LVJA 2OVOA 4DS7A 1MQ1A 2LAPA 5KSZA 4ORAB 1BF5A 1HPTA 1QX7A 4GI3C 3JVTB 3TDZA 1SL8A 4M2OA 1IH0A 1SGRI 1YTPA 2LVVA 1DJWA 3GK4X 4JQ0D 2JNFA
chains in the Genus database with same CATH superfamily
1M46A 2KDHA 4YGCB 2ZN9A 4PHJA 2SGQI 3VDPA 1CT4I 2EGDA 3OB2B 2HQ8A 4SGBI 3BUNB 3A8RA 1W7JB 2JRFA 3R1VA 4YGBB 2MLEC 2QQ0A 3D00A 3EG5B 2E6WA 4Q04A 2BNXA 1F54A 3DY9A 1N13A 1OOGA 1FPWA 1SGEI 2JWWA 3B6XA 4AQIA 3IQOA 4OKHA 4MRYA 1WGTA 2N71A 2JYYA 3EKJA 3JTDC 2LANA 2M9GA 1GGWA 2ERBA 1NPQA 1KK8C 2CWFA 1XO5A 1IWQA 3OX6A 1S1EA 2Q4UA 4PE1A 1JSAA 5G08A 1X4SA 2KPHA 3CABA 2B8TA 1J7OA 1VDDA 5FUYA 2LP3A 1K9KA 1TIHA 1ALVA 1MXLC 1NCZA 1YX7A 2LMUA 2L5XB 2OS8B 1TTXA 2GKTI 3OB1B 2BL0C 3DF0B 1KFUS 1BR1B 1CKKA 3OP0A 2KI4C 1OMTA 1QATA 9WGAA 4L9MA 1QV0A 1YVLA 1MJBA 1RECA 5DKNA 3UO9A 2M97A 4PHMA 4MVFA 2QQEA 3BOWA 3BUOB 4HGUA 2WNDA 3EVUA 2N1AB 4U8DA 1QV1A 5CSJA 1N2DA 2WCMA 1DQEA 3RM1A 2A20A 2KQYA 2NLNA 2SGDI 1OOFA 3R5CA 2WCEA 2RIJA 3TZ1A 2UZ3A 3O6BA 1XFXO 5ER5A 3D73A 3B86A 1EL4A 2AUCA 2LE9B 1WLMA 4NDCA 2GKVA 1VRKA 4ZCUA 1DC1A 4OVNF 5ER4X 3FWCA 1K9PA 1WDCC 5HYDA 1TBQR 5F6TA 2LC5A 1NCXA 1U5IA 4YI9A 2ZNDA 2JXLA 4QJ3B 1IIOA 4N1GA 1TCOB 2HF5A 1DT7B 3S0AA 4OV2A 2DB6A 2WOSA 2W0TA 1SL9A 1B8RA 1M39A 1CT2I 1KBFA 1NUBA 1TOTA 2GIVA 2KMQA 3AAKA 2KAYA 2ISDA 2AAOA 3I5HC 3LL8B 4ZCVA 1TUJA 5KTYA 3VDUA 1Q80A 3ZWHA 4CFQA 4GAOA 1DJIA 2LCPA 1E8AA 4D1EA 2V53A 2M8UA 4XYNA 2DOQA 4YI8A 2LLTA 4OVOA 2LUXA 4OR9B 4UXJA 3EK4A 1B47A 1N65A 1B7TY 3M0WA 1FF1A 3PFVA 5JOLA 1F70A 3FSYA 1AP4A 5HKZA 3EK7A 1ULMA 4FQTA 2TN4A 2LHIA 1QIVA 3FE9A 3GOXA 5CSNA 2BL0B 5J8FA 1FI5A 2WCKA 4INXA 1RTP1 2MRDA 5FUVA 4MSPA 2X3TA 4DIRA 2G9BA 3OVOA 3EK8A 1SBJA 1CDNA 3UNWA 1S6IA 2YGUA 1XFUO 1IQ3A 1BR4B 1DVIA 1WRKA 5I2OA 2KLDA 1NCYA 2SGFI 4C0LA 1A29A 2CTNA 3BFBA 2H61A 5TNCA 1JF2A 1WY9A 1EH2A 1FI6A 3VGOA 1UHAA 2GTEA 3TDIA 3CZTX 1KQVA 2BCBA 1V1GA 2KGBC 5D3OA 1ULNA 1J1DA 4MN0A 2JXDA 1U5IB 1WDCB 1QS7A 1BU3A 2JW6A 2KAVA 3WHUB 2MA2A 1OMRA 2KBIA 3BFHA 5HLVA 2L2EA 1YUSA 3B88A 2IS9A 2OTGC 1DF0A 2QEVA 1CE3A 3I5GC 2GGMA 4NDBA 1SY9A 3FIAA 3QMEA 1PTRA 1QIWA 1G4YR 2KI6C 1TBNA 2B1UA 1AJ5A 3TOAA 1CLMA 1OSAA 2ZN8A 2LMTA 5HL1A 1OMDA 2KAXA 3PALA 1CTRA 4WP4A 1KFXL 2OVOA 4ORAB 1SL8A 1SGRI 1P9GA 1YTPA 2CWGA 2JNFA 3EVRA 4JPZB 1OZOA 2WC5A 2LP2A 2PSRA 3EKHA 3PN7C 5CCLA 1M31A 1DJGA 3UGLA 1XFZO 5CSFA 4QJ5B 1PULA 1CGII 2Q91A 1QWVA 4DUQA 2PYQA 2WCFA 2ERWA 2QEHA 2PMYA 2AMIA 2WCJA 3A4UB 1MT1A 1DEKA 4FKDA 1RROA 1MR8A 2QACA 4UXIA 4YBHB 1RK9A 1MXEA 1WLZA 4NDDA 3WNXB 3Q8IA 5DAEA 1UHKA 4PHNA 3I5IB 2F33A 1H0ZA 1CM1A 3BUWB 3K21A 1EG4A 1R6PA 4XJKB 3DZTA 1XK4C 1DJZA 4AOMA 1J55A 1V1FA 4WQ2A 1CB1A 1SPYA 2N52A 3H4SE 1XK4A 2LNKA 1TBRR 2BUSA 5JHWC 4INWA 1OMVA 1L7ZA 2P6AC 1NP8A 2NZ0A 1D1OA 2JA1A 1V1HA 2YQPA 2OD1A 4PALA 1K8UA 1CHOI 2ORVA 5AFPA 3B87A 2KFGA 1A75A 3AKAA 3PJIA 3CR4X 4QJ4B 4MBEA 3KF9A 1W9ZA 1SCMC 1JBAA 1ODBA 2OTGB 2B0UC 5HLOA 5AANA 4WQ3A 3I5GB 1EG3A 1DMOA 3I5FB 2KQ6A 1OW4A 4ICBA 4FQOA 1PK0D 2E30A 5E3QA 2LLUA 2P71A 2M1UA 2MLFC 1YURA 1K2HA 3UOEA 1LA0A 3GK1A 1R2UA 1SGDI 1XA5A 3SG2A 3SS3A 4R1EA 2JC2A 3QWPA 2HPSA 2PALA 1KFUL 1FYBA 1R0RI 3RLZA 4ORCB 3S0BA 3PN7B 1YVHA 2M0RA 1LA3A 2KNEA 1K93D 3CZ2A 3R1OA 1CMFA 1S36A 1NX1A 1KQMC 2CXJA 5AXIA 3BYAA 1Y1XA 3SS5A 1OVOA 1BOCA 2DIPA 3LCPC 4GNKB 3OXLA 1FBVA 1OQPA 4MZJA 3DVJA 3AAJA 4MRXA 3HH2C 3QAHA 1XFRA 3AKBA 2K61A 1F8HA 4BY4A 1MJ9A 3R5AA 3NHTA 2KYFA 2M5XA 2DKVA 2JOJA 2FOTA 3HX4A 4GUKA 1TNPA 3CWGA 1NXUA 1SRAA 1YX8A 1TNXA 1XBTA 3UEYA 2P6BB 1CM4A 2EHBA 2Y1MA 2BKIB 2JT0A 4MZLA 3CDNA 3UEJA 1CGJI 5BPJA 1TUSA 1IG5A 2N17A 3R72A 2ZRSA 1CLLA 4YGDB 3D75A 1YTZC 1OYVI 2O5GA 1ZOTB 4C0JA 3O4YA 2CNPA 1OE9B 1LR7A 3D76A 1NSHA 2Y5IA 3D0YA 1WRZA 1H8BA 2WGCA 1C7WA 1YU6C 1SGYI 3E2IA 4AMLA 4F7FA 1AVSA 3KPXA 1B8CA 2CCMA 3ZNIA 1TCFA 2KSPA 2LHLA 1BUSA 1HDLA 2K8MB 2MJWB 2KMOA 1K96A 3O78A 2LEOA 2LLSA 3D74A 2WCLA 1M8BA 1DS3I 5E3PA 1S5GZ 2I2RE 1UHNA 1WGCA 3JTDB 1YUUA 2MAZA 1EJ3A 2M7LA 1BODA 2WC6A 1B1GA 1M63B 3KO0A 2GGZA 2ROWA 1C07A 1KK8B 3O2PA 3R5BA 4PE7A 1DGUA 2QQDA 3PM2A 1KQMB 3SGBI 3VB1A 4MPIA 1NYAA 3TOBA 3DVKA 2UVOA 4DS7A 2ORWA 2K9HA 2LAPA 1QX7A 3TDZA 3R5DA 3GK4X 3BJIA 2JXCA 1OOJA 4PE0A 2L4HA 3S0GA 2KI4B 2JTTA 2A4JA 3CLNA 1SL7A 2F3CI 2L5YA 1S6JA 3TS5C 1PCEA 4IL1A 3KHEA 3BOWB 1DJXA 3FSXA 1FY7A 1TIZA 4GPLB 1DTLA 1DJYA 3GK2A 1Y1BA 2CT9A 3L47A 2H61C 2VRGA 1TOPA 5FYXA 1ZUZA 3QTLD 1SSEB 1J7QA 1QX2A 3VRRA 1L2OC 5GQQC 1S5GY 1UVFA 3SG6A 1F55A 1QX5B 1S6CA 2K0JA 1YUTA 3TJQA 2E73A 3NSKA 3OHMB 1LINA 1UUCA 1K95A 5FI6A 2YUUA 1RFJA 1MJAA 1LR9A 1UHIA 1Z2IA 4CIDA 3UFFA 2JULA 3IF7A 4M2PA 1IW4A 3JVTC 1TUZA 2D8NA 2E5RA 3SIBA 4USLA 4PE4A 1P9ZA 1QVIZ 1IGVA 2L0PA 1RJVA 3NGVA 1IJ6A 1AUIB 1HEVA 3GOFA 3I5HB 1PSBA 1QLSA 2SGPI 3FC3A 3NSIA 4UPGA 2BE4A 2I18A 2KOTA 4GFTA 1R79A 1QTXA 1GJYA 4GGNA 2CWHA 3FWBA 3R1PA 2ZNEA 1UURA 1WRLA 2LVIA 4YRUA 3E3RA 2JQ6A 1A03A 4N5XA 2LB7A 1DS2I 1JFKA 4JWQA 1HT9A 2KI6D 1M45A 1KSMA 1XVJA 3CZ1A 1TNWA 1IKUA 5EX3A 2L4IA 4HRHA 1QLKA 1ZACA 5J8CA 3UGIA 1XFWO 2RGIA 1WTJA 3DXLA 4DRWA 1LR8A 1C3YA 3UGDA 5HQ8A 1NIWA 1S20A 1TNQA 5D69A 1ZFSA 2CJSC 3L4AA 3EVVA 1BJFA 1YRTB 3IQQA 1B9AA 3VRQA 1Y1UA 2QPOA 2LM5A 5FI2A 1AN1I 1TGSI 4DCKA 3D77A 2QQCA 3BFAA 4C0KA 4N1FA 2JU0A 1BG1A 1Y0VH 4I5LB 2BCXA 3PDNA 1QVIY 1SR6C 2I7AA 2Y1NA 3CZ0A 3DF0A 3C1VA 4MZKA 2XRCA 1J1EA 1CFFA 5EL2A 3IVTA 4B6DA 2PVBA 2L7XA 2K7OA 3PM8A 5B8IB 1UWOA 4ETOA 1YR5A 5E3RA 3CXLA 3V2LA 2J87A 5JJGA 2WCYA 5CSIA 2LUCA 2L2CA 2F3ZA 1AK8A 1DF0B 2HETA 2BCAA 1F71A 1SGPI 1JFJA 2NCPA 1MHOA 2QEOA 2WCBA 5DKRA 1JF0A 2M7NA 2SCPA 1CFCA 2LVKA 4A4CA 4UXHA 3CTNA 4PDZA 4BY5A 1K7VA 1GQMA 1UHJA 3DYEA 3QRXA 2R2IA 1AHRA 2K2AA 1B8LA 2PASA 1CSOI 3OXGA 1CFPA 3OXFA 1A4PA 1SGNI 1U5KA 3TO6A 2NCOA 3WHTB 1CT0I 1LS8A 1SNLA 5EX0A 5K89A 1NX3A 1K9UA 3VROA 5PALA 2H2KA 2JNXA 5CCMA 1RFHA 4CFRA 3FS7A 3LK0A 3HCMA 2LV7A 2F3YA 3FE8A 5I94A 1CMGA 1M8CA 1SK6D 1IY5A 3SGQI 3D78A 1XX6A 3DVEA 1FAQA 3OBVA 2L98A 3MEKA 3TO9A 4JD9A 2K2FA 1Z7KB 1ORGA 2KFFA 4FTGA 1PSRA 2KBMA 4YGAA 1CDLA 1KK7Z 5FI7A 1MUXA 5HKYA 2JZIA 4E68A 1SR6B 1OMUA 1K7UA 5KSZA 1HPTA 4GI3C 4M2OA 2LVVA 4JQ0D 1FARA 1T14A 2L50A 2GKRI 1XA6A 3BXKA 1GM0A 3NSOA 2WC8A 1F4OA 2L51A 1A75B 2M29A 1TURA 1S3PA 1UVGA 1PPFI 1PTQA 1IJ5A 3CR2A 2KHNA 4M2QA 3OX5A 1B7TZ 1V1IA 4PHKA 2LUYA 4JCVE 2WCHA 1SCMB 5HKWA 3TDUA 3B4VC 1HQVA 1SCVA 1K94A 2BE6A 1S26D 1DELA 1G8IA 2VRWB 3BJHA 2WORA 2COLB 2NXQA 3LLEA 2JPTA 1Y1AA 2O60A 2QPTA 2K7CA 1PJUA 1QASA 1EXRA 1XFVO 1IRJA 4ORBB 3S0EA 2PRUA 3D10A 2ODDA 1RWYA 1KK7Y 2EC6C 2BKHB 3KEVA 1CNPA 2NU0I 3WXAA 1H4BA 4DNCA 2ZRTA 2G2BA 5KU1A 2P70A 3LK1A 2KMRA 5DICA 2KGRA 3DD4A 2Y4QA 1HJAI 1C3ZA 1C7VA 1UP5A 4CPVA 3CGAA 3PSRA 1CFDA 2RC4A 5AERA 2FNFX 5CPVA 4MEWA 2NU2I 1XFYO 1W3SA 3NHIA 2KMPA 3K1EA 2M3WA 1FW4A 1JC2A 2PQLA 3F45A 1MF8B 1CDPA 4A24A 3SIAA 4A4BA 2FCEA 3TUYC 2MBXA 1SW8A 2JT3A 2ENZA 1OZSA 3SG4A 1OOHA 3BQ3A 4E1RA 1XYDA 3RZSA 4IJ7A 1Y1CA 3CR5X 2KYCA 2BAPA 4F0ZB 2K60A 5I2LA 4OCIA 3L4LA 1A2XA 2JTZA 3I5IC 4HSZA 4TNCA 1KMAA 1P28A 1UUSA 3S0DA 1AJ4A 7WGAA 4XJKA 2BECA 2HQWA 1Z4HA 3FE6A 4P5OE 3N7HA 2GV5A 2F2OA 3SG5A 1PALA 1LKJA 2Y0MA 4AQJA 5I8NA 4PCWA 2MHHA 5J3XA 3CS1A 5FUWA 2BBMA 2NU1I 2K7BA 2I94A 3DVMA 1ALWA 1KWOC 1YRUB 3D0YB 2LMVA 3SG3A 1KCYA 5AEQA 3BUXB 1J7PA 1N0YA 1TN4A 2FJUB 1JUOA 1OOIX 4GBAA 3SS4A 1PVBA 4I5NB 3O4XA 2SASA 4I5JA 4NQGA 2OPOA 1Y6WA 1J7RA 3MSEB 1QXPA 2F2PA 3I5FC 2JPOA 2KCXA 2OZUA 3KY9A 3S0FA 1KBEA 1BMOA 2ZKMX 3BUMB 2KFHA 3NSLA 1SKTA 2BBNA 1PRWA 2EC6B 3SJSA 5FUXA 1NWDA 5IBWA 3VE5A 2ELIA 2JT8A 1QJTA 1CDMA 2F8PA 1K7TA 1TRFA 4GGFC 2X52A 5I2QA 1ZMZA 4CLNA 2V1CC 1CLBA 2NU4I 4GGFA 1GGZA 4OZDA 2QEBA 2V1CA 1Y8FA 2NU3I 2K7DA 2ZFDA 1SGQI 4KYNA 1K90D 1BLQA 1B4CA 1MWNA 3B7AA 5HI7A 2M1KB 3VRNA 1LVCD 3PATA 2QDIA 4HREE 1KFXS 2ENNA 3CYZA 1NX2A 3TUYB 1W7IB 2FJYA 3TS5B 1SMGA 1IY6A 4P2YB 2OS8C 5D7FA 2WVJA 3E59A 1DJHA 3VRPA 1PVAA 3SG7A 4MLWA 1TWOA 1W4RA 3OL0A 1IQ5A 2SGEI 1G33A 2KLEA 1X02A 4HRGA 1KSOA 2PQ8A 2FCDA 2H8VA 2L8EA 1NX0A 1L2OB 2CBLA 4YGEB 1F4QA 2OU2A 3SEKC 2M49B 1TBOA 1UHHA 1BT6A 1LXFC 5DKQA 1JWDA 4I5KA 4JKTA 3NXAA 4WRIA 3TO7A 1DGVA 3ICBA 1ULKA 2J9RA 1SYMA 1X74A 2JZMA 4PT1A 3RU0A 2ARPF 3PLFB 1KWOB 2LVJA 4E1PA 1Q9BA 1Z2CB 1MQ1A 1BF5A 3JVTB 1IH0A 1WKXA 1DJWA 3OGNA 2GVIA
chains in the Genus database with same CATH topology
1M46A 2KDHA 2L50A 1FARA 4YGCB 2ZN9A 3EVRA 4PHJA 2GKRI 4JPZB 1OZOA 2SGQI 2LP2A 2PSRA 2JXCA 1CT4I 3BJIA 3VDPA 1OOJA 3EKHA 2EGDA 4PE0A 3PN7C 1XA6A 3OB2B 3BXKA 2L4HA 5CCLA 1M31A 3NSOA 2KI4B 2JTTA 1DJGA 2A4JA 2HQ8A 3CLNA 1SL7A 2WC8A 4SGBI 1F4OA 3UGLA 2L51A 1XFZO 2F3CI 3BUNB 1A75B 1S6JA 2M29A 3A8RA 1W7JB 3TS5C 2JRFA 1PCEA 4IL1A 5CSFA 3KHEA 4YGBB 1TURA 1S3PA 4QJ5B 1UVGA 1PPFI 1PTQA 3BOWB 2MLEC 2QQ0A 1IJ5A 3CR2A 1DJXA 2KHNA 4M2QA 3D00A 1PULA 1CGII 3OX5A 1B7TZ 2Q91A 4DUQA 2WCFA 1TIZA 2E6WA 4GPLB 4Q04A 1DTLA 1DJYA 2ERWA 3GK2A 1V1IA 4PHKA 1Y1BA 2LUYA 1F54A 4JCVE 2CT9A 2PMYA 2AMIA 3A4UB 1MT1A 2H61C 2VRGA 1N13A 1TOPA 1SCMB 5FYXA 1ZUZA 5HKWA 1FPWA 3QTLD 4FKDA 3TDUA 1SGEI 3B4VC 2JWWA 1HQVA 1RROA 4AQIA 3IQOA 4OKHA 4MRYA 1SCVA 2N71A 1K94A 1MR8A 2BE6A 2QACA 1S26D 2JYYA 3EKJA 1J7QA 4UXIA 1QX2A 4YBHB 1G8IA 1RK9A 3VRRA 1L2OC 3JTDC 5GQQC 2LANA 1S5GY 2VRWB 2M9GA 1GGWA 1UVFA 3SG6A 1F55A 1MXEA 2COLB 2WORA 1NPQA 1QX5B 1S6CA 1WLZA 2K0JA 4NDDA 3WNXB 1KK8C 1YUTA 1XO5A 1IWQA 5DAEA 3TJQA 2NXQA 3OX6A 1S1EA 3LLEA 2JPTA 2E73A 3NSKA 2Q4UA 3OHMB 1UHKA 1Y1AA 4PE1A 1LINA 4PHNA 1JSAA 1UUCA 3I5IB 1K95A 2F33A 1H0ZA 5G08A 2O60A 1X4SA 2QPTA 2K7CA 1CM1A 1PJUA 2YUUA 1RFJA 3BUWB 3K21A 1QASA 1EG4A 1EXRA 1XFVO 1LR9A 2B8TA 1R6PA 1IRJA 4XJKB 1J7OA 1XK4C 4ORBB 1UHIA 1DJZA 1VDDA 5FUYA 2PRUA 3D10A 2ODDA 4AOMA 1RWYA 1J55A 1KK7Y 1V1FA 4WQ2A 4CIDA 2EC6C 1CB1A 1SPYA 2BKHB 2LP3A 3KEVA 3UFFA 1CNPA 2JULA 1K9KA 3H4SE 2N52A 3IF7A 1TIHA 4M2PA 1IW4A 2NU0I 3JVTC 3WXAA 1ALVA 1MXLC 1NCZA 1XK4A 2D8NA 2LNKA 1YX7A 2E5RA 1H4BA 2ZRTA 2G2BA 3SIBA 2LMUA 5KU1A 1TBRR 2BUSA 5JHWC 1OMVA 1L7ZA 4USLA 2L5XB 4PE4A 2OS8B 2P6AC 1TTXA 2GKTI 3OB1B 2BL0C 3DF0B 1KFUS 1BR1B 1NP8A 3LK1A 1QVIZ 1IGVA 2L0PA 2KMRA 1CKKA 2NZ0A 3OP0A 2KI4C 2KGRA 3DD4A 1RJVA 1D1OA 2JA1A 1IJ6A 1OMTA 1V1HA 1AUIB 1QATA 2Y4QA 1HJAI 4L9MA 2YQPA 3GOFA 3I5HB 1PSBA 1C7VA 1QLSA 2OD1A 1QV0A 1UP5A 4CPVA 2SGPI 3CGAA 4PALA 1K8UA 3FC3A 3PSRA 1YVLA 1CHOI 1CFDA 3NSIA 4GNKB 2ORVA 5AERA 4UPGA 2FNFX 5CPVA 4MEWA 2BE4A 1RECA 2I18A 2KOTA 5DKNA 5AFPA 4GFTA 2NU2I 1XFYO 2M97A 2KFGA 1R79A 1A75A 4PHMA 4MVFA 1W3SA 2KMPA 3AKAA 2QQEA 3CR4X 2M3WA 1FW4A 1QTXA 4QJ4B 4MBEA 1GJYA 4GGNA 3KF9A 3BOWA 3FWBA 3BUOB 1JC2A 4HGUA 2ZNEA 2WNDA 3F45A 3EVUA 1UURA 1WRLA 4U8DA 2N1AB 1QV1A 1MF8B 1SCMC 2LVIA 1CDPA 5CSJA 1JBAA 4A24A 1ODBA 2OTGB 1N2DA 3E3RA 2JQ6A 3SIAA 4YRUA 5HLOA 5AANA 4A4BA 4N5XA 2FCEA 3TUYC 1A03A 2B0UC 1DS2I 2MBXA 1SW8A 2JT3A 4WQ3A 3I5GB 2ENZA 1EG3A 1DMOA 3RM1A 3I5FB 1JFKA 4JWQA 2KQ6A 2A20A 2KQYA 1OZSA 2NLNA 3SG4A 1HT9A 2SGDI 2KI6D 4ICBA 4FQOA 2WCEA 3BQ3A 4E1RA 1XYDA 3TZ1A 1M45A 1PK0D 2E30A 2UZ3A 3O6BA 1KSMA 1XVJA 1XFXO 2LLUA 3CR5X 1Y1CA 2M1UA 5ER5A 2MLFC 1TNWA 2KYCA 1YURA 1IKUA 5EX3A 4F0ZB 1EL4A 2L4IA 4HRHA 1K2HA 1QLKA 1ZACA 5I2LA 2AUCA 4OCIA 1LA0A 1A2XA 2LE9B 3GK1A 1WLMA 4NDCA 2GKVA 1R2UA 1SGDI 2JTZA 3UGIA 1XFWO 1VRKA 1XA5A 2RGIA 4ZCUA 3OXLA 3SG2A 4OVNF 4R1EA 5ER4X 3FWCA 2JC2A 3I5IC 4HSZA 1K9PA 1WDCC 3QWPA 2HPSA 5HYDA 1TBQR 4DRWA 5F6TA 2LC5A 4TNCA 1LR8A 1NCXA 2PALA 1KMAA 1KFUL 3UGDA 1U5IA 1FYBA 4YI9A 1R0RI 5HQ8A 1UUSA 2ZNDA 3RLZA 1AJ4A 1NIWA 4ORCB 1TNQA 2JXLA 4QJ3B 5D69A 1ZFSA 2CJSC 4N1GA 3PN7B 3EVVA 1YVHA 2M0RA 1BJFA 1YRTB 3IQQA 1LA3A 1TCOB 1B9AA 2HF5A 2KNEA 4XJKA 3VRQA 1DT7B 1Y1UA 2BECA 2HQWA 2QPOA 4OV2A 2DB6A 1K93D 2LM5A 2WOSA 4P5OE 1AN1I 1TGSI 1CMFA 2GV5A 2F2OA 3SG5A 4DCKA 1PALA 1LKJA 1S36A 1NX1A 4AQJA 2W0TA 5I8NA 1KQMC 1SL9A 2CXJA 2MHHA 4PCWA 2QQCA 1B8RA 1M39A 5J3XA 3CS1A 4C0KA 4N1FA 5AXIA 1CT2I 2JU0A 3BYAA 1Y1XA 1BG1A 5FUWA 1OVOA 1Y0VH 1KBFA 4I5LB 1NUBA 2BBMA 1BOCA 2BCXA 1TOTA 2NU1I 3PDNA 2K7BA 2DIPA 2I94A 2KMQA 3LCPC 3AAKA 3DVMA 1ALWA 1QVIY 1SR6C 2I7AA 1KWOC 1YRUB 1FBVA 2KAYA 2Y1NA 2AAOA 1OQPA 2LMVA 3D0YB 3DF0A 3I5HC 3DVJA 4MZJA 2ISDA 3SG3A 1KCYA 3LL8B 3C1VA 4MZKA 5AEQA 3BUXB 4ZCVA 1J7PA 3AAJA 4MRXA 1N0YA 1TN4A 2FJUB 2XRCA 1JUOA 5KTYA 4GBAA 3HH2C 3VDUA 3AKBA 1J1EA 2K61A 1Q80A 3ZWHA 1CFFA 1F8HA 1PVBA 4CFQA 4I5NB 4GAOA 1DJIA 4B6DA 4BY4A 2SASA 2PVBA 4I5JA 2L7XA 4NQGA 2LCPA 1E8AA 2K7OA 3PM8A 5B8IB 2OPOA 4D1EA 2V53A 2M8UA 1UWOA 4ETOA 1Y6WA 1J7RA 2KYFA 1YR5A 4XYNA 3MSEB 2M5XA 1QXPA 2DOQA 2JOJA 3OXFA 3CXLA 2FOTA 3HX4A 2F2PA 4YI8A 4GUKA 2LLTA 3I5FC 2KCXA 1TNPA 4OVOA 2LUXA 3CWGA 3KY9A 4OR9B 2J87A 5JJGA 1SRAA 1YX8A 5CSIA 1KBEA 2WCYA 1BMOA 2ZKMX 1TNXA 4UXJA 2LUCA 3EK4A 1XBTA 3UEYA 3BUMB 2P6BB 1B47A 1N65A 2F3ZA 1CM4A 1AK8A 1DF0B 2KFHA 1B7TY 2HETA 3NSLA 3M0WA 2BCAA 2EHBA 1SKTA 1F71A 2Y1MA 1FF1A 3PFVA 5JOLA 1F70A 2BBNA 1PRWA 2EC6B 1JFJA 1SGPI 3SJSA 2BKIB 1AP4A 2NCPA 1MHOA 2JT0A 2WCBA 5DKRA 5FUXA 1JF0A 5HKZA 3EK7A 1NWDA 5IBWA 2TN4A 3VE5A 2LHIA 2JT8A 2M7NA 1QJTA 1CDMA 2ELIA 1QIVA 2SCPA 2F8PA 3GOXA 4MZLA 5CSNA 1CFCA 1TRFA 4GGFC 2LVKA 3UEJA 1CGJI 4A4CA 5I2QA 1ZMZA 4CLNA 2BL0B 5BPJA 2V1CC 1CLBA 1TUSA 2NU4I 4GGFA 4UXHA 3CTNA 1IG5A 1GGZA 1FI5A 2N17A 1RTP1 2ZRSA 4PDZA 2V1CA 1CLLA 1Y8FA 4BY5A 2MRDA 5FUVA 1GQMA 1UHJA 4MSPA 4YGDB 2NU3I 4DIRA 2G9BA 3QRXA 2K7DA 2R2IA 3OVOA 1AHRA 1YTZC 2K2AA 2ZFDA 3EK8A 1SGQI 1OYVI 1SBJA 2O5GA 1ZOTB 1B8LA 4C0JA 1CDNA 1K90D 2PASA 1BLQA 1CSOI 1S6IA 1XFUO 1B4CA 3OXGA 1MWNA 1CFPA 1IQ3A 5HI7A 3O4YA 2CNPA 2M1KB 1BR4B 1DVIA 1LVCD 1A4PA 1WRKA 1OE9B 3PATA 3VRNA 5I2OA 1SGNI 1U5KA 1LR7A 1NCYA 2SGFI 2NCOA 4HREE 1KFXS 2ENNA 3WHTB 1NSHA 1CT0I 1NX2A 3TUYB 2Y5IA 1W7IB 4C0LA 1A29A 3D0YA 1WRZA 1H8BA 2CTNA 1SNLA 3TS5B 1SMGA 1IY6A 2H61A 5TNCA 5EX0A 1JF2A 5K89A 1WY9A 4P2YB 1C7WA 1NX3A 1SGYI 2OS8C 1YU6C 3E2IA 1EH2A 1K9UA 5D7FA 2WVJA 3E59A 3VROA 1DJHA 3VRPA 1AVSA 1PVAA 3KPXA 3VGOA 1FI6A 5PALA 3SG7A 1B8CA 3TDIA 4MLWA 1W4RA 2CCMA 3ZNIA 2H2KA 1TCFA 2JNXA 3CZTX 2BCBA 1KQVA 5CCMA 1V1GA 2KGBC 1RFHA 4CFRA 1IQ5A 2KSPA 2LHLA 3OL0A 3FS7A 3LK0A 1BUSA 3HCMA 1J1DA 1G33A 2LV7A 2SGEI 4MN0A 2JXDA 1X02A 4HRGA 1U5IB 2F3YA 1HDLA 2K8MB 2MJWB 2KMOA 1K96A 1KSOA 1CMGA 3O78A 2LEOA 2LLSA 1M8CA 1SK6D 1IY5A 1WDCB 2FCDA 3SGQI 1QS7A 1M8BA 1BU3A 1DS3I 1XX6A 1S5GZ 3DVEA 2JW6A 2I2RE 1UHNA 2KAVA 1FAQA 2L8EA 3WHUB 2L98A 1NX0A 2MA2A 1OMRA 2KBIA 3MEKA 5HLVA 1L2OB 2L2EA 2CBLA 1YUUA 2MAZA 1EJ3A 3JTDB 4YGEB 2M7LA 1F4QA 1BODA 1YUSA 1B1GA 1M63B 3SEKC 2IS9A 2K2FA 2OTGC 2M49B 1Z7KB 2KFFA 3KO0A 1DF0A 2GGZA 1UHHA 1TBOA 2ROWA 1C07A 1CE3A 3I5GC 1KK8B 2GGMA 1BT6A 4NDBA 1LXFC 1SY9A 3FIAA 3O2PA 1QIWA 1PTRA 5DKQA 1G4YR 2KI6C 4PE7A 1TBNA 2B1UA 1JWDA 1DGUA 2QQDA 4I5KA 1AJ5A 1KQMB 3NXAA 4FTGA 4WRIA 1DGVA 3ICBA 1CLMA 1OSAA 1PSRA 2KBMA 2LMTA 2ZN8A 4YGAA 2J9RA 3SGBI 1SYMA 1X74A 2JZMA 1CDLA 1KK7Z 3RU0A 1MUXA 5HKYA 2ARPF 3PLFB 1OMDA 2KAXA 2JZIA 4E68A 3PALA 1SR6B 1OMUA 1KWOB 1CTRA 1NYAA 3DVKA 1KFXL 2LVJA 2OVOA 4E1PA 4DS7A 1MQ1A 2ORWA 2K9HA 2LAPA 5KSZA 4ORAB 1BF5A 1HPTA 1QX7A 4GI3C 3JVTB 3TDZA 1SL8A 4M2OA 1IH0A 1SGRI 1YTPA 2LVVA 1DJWA 3GK4X 4JQ0D 2GVIA 2JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M46 A;  2KDH A;  2L50 A;  4YGC B;  2ZN9 A;  3EVR A;  4PHJ A;  2GKR I;  4JPZ B;  1OZO A;  2SGQ I;  2LP2 A;  2PSR A;  2JXC A;  1CT4 I;  1OOJ A;  3EKH A;  2EGD A;  4PE0 A;  3PN7 C;  3OB2 B;  3BXK A;  2L4H A;  1M31 A;  3NSO A;  2KI4 B;  2JTT A;  1DJG A;  2A4J A;  2HQ8 A;  3CLN A;  1SL7 A;  2WC8 A;  4SGB I;  1F4O A;  2L51 A;  1XFZ O;  2F3C I;  3BUN B;  1A75 B;  1S6J A;  2M29 A;  3A8R A;  1W7J B;  3TS5 C;  2JRF A;  1PCE A;  4IL1 A;  5CSF A;  3KHE A;  4YGB B;  1TUR A;  1S3P A;  4QJ5 B;  1UVG A;  1PPF I;  3BOW B;  2MLE C;  1IJ5 A;  3CR2 A;  1DJX A;  2KHN A;  4M2Q A;  1PUL A;  1CGI I;  3OX5 A;  1B7T Z;  2Q91 A;  4DUQ A;  2WCF A;  1TIZ A;  2E6W A;  4GPL B;  4Q04 A;  1DTL A;  1DJY A;  2ERW A;  3GK2 A;  4PHK A;  1Y1B A;  1F54 A;  2CT9 A;  2PMY A;  2AMI A;  3A4U B;  1MT1 A;  2H61 C;  2VRG A;  1N13 A;  1TOP A;  1SCM B;  5FYX A;  1ZUZ A;  5HKW A;  1FPW A;  3QTL D;  3TDU A;  1SGE I;  3B4V C;  2JWW A;  1HQV A;  1RRO A;  4AQI A;  3IQO A;  4OKH A;  4MRY A;  1SCV A;  2N71 A;  1K94 A;  1MR8 A;  2BE6 A;  2QAC A;  1S26 D;  2JYY A;  3EKJ A;  1J7Q A;  1QX2 A;  4YBH B;  1G8I A;  1RK9 A;  3VRR A;  1L2O C;  3JTD C;  5GQQ C;  2LAN A;  1S5G Y;  2M9G A;  1GGW A;  1UVF A;  3SG6 A;  1F55 A;  1MXE A;  2COL B;  2WOR A;  1NPQ A;  1QX5 B;  1S6C A;  1WLZ A;  2K0J A;  4NDD A;  3WNX B;  1KK8 C;  1YUT A;  1XO5 A;  1IWQ A;  5DAE A;  3TJQ A;  2NXQ A;  3OX6 A;  1S1E A;  3LLE A;  2JPT A;  3NSK A;  2Q4U A;  3OHM B;  1UHK A;  1Y1A A;  4PE1 A;  1LIN A;  4PHN A;  1JSA A;  1UUC A;  3I5I B;  1K95 A;  2F33 A;  1H0Z A;  5G08 A;  2O60 A;  2QPT A;  2K7C A;  1CM1 A;  1PJU A;  1RFJ A;  3BUW B;  3K21 A;  1QAS A;  1EG4 A;  1EXR A;  1XFV O;  1LR9 A;  1R6P A;  1IRJ A;  4XJK B;  1J7O A;  1XK4 C;  4ORB B;  1UHI A;  1DJZ A;  2PRU A;  3D10 A;  4AOM A;  1RWY A;  1J55 A;  1KK7 Y;  1V1F A;  4WQ2 A;  4CID A;  2EC6 C;  1CB1 A;  1SPY A;  2BKH B;  2LP3 A;  3KEV A;  1CNP A;  2JUL A;  1K9K A;  3H4S E;  2N52 A;  3IF7 A;  1TIH A;  4M2P A;  1IW4 A;  2NU0 I;  3JVT C;  3WXA A;  1ALV A;  1MXL C;  1NCZ A;  1XK4 A;  2D8N A;  2LNK A;  1YX7 A;  1H4B A;  2ZRT A;  2G2B A;  3SIB A;  2LMU A;  5KU1 A;  1TBR R;  2BUS A;  5JHW C;  1OMV A;  1L7Z A;  4USL A;  2L5X B;  4PE4 A;  2OS8 B;  2P6A C;  1TTX A;  2GKT I;  3OB1 B;  2BL0 C;  3DF0 B;  1KFU S;  1BR1 B;  1NP8 A;  3LK1 A;  1QVI Z;  1IGV A;  2L0P A;  2KMR A;  1CKK A;  2NZ0 A;  3OP0 A;  2KI4 C;  2KGR A;  3DD4 A;  1RJV A;  1D1O A;  1IJ6 A;  1OMT A;  1AUI B;  1QAT A;  2Y4Q A;  1HJA I;  4L9M A;  3GOF A;  3I5H B;  1PSB A;  1C7V A;  1QLS A;  1QV0 A;  1UP5 A;  4CPV A;  2SGP I;  3CGA A;  4PAL A;  1K8U A;  3PSR A;  1YVL A;  1CHO I;  1CFD A;  3NSI A;  4GNK B;  5AER A;  4UPG A;  5CPV A;  4MEW A;  2BE4 A;  1REC A;  2I18 A;  2KOT A;  5DKN A;  5AFP A;  4GFT A;  2NU2 I;  1XFY O;  2M97 A;  2KFG A;  1A75 A;  4PHM A;  4MVF A;  2KMP A;  3AKA A;  3CR4 X;  2M3W A;  1FW4 A;  1QTX A;  4QJ4 B;  4MBE A;  1GJY A;  4GGN A;  3KF9 A;  3BOW A;  3FWB A;  3BUO B;  1JC2 A;  4HGU A;  2ZNE A;  2WND A;  3F45 A;  3EVU A;  1UUR A;  1WRL A;  4U8D A;  1QV1 A;  1MF8 B;  1SCM C;  2LVI A;  1CDP A;  5CSJ A;  1JBA A;  1ODB A;  2OTG B;  1N2D A;  3E3R A;  2JQ6 A;  3SIA A;  4YRU A;  5HLO A;  5AAN A;  4A4B A;  4N5X A;  2FCE A;  3TUY C;  1A03 A;  2B0U C;  1DS2 I;  2MBX A;  1SW8 A;  2JT3 A;  4WQ3 A;  3I5G B;  1EG3 A;  1DMO A;  3RM1 A;  3I5F B;  1JFK A;  4JWQ A;  2KQ6 A;  2KQY A;  1OZS A;  2NLN A;  3SG4 A;  1HT9 A;  2SGD I;  2KI6 D;  4ICB A;  4FQO A;  2WCE A;  3BQ3 A;  1XYD A;  3TZ1 A;  1M45 A;  1PK0 D;  2E30 A;  3O6B A;  1KSM A;  1XVJ A;  1XFX O;  2LLU A;  3CR5 X;  1Y1C A;  2M1U A;  5ER5 A;  2MLF C;  1TNW A;  2KYC A;  1YUR A;  1IKU A;  4F0Z B;  1EL4 A;  2L4I A;  4HRH A;  1K2H A;  1QLK A;  1ZAC A;  5I2L A;  2AUC A;  4OCI A;  1LA0 A;  1A2X A;  2LE9 B;  3GK1 A;  1WLM A;  4NDC A;  2GKV A;  1R2U A;  1SGD I;  2JTZ A;  1XFW O;  1VRK A;  1XA5 A;  2RGI A;  4ZCU A;  3SG2 A;  4OVN F;  4R1E A;  5ER4 X;  3FWC A;  2JC2 A;  3I5I C;  4HSZ A;  1K9P A;  1WDC C;  2HPS A;  5HYD A;  1TBQ R;  4DRW A;  5F6T A;  2LC5 A;  4TNC A;  1LR8 A;  1NCX A;  2PAL A;  1KMA A;  1KFU L;  1U5I A;  1FYB A;  4YI9 A;  1R0R I;  1UUS A;  2ZND A;  3RLZ A;  1AJ4 A;  1NIW A;  4ORC B;  1TNQ A;  2JXL A;  4QJ3 B;  5D69 A;  1ZFS A;  4N1G A;  3PN7 B;  3EVV A;  1YVH A;  2M0R A;  1BJF A;  1YRT B;  3IQQ A;  1LA3 A;  1TCO B;  1B9A A;  2HF5 A;  2KNE A;  4XJK A;  3VRQ A;  1DT7 B;  1Y1U A;  2BEC A;  2HQW A;  4OV2 A;  1K93 D;  2LM5 A;  2WOS A;  4P5O E;  1AN1 I;  1TGS I;  1CMF A;  2GV5 A;  2F2O A;  3SG5 A;  4DCK A;  1PAL A;  1LKJ A;  1S36 A;  1NX1 A;  4AQJ A;  5I8N A;  1KQM C;  1SL9 A;  2CXJ A;  2MHH A;  4PCW A;  2QQC A;  1B8R A;  1M39 A;  5J3X A;  3CS1 A;  4C0K A;  4N1F A;  5AXI A;  1CT2 I;  2JU0 A;  3BYA A;  1Y1X A;  1BG1 A;  1OVO A;  1Y0V H;  4I5L B;  1NUB A;  2BBM A;  1BOC A;  2BCX A;  2NU1 I;  2K7B A;  2I94 A;  2KMQ A;  3LCP C;  3AAK A;  3DVM A;  1ALW A;  1QVI Y;  1SR6 C;  2I7A A;  1KWO C;  1YRU B;  1FBV A;  2KAY A;  2Y1N A;  2AAO A;  1OQP A;  2LMV A;  3D0Y B;  3DF0 A;  3I5H C;  3DVJ A;  4MZJ A;  2ISD A;  3SG3 A;  1KCY A;  3LL8 B;  3C1V A;  4MZK A;  5AEQ A;  3BUX B;  4ZCV A;  1J7P A;  3AAJ A;  4MRX A;  1N0Y A;  1TN4 A;  2FJU B;  2XRC A;  1JUO A;  5KTY A;  4GBA A;  3HH2 C;  3AKB A;  1J1E A;  2K61 A;  1Q80 A;  3ZWH A;  1CFF A;  1F8H A;  1PVB A;  4CFQ A;  4I5N B;  4GAO A;  1DJI A;  4BY4 A;  2SAS A;  2PVB A;  4I5J A;  4NQG A;  2LCP A;  1E8A A;  2K7O A;  3PM8 A;  5B8I B;  2OPO A;  4D1E A;  2V53 A;  2M8U A;  1UWO A;  4ETO A;  1Y6W A;  1J7R A;  2KYF A;  1YR5 A;  4XYN A;  3MSE B;  2M5X A;  1QXP A;  2DOQ A;  2JOJ A;  2FOT A;  3HX4 A;  2F2P A;  4YI8 A;  4GUK A;  2LLT A;  3I5F C;  2KCX A;  1TNP A;  4OVO A;  2LUX A;  3CWG A;  4OR9 B;  5JJG A;  1SRA A;  1YX8 A;  5CSI A;  2WCY A;  1BMO A;  2ZKM X;  1TNX A;  2LUC A;  3EK4 A;  3BUM B;  2P6B B;  1B47 A;  1N65 A;  2F3Z A;  1CM4 A;  1AK8 A;  1DF0 B;  2KFH A;  1B7T Y;  2HET A;  3NSL A;  3M0W A;  2BCA A;  2EHB A;  1SKT A;  1F71 A;  2Y1M A;  1FF1 A;  3PFV A;  5JOL A;  1F70 A;  2BBN A;  1PRW A;  2EC6 B;  1JFJ A;  1SGP I;  3SJS A;  2BKI B;  1AP4 A;  2NCP A;  1MHO A;  2JT0 A;  2WCB A;  5DKR A;  1JF0 A;  5HKZ A;  3EK7 A;  1NWD A;  5IBW A;  2TN4 A;  2LHI A;  2JT8 A;  2M7N A;  1QJT A;  1CDM A;  1QIV A;  2SCP A;  2F8P A;  4MZL A;  5CSN A;  1CFC A;  1TRF A;  4GGF C;  2LVK A;  1CGJ I;  4A4C A;  5I2Q A;  1ZMZ A;  4CLN A;  2BL0 B;  5BPJ A;  1CLB A;  1TUS A;  2NU4 I;  4GGF A;  3CTN A;  1IG5 A;  1GGZ A;  1FI5 A;  2N17 A;  1RTP 1;  2ZRS A;  4PDZ A;  1CLL A;  4BY5 A;  2MRD A;  1GQM A;  1UHJ A;  4MSP A;  4YGD B;  2NU3 I;  4DIR A;  2G9B A;  3QRX A;  2K7D A;  2R2I A;  3OVO A;  1AHR A;  1YTZ C;  2K2A A;  2ZFD A;  3EK8 A;  1SGQ I;  1OYV I;  1SBJ A;  2O5G A;  1ZOT B;  1B8L A;  4C0J A;  1CDN A;  1K90 D;  2PAS A;  1BLQ A;  1CSO I;  1S6I A;  1XFU O;  1B4C A;  1MWN A;  1CFP A;  1IQ3 A;  3O4Y A;  2CNP A;  2M1K B;  1BR4 B;  1DVI A;  1LVC D;  1A4P A;  1WRK A;  1OE9 B;  3PAT A;  3VRN A;  5I2O A;  1SGN I;  1LR7 A;  1NCY A;  2SGF I;  2NCO A;  4HRE E;  1KFX S;  3WHT B;  1NSH A;  1CT0 I;  1NX2 A;  3TUY B;  2Y5I A;  1W7I B;  4C0L A;  1A29 A;  3D0Y A;  1WRZ A;  1H8B A;  2CTN A;  1SNL A;  3TS5 B;  1SMG A;  1IY6 A;  2H61 A;  5TNC A;  1JF2 A;  5K89 A;  1WY9 A;  4P2Y B;  1C7W A;  1NX3 A;  1SGY I;  2OS8 C;  1YU6 C;  1EH2 A;  1K9U A;  5D7F A;  3VRO A;  1DJH A;  3VRP A;  1AVS A;  1PVA A;  3KPX A;  3VGO A;  1FI6 A;  5PAL A;  3SG7 A;  1B8C A;  3TDI A;  4MLW A;  2CCM A;  3ZNI A;  2H2K A;  1TCF A;  2JNX A;  3CZT X;  2BCB A;  1KQV A;  1V1G A;  2KGB C;  4CFR A;  1IQ5 A;  2KSP A;  2LHL A;  1BUS A;  3FS7 A;  3LK0 A;  3HCM A;  1J1D A;  1G33 A;  2LV7 A;  2SGE I;  4MN0 A;  2JXD A;  1X02 A;  4HRG A;  1U5I B;  2F3Y A;  1HDL A;  2K8M B;  2MJW B;  2KMO A;  1K96 A;  1KSO A;  1CMG A;  3O78 A;  2LEO A;  2LLS A;  1M8C A;  1SK6 D;  1IY5 A;  1WDC B;  2FCD A;  3SGQ I;  1QS7 A;  1M8B A;  1BU3 A;  1DS3 I;  1S5G Z;  3DVE A;  2I2R E;  1UHN A;  2KAV A;  3WHU B;  2L98 A;  1NX0 A;  2MA2 A;  1OMR A;  2KBI A;  5HLV A;  1L2O B;  2L2E A;  2CBL A;  1YUU A;  2MAZ A;  1EJ3 A;  3JTD B;  4YGE B;  2M7L A;  1F4Q A;  1BOD A;  1YUS A;  1B1G A;  1M63 B;  3SEK C;  2IS9 A;  2K2F A;  2OTG C;  2M49 B;  1Z7K B;  2KFF A;  3KO0 A;  1DF0 A;  2GGZ A;  1UHH A;  1C07 A;  1CE3 A;  3I5G C;  1KK8 B;  2GGM A;  1BT6 A;  4NDB A;  1LXF C;  1SY9 A;  3FIA A;  3O2P A;  1QIW A;  5DKQ A;  1G4Y R;  2KI6 C;  4PE7 A;  2B1U A;  1JWD A;  1DGU A;  2QQD A;  4I5K A;  1AJ5 A;  1KQM B;  3NXA A;  4FTG A;  4WRI A;  1DGV A;  3ICB A;  1CLM A;  1OSA A;  1PSR A;  2KBM A;  2LMT A;  2ZN8 A;  4YGA A;  3SGB I;  1SYM A;  2JZM A;  1CDL A;  1KK7 Z;  1MUX A;  5HKY A;  2ARP F;  3PLF B;  1OMD A;  2KAX A;  2JZI A;  4E68 A;  3PAL A;  1SR6 B;  1OMU A;  1KWO B;  1CTR A;  1NYA A;  3DVK A;  1KFX L;  2LVJ A;  2OVO A;  4DS7 A;  1MQ1 A;  2LAP A;  5KSZ A;  4ORA B;  1BF5 A;  1HPT A;  1QX7 A;  4GI3 C;  3JVT B;  3TDZ A;  1SL8 A;  4M2O A;  1IH0 A;  1SGR I;  1YTP A;  2LVV A;  1DJW A;  3GK4 X;  4JQ0 D;  2JNF A; 
#chains in the Genus database with same CATH topology
 1M46 A;  2KDH A;  4YGC B;  2ZN9 A;  4PHJ A;  2SGQ I;  3VDP A;  1CT4 I;  2EGD A;  3OB2 B;  2HQ8 A;  4SGB I;  3BUN B;  3A8R A;  1W7J B;  2JRF A;  3R1V A;  4YGB B;  2MLE C;  2QQ0 A;  3D00 A;  3EG5 B;  2E6W A;  4Q04 A;  2BNX A;  1F54 A;  3DY9 A;  1N13 A;  1OOG A;  1FPW A;  1SGE I;  2JWW A;  3B6X A;  4AQI A;  3IQO A;  4OKH A;  4MRY A;  1WGT A;  2N71 A;  2JYY A;  3EKJ A;  3JTD C;  2LAN A;  2M9G A;  1GGW A;  2ERB A;  1NPQ A;  1KK8 C;  2CWF A;  1XO5 A;  1IWQ A;  3OX6 A;  1S1E A;  2Q4U A;  4PE1 A;  1JSA A;  5G08 A;  1X4S A;  2KPH A;  3CAB A;  2B8T A;  1J7O A;  1VDD A;  5FUY A;  2LP3 A;  1K9K A;  1TIH A;  1ALV A;  1MXL C;  1NCZ A;  1YX7 A;  2LMU A;  2L5X B;  2OS8 B;  1TTX A;  2GKT I;  3OB1 B;  2BL0 C;  3DF0 B;  1KFU S;  1BR1 B;  1CKK A;  3OP0 A;  2KI4 C;  1OMT A;  1QAT A;  9WGA A;  4L9M A;  1QV0 A;  1YVL A;  1MJB A;  1REC A;  5DKN A;  3UO9 A;  2M97 A;  4PHM A;  4MVF A;  2QQE A;  3BOW A;  3BUO B;  4HGU A;  2WND A;  3EVU A;  2N1A B;  4U8D A;  1QV1 A;  5CSJ A;  1N2D A;  2WCM A;  1DQE A;  3RM1 A;  2A20 A;  2KQY A;  2NLN A;  2SGD I;  1OOF A;  3R5C A;  2WCE A;  2RIJ A;  3TZ1 A;  2UZ3 A;  3O6B A;  1XFX O;  5ER5 A;  3D73 A;  3B86 A;  1EL4 A;  2AUC A;  2LE9 B;  1WLM A;  4NDC A;  2GKV A;  1VRK A;  4ZCU A;  1DC1 A;  4OVN F;  5ER4 X;  3FWC A;  1K9P A;  1WDC C;  5HYD A;  1TBQ R;  5F6T A;  2LC5 A;  1NCX A;  1U5I A;  4YI9 A;  2ZND A;  2JXL A;  4QJ3 B;  1IIO A;  4N1G A;  1TCO B;  2HF5 A;  1DT7 B;  3S0A A;  4OV2 A;  2DB6 A;  2WOS A;  2W0T A;  1SL9 A;  1B8R A;  1M39 A;  1CT2 I;  1KBF A;  1NUB A;  1TOT A;  2GIV A;  2KMQ A;  3AAK A;  2KAY A;  2ISD A;  2AAO A;  3I5H C;  3LL8 B;  4ZCV A;  1TUJ A;  5KTY A;  3VDU A;  1Q80 A;  3ZWH A;  4CFQ A;  4GAO A;  1DJI A;  2LCP A;  1E8A A;  4D1E A;  2V53 A;  2M8U A;  4XYN A;  2DOQ A;  4YI8 A;  2LLT A;  4OVO A;  2LUX A;  4OR9 B;  4UXJ A;  3EK4 A;  1B47 A;  1N65 A;  1B7T Y;  3M0W A;  1FF1 A;  3PFV A;  5JOL A;  1F70 A;  3FSY A;  1AP4 A;  5HKZ A;  3EK7 A;  1ULM A;  4FQT A;  2TN4 A;  2LHI A;  1QIV A;  3FE9 A;  3GOX A;  5CSN A;  2BL0 B;  5J8F A;  1FI5 A;  2WCK A;  4INX A;  1RTP 1;  2MRD A;  5FUV A;  4MSP A;  2X3T A;  4DIR A;  2G9B A;  3OVO A;  3EK8 A;  1SBJ A;  1CDN A;  3UNW A;  1S6I A;  2YGU A;  1XFU O;  1IQ3 A;  1BR4 B;  1DVI A;  1WRK A;  5I2O A;  2KLD A;  1NCY A;  2SGF I;  4C0L A;  1A29 A;  2CTN A;  3BFB A;  2H61 A;  5TNC A;  1JF2 A;  1WY9 A;  1EH2 A;  1FI6 A;  3VGO A;  1UHA A;  2GTE A;  3TDI A;  3CZT X;  1KQV A;  2BCB A;  1V1G A;  2KGB C;  5D3O A;  1ULN A;  1J1D A;  4MN0 A;  2JXD A;  1U5I B;  1WDC B;  1QS7 A;  1BU3 A;  2JW6 A;  2KAV A;  3WHU B;  2MA2 A;  1OMR A;  2KBI A;  3BFH A;  5HLV A;  2L2E A;  1YUS A;  3B88 A;  2IS9 A;  2OTG C;  1DF0 A;  2QEV A;  1CE3 A;  3I5G C;  2GGM A;  4NDB A;  1SY9 A;  3FIA A;  3QME A;  1PTR A;  1QIW A;  1G4Y R;  2KI6 C;  1TBN A;  2B1U A;  1AJ5 A;  3TOA A;  1CLM A;  1OSA A;  2ZN8 A;  2LMT A;  5HL1 A;  1OMD A;  2KAX A;  3PAL A;  1CTR A;  4WP4 A;  1KFX L;  2OVO A;  4ORA B;  1SL8 A;  1SGR I;  1P9G A;  1YTP A;  2CWG A;  2JNF A;  3EVR A;  4JPZ B;  1OZO A;  2WC5 A;  2LP2 A;  2PSR A;  3EKH A;  3PN7 C;  5CCL A;  1M31 A;  1DJG A;  3UGL A;  1XFZ O;  5CSF A;  4QJ5 B;  1PUL A;  1CGI I;  2Q91 A;  1QWV A;  4DUQ A;  2PYQ A;  2WCF A;  2ERW A;  2QEH A;  2PMY A;  2AMI A;  2WCJ A;  3A4U B;  1MT1 A;  1DEK A;  4FKD A;  1RRO A;  1MR8 A;  2QAC A;  4UXI A;  4YBH B;  1RK9 A;  1MXE A;  1WLZ A;  4NDD A;  3WNX B;  3Q8I A;  5DAE A;  1UHK A;  4PHN A;  3I5I B;  2F33 A;  1H0Z A;  1CM1 A;  3BUW B;  3K21 A;  1EG4 A;  1R6P A;  4XJK B;  3DZT A;  1XK4 C;  1DJZ A;  4AOM A;  1J55 A;  1V1F A;  4WQ2 A;  1CB1 A;  1SPY A;  2N52 A;  3H4S E;  1XK4 A;  2LNK A;  1TBR R;  2BUS A;  5JHW C;  4INW A;  1OMV A;  1L7Z A;  2P6A C;  1NP8 A;  2NZ0 A;  1D1O A;  2JA1 A;  1V1H A;  2YQP A;  2OD1 A;  4PAL A;  1K8U A;  1CHO I;  2ORV A;  5AFP A;  3B87 A;  2KFG A;  1A75 A;  3AKA A;  3PJI A;  3CR4 X;  4QJ4 B;  4MBE A;  3KF9 A;  1W9Z A;  1SCM C;  1JBA A;  1ODB A;  2OTG B;  2B0U C;  5HLO A;  5AAN A;  4WQ3 A;  3I5G B;  1EG3 A;  1DMO A;  3I5F B;  2KQ6 A;  1OW4 A;  4ICB A;  4FQO A;  1PK0 D;  2E30 A;  5E3Q A;  2LLU A;  2P71 A;  2M1U A;  2MLF C;  1YUR A;  1K2H A;  3UOE A;  1LA0 A;  3GK1 A;  1R2U A;  1SGD I;  1XA5 A;  3SG2 A;  3SS3 A;  4R1E A;  2JC2 A;  3QWP A;  2HPS A;  2PAL A;  1KFU L;  1FYB A;  1R0R I;  3RLZ A;  4ORC B;  3S0B A;  3PN7 B;  1YVH A;  2M0R A;  1LA3 A;  2KNE A;  1K93 D;  3CZ2 A;  3R1O A;  1CMF A;  1S36 A;  1NX1 A;  1KQM C;  2CXJ A;  5AXI A;  3BYA A;  1Y1X A;  3SS5 A;  1OVO A;  1BOC A;  2DIP A;  3LCP C;  4GNK B;  3OXL A;  1FBV A;  1OQP A;  4MZJ A;  3DVJ A;  3AAJ A;  4MRX A;  3HH2 C;  3QAH A;  1XFR A;  3AKB A;  2K61 A;  1F8H A;  4BY4 A;  1MJ9 A;  3R5A A;  3NHT A;  2KYF A;  2M5X A;  2DKV A;  2JOJ A;  2FOT A;  3HX4 A;  4GUK A;  1TNP A;  3CWG A;  1NXU A;  1SRA A;  1YX8 A;  1TNX A;  1XBT A;  3UEY A;  2P6B B;  1CM4 A;  2EHB A;  2Y1M A;  2BKI B;  2JT0 A;  4MZL A;  3CDN A;  3UEJ A;  1CGJ I;  5BPJ A;  1TUS A;  1IG5 A;  2N17 A;  3R72 A;  2ZRS A;  1CLL A;  4YGD B;  3D75 A;  1YTZ C;  1OYV I;  2O5G A;  1ZOT B;  4C0J A;  3O4Y A;  2CNP A;  1OE9 B;  1LR7 A;  3D76 A;  1NSH A;  2Y5I A;  3D0Y A;  1WRZ A;  1H8B A;  2WGC A;  1C7W A;  1YU6 C;  1SGY I;  3E2I A;  4AML A;  4F7F A;  1AVS A;  3KPX A;  1B8C A;  2CCM A;  3ZNI A;  1TCF A;  2KSP A;  2LHL A;  1BUS A;  1HDL A;  2K8M B;  2MJW B;  2KMO A;  1K96 A;  3O78 A;  2LEO A;  2LLS A;  3D74 A;  2WCL A;  1M8B A;  1DS3 I;  5E3P A;  1S5G Z;  2I2R E;  1UHN A;  1WGC A;  3JTD B;  1YUU A;  2MAZ A;  1EJ3 A;  2M7L A;  1BOD A;  2WC6 A;  1B1G A;  1M63 B;  3KO0 A;  2GGZ A;  2ROW A;  1C07 A;  1KK8 B;  3O2P A;  3R5B A;  4PE7 A;  1DGU A;  2QQD A;  3PM2 A;  1KQM B;  3SGB I;  3VB1 A;  4MPI A;  1NYA A;  3TOB A;  3DVK A;  2UVO A;  4DS7 A;  2ORW A;  2K9H A;  2LAP A;  1QX7 A;  3TDZ A;  3R5D A;  3GK4 X;  3BJI A;  2JXC A;  1OOJ A;  4PE0 A;  2L4H A;  3S0G A;  2KI4 B;  2JTT A;  2A4J A;  3CLN A;  1SL7 A;  2F3C I;  2L5Y A;  1S6J A;  3TS5 C;  1PCE A;  4IL1 A;  3KHE A;  3BOW B;  1DJX A;  3FSX A;  1FY7 A;  1TIZ A;  4GPL B;  1DTL A;  1DJY A;  3GK2 A;  1Y1B A;  2CT9 A;  3L47 A;  2H61 C;  2VRG A;  1TOP A;  5FYX A;  1ZUZ A;  3QTL D;  1SSE B;  1J7Q A;  1QX2 A;  3VRR A;  1L2O C;  5GQQ C;  1S5G Y;  1UVF A;  3SG6 A;  1F55 A;  1QX5 B;  1S6C A;  2K0J A;  1YUT A;  3TJQ A;  2E73 A;  3NSK A;  3OHM B;  1LIN A;  1UUC A;  1K95 A;  5FI6 A;  2YUU A;  1RFJ A;  1MJA A;  1LR9 A;  1UHI A;  1Z2I A;  4CID A;  3UFF A;  2JUL A;  3IF7 A;  4M2P A;  1IW4 A;  3JVT C;  1TUZ A;  2D8N A;  2E5R A;  3SIB A;  4USL A;  4PE4 A;  1P9Z A;  1QVI Z;  1IGV A;  2L0P A;  1RJV A;  3NGV A;  1IJ6 A;  1AUI B;  1HEV A;  3GOF A;  3I5H B;  1PSB A;  1QLS A;  2SGP I;  3FC3 A;  3NSI A;  4UPG A;  2BE4 A;  2I18 A;  2KOT A;  4GFT A;  1R79 A;  1QTX A;  1GJY A;  4GGN A;  2CWH A;  3FWB A;  3R1P A;  2ZNE A;  1UUR A;  1WRL A;  2LVI A;  4YRU A;  3E3R A;  2JQ6 A;  1A03 A;  4N5X A;  2LB7 A;  1DS2 I;  1JFK A;  4JWQ A;  1HT9 A;  2KI6 D;  1M45 A;  1KSM A;  1XVJ A;  3CZ1 A;  1TNW A;  1IKU A;  5EX3 A;  2L4I A;  4HRH A;  1QLK A;  1ZAC A;  5J8C A;  3UGI A;  1XFW O;  2RGI A;  1WTJ A;  3DXL A;  4DRW A;  1LR8 A;  1C3Y A;  3UGD A;  5HQ8 A;  1NIW A;  1S20 A;  1TNQ A;  5D69 A;  1ZFS A;  2CJS C;  3L4A A;  3EVV A;  1BJF A;  1YRT B;  3IQQ A;  1B9A A;  3VRQ A;  1Y1U A;  2QPO A;  2LM5 A;  5FI2 A;  1AN1 I;  1TGS I;  4DCK A;  3D77 A;  2QQC A;  3BFA A;  4C0K A;  4N1F A;  2JU0 A;  1BG1 A;  1Y0V H;  4I5L B;  2BCX A;  3PDN A;  1QVI Y;  1SR6 C;  2I7A A;  2Y1N A;  3CZ0 A;  3DF0 A;  3C1V A;  4MZK A;  2XRC A;  1J1E A;  1CFF A;  5EL2 A;  3IVT A;  4B6D A;  2PVB A;  2L7X A;  2K7O A;  3PM8 A;  5B8I B;  1UWO A;  4ETO A;  1YR5 A;  5E3R A;  3CXL A;  3V2L A;  2J87 A;  5JJG A;  2WCY A;  5CSI A;  2LUC A;  2L2C A;  2F3Z A;  1AK8 A;  1DF0 B;  2HET A;  2BCA A;  1F71 A;  1SGP I;  1JFJ A;  2NCP A;  1MHO A;  2QEO A;  2WCB A;  5DKR A;  1JF0 A;  2M7N A;  2SCP A;  1CFC A;  2LVK A;  4A4C A;  4UXH A;  3CTN A;  4PDZ A;  4BY5 A;  1K7V A;  1GQM A;  1UHJ A;  3DYE A;  3QRX A;  2R2I A;  1AHR A;  2K2A A;  1B8L A;  2PAS A;  1CSO I;  3OXG A;  1CFP A;  3OXF A;  1A4P A;  1SGN I;  1U5K A;  3TO6 A;  2NCO A;  3WHT B;  1CT0 I;  1LS8 A;  1SNL A;  5EX0 A;  5K89 A;  1NX3 A;  1K9U A;  3VRO A;  5PAL A;  2H2K A;  2JNX A;  5CCM A;  1RFH A;  4CFR A;  3FS7 A;  3LK0 A;  3HCM A;  2LV7 A;  2F3Y A;  3FE8 A;  5I94 A;  1CMG A;  1M8C A;  1SK6 D;  1IY5 A;  3SGQ I;  3D78 A;  1XX6 A;  3DVE A;  1FAQ A;  3OBV A;  2L98 A;  3MEK A;  3TO9 A;  4JD9 A;  2K2F A;  1Z7K B;  1ORG A;  2KFF A;  4FTG A;  1PSR A;  2KBM A;  4YGA A;  1CDL A;  1KK7 Z;  5FI7 A;  1MUX A;  5HKY A;  2JZI A;  4E68 A;  1SR6 B;  1OMU A;  1K7U A;  5KSZ A;  1HPT A;  4GI3 C;  4M2O A;  2LVV A;  4JQ0 D;  1FAR A;  1T14 A;  2L50 A;  2GKR I;  1XA6 A;  3BXK A;  1GM0 A;  3NSO A;  2WC8 A;  1F4O A;  2L51 A;  1A75 B;  2M29 A;  1TUR A;  1S3P A;  1UVG A;  1PPF I;  1PTQ A;  1IJ5 A;  3CR2 A;  2KHN A;  4M2Q A;  3OX5 A;  1B7T Z;  1V1I A;  4PHK A;  2LUY A;  4JCV E;  2WCH A;  1SCM B;  5HKW A;  3TDU A;  3B4V C;  1HQV A;  1SCV A;  1K94 A;  2BE6 A;  1S26 D;  1DEL A;  1G8I A;  2VRW B;  3BJH A;  2WOR A;  2COL B;  2NXQ A;  3LLE A;  2JPT A;  1Y1A A;  2O60 A;  2QPT A;  2K7C A;  1PJU A;  1QAS A;  1EXR A;  1XFV O;  1IRJ A;  4ORB B;  3S0E A;  2PRU A;  3D10 A;  2ODD A;  1RWY A;  1KK7 Y;  2EC6 C;  2BKH B;  3KEV A;  1CNP A;  2NU0 I;  3WXA A;  1H4B A;  4DNC A;  2ZRT A;  2G2B A;  5KU1 A;  2P70 A;  3LK1 A;  2KMR A;  5DIC A;  2KGR A;  3DD4 A;  2Y4Q A;  1HJA I;  1C3Z A;  1C7V A;  1UP5 A;  4CPV A;  3CGA A;  3PSR A;  1CFD A;  2RC4 A;  5AER A;  2FNF X;  5CPV A;  4MEW A;  2NU2 I;  1XFY O;  1W3S A;  3NHI A;  2KMP A;  3K1E A;  2M3W A;  1FW4 A;  1JC2 A;  2PQL A;  3F45 A;  1MF8 B;  1CDP A;  4A24 A;  3SIA A;  4A4B A;  2FCE A;  3TUY C;  2MBX A;  1SW8 A;  2JT3 A;  2ENZ A;  1OZS A;  3SG4 A;  1OOH A;  3BQ3 A;  4E1R A;  1XYD A;  3RZS A;  4IJ7 A;  1Y1C A;  3CR5 X;  2KYC A;  2BAP A;  4F0Z B;  2K60 A;  5I2L A;  4OCI A;  3L4L A;  1A2X A;  2JTZ A;  3I5I C;  4HSZ A;  4TNC A;  1KMA A;  1P28 A;  1UUS A;  3S0D A;  1AJ4 A;  7WGA A;  4XJK A;  2BEC A;  2HQW A;  1Z4H A;  3FE6 A;  4P5O E;  3N7H A;  2GV5 A;  2F2O A;  3SG5 A;  1PAL A;  1LKJ A;  2Y0M A;  4AQJ A;  5I8N A;  4PCW A;  2MHH A;  5J3X A;  3CS1 A;  5FUW A;  2BBM A;  2NU1 I;  2K7B A;  2I94 A;  3DVM A;  1ALW A;  1KWO C;  1YRU B;  3D0Y B;  2LMV A;  3SG3 A;  1KCY A;  5AEQ A;  3BUX B;  1J7P A;  1N0Y A;  1TN4 A;  2FJU B;  1JUO A;  1OOI X;  4GBA A;  3SS4 A;  1PVB A;  4I5N B;  3O4X A;  2SAS A;  4I5J A;  4NQG A;  2OPO A;  1Y6W A;  1J7R A;  3MSE B;  1QXP A;  2F2P A;  3I5F C;  2JPO A;  2KCX A;  2OZU A;  3KY9 A;  3S0F A;  1KBE A;  1BMO A;  2ZKM X;  3BUM B;  2KFH A;  3NSL A;  1SKT A;  2BBN A;  1PRW A;  2EC6 B;  3SJS A;  5FUX A;  1NWD A;  5IBW A;  3VE5 A;  2ELI A;  2JT8 A;  1QJT A;  1CDM A;  2F8P A;  1K7T A;  1TRF A;  4GGF C;  2X52 A;  5I2Q A;  1ZMZ A;  4CLN A;  2V1C C;  1CLB A;  2NU4 I;  4GGF A;  1GGZ A;  4OZD A;  2QEB A;  2V1C A;  1Y8F A;  2NU3 I;  2K7D A;  2ZFD A;  1SGQ I;  4KYN A;  1K90 D;  1BLQ A;  1B4C A;  1MWN A;  3B7A A;  5HI7 A;  2M1K B;  3VRN A;  1LVC D;  3PAT A;  2QDI A;  4HRE E;  1KFX S;  2ENN A;  3CYZ A;  1NX2 A;  3TUY B;  1W7I B;  2FJY A;  3TS5 B;  1SMG A;  1IY6 A;  4P2Y B;  2OS8 C;  5D7F A;  2WVJ A;  3E59 A;  1DJH A;  3VRP A;  1PVA A;  3SG7 A;  4MLW A;  1TWO A;  1W4R A;  3OL0 A;  1IQ5 A;  2SGE I;  1G33 A;  2KLE A;  1X02 A;  4HRG A;  1KSO A;  2PQ8 A;  2FCD A;  2H8V A;  2L8E A;  1NX0 A;  1L2O B;  2CBL A;  4YGE B;  1F4Q A;  2OU2 A;  3SEK C;  2M49 B;  1TBO A;  1UHH A;  1BT6 A;  1LXF C;  5DKQ A;  1JWD A;  4I5K A;  4JKT A;  3NXA A;  4WRI A;  3TO7 A;  1DGV A;  3ICB A;  1ULK A;  2J9R A;  1SYM A;  1X74 A;  2JZM A;  4PT1 A;  3RU0 A;  2ARP F;  3PLF B;  1KWO B;  2LVJ A;  4E1P A;  1Q9B A;  1Z2C B;  1MQ1 A;  1BF5 A;  3JVT B;  1IH0 A;  1WKX A;  1DJW A;  3OGN A;  2GVI A; 
#chains in the Genus database with same CATH homology
 1M46 A;  2KDH A;  2L50 A;  1FAR A;  4YGC B;  2ZN9 A;  3EVR A;  4PHJ A;  2GKR I;  4JPZ B;  1OZO A;  2SGQ I;  2LP2 A;  2PSR A;  2JXC A;  1CT4 I;  3BJI A;  3VDP A;  1OOJ A;  3EKH A;  2EGD A;  4PE0 A;  3PN7 C;  1XA6 A;  3OB2 B;  3BXK A;  2L4H A;  5CCL A;  1M31 A;  3NSO A;  2KI4 B;  2JTT A;  1DJG A;  2A4J A;  2HQ8 A;  3CLN A;  1SL7 A;  2WC8 A;  4SGB I;  1F4O A;  3UGL A;  2L51 A;  1XFZ O;  2F3C I;  3BUN B;  1A75 B;  1S6J A;  2M29 A;  3A8R A;  1W7J B;  3TS5 C;  2JRF A;  1PCE A;  4IL1 A;  5CSF A;  3KHE A;  4YGB B;  1TUR A;  1S3P A;  4QJ5 B;  1UVG A;  1PPF I;  1PTQ A;  3BOW B;  2MLE C;  2QQ0 A;  1IJ5 A;  3CR2 A;  1DJX A;  2KHN A;  4M2Q A;  3D00 A;  1PUL A;  1CGI I;  3OX5 A;  1B7T Z;  2Q91 A;  4DUQ A;  2WCF A;  1TIZ A;  2E6W A;  4GPL B;  4Q04 A;  1DTL A;  1DJY A;  2ERW A;  3GK2 A;  1V1I A;  4PHK A;  1Y1B A;  2LUY A;  1F54 A;  4JCV E;  2CT9 A;  2PMY A;  2AMI A;  3A4U B;  1MT1 A;  2H61 C;  2VRG A;  1N13 A;  1TOP A;  1SCM B;  5FYX A;  1ZUZ A;  5HKW A;  1FPW A;  3QTL D;  4FKD A;  3TDU A;  1SGE I;  3B4V C;  2JWW A;  1HQV A;  1RRO A;  4AQI A;  3IQO A;  4OKH A;  4MRY A;  1SCV A;  2N71 A;  1K94 A;  1MR8 A;  2BE6 A;  2QAC A;  1S26 D;  2JYY A;  3EKJ A;  1J7Q A;  4UXI A;  1QX2 A;  4YBH B;  1G8I A;  1RK9 A;  3VRR A;  1L2O C;  3JTD C;  5GQQ C;  2LAN A;  1S5G Y;  2VRW B;  2M9G A;  1GGW A;  1UVF A;  3SG6 A;  1F55 A;  1MXE A;  2COL B;  2WOR A;  1NPQ A;  1QX5 B;  1S6C A;  1WLZ A;  2K0J A;  4NDD A;  3WNX B;  1KK8 C;  1YUT A;  1XO5 A;  1IWQ A;  5DAE A;  3TJQ A;  2NXQ A;  3OX6 A;  1S1E A;  3LLE A;  2JPT A;  2E73 A;  3NSK A;  2Q4U A;  3OHM B;  1UHK A;  1Y1A A;  4PE1 A;  1LIN A;  4PHN A;  1JSA A;  1UUC A;  3I5I B;  1K95 A;  2F33 A;  1H0Z A;  5G08 A;  2O60 A;  1X4S A;  2QPT A;  2K7C A;  1CM1 A;  1PJU A;  2YUU A;  1RFJ A;  3BUW B;  3K21 A;  1QAS A;  1EG4 A;  1EXR A;  1XFV O;  1LR9 A;  2B8T A;  1R6P A;  1IRJ A;  4XJK B;  1J7O A;  1XK4 C;  4ORB B;  1UHI A;  1DJZ A;  1VDD A;  5FUY A;  2PRU A;  3D10 A;  2ODD A;  4AOM A;  1RWY A;  1J55 A;  1KK7 Y;  1V1F A;  4WQ2 A;  4CID A;  2EC6 C;  1CB1 A;  1SPY A;  2BKH B;  2LP3 A;  3KEV A;  3UFF A;  1CNP A;  2JUL A;  1K9K A;  3H4S E;  2N52 A;  3IF7 A;  1TIH A;  4M2P A;  1IW4 A;  2NU0 I;  3JVT C;  3WXA A;  1ALV A;  1MXL C;  1NCZ A;  1XK4 A;  2D8N A;  2LNK A;  1YX7 A;  2E5R A;  1H4B A;  2ZRT A;  2G2B A;  3SIB A;  2LMU A;  5KU1 A;  1TBR R;  2BUS A;  5JHW C;  1OMV A;  1L7Z A;  4USL A;  2L5X B;  4PE4 A;  2OS8 B;  2P6A C;  1TTX A;  2GKT I;  3OB1 B;  2BL0 C;  3DF0 B;  1KFU S;  1BR1 B;  1NP8 A;  3LK1 A;  1QVI Z;  1IGV A;  2L0P A;  2KMR A;  1CKK A;  2NZ0 A;  3OP0 A;  2KI4 C;  2KGR A;  3DD4 A;  1RJV A;  1D1O A;  2JA1 A;  1IJ6 A;  1OMT A;  1V1H A;  1AUI B;  1QAT A;  2Y4Q A;  1HJA I;  4L9M A;  2YQP A;  3GOF A;  3I5H B;  1PSB A;  1C7V A;  1QLS A;  2OD1 A;  1QV0 A;  1UP5 A;  4CPV A;  2SGP I;  3CGA A;  4PAL A;  1K8U A;  3FC3 A;  3PSR A;  1YVL A;  1CHO I;  1CFD A;  3NSI A;  4GNK B;  2ORV A;  5AER A;  4UPG A;  2FNF X;  5CPV A;  4MEW A;  2BE4 A;  1REC A;  2I18 A;  2KOT A;  5DKN A;  5AFP A;  4GFT A;  2NU2 I;  1XFY O;  2M97 A;  2KFG A;  1R79 A;  1A75 A;  4PHM A;  4MVF A;  1W3S A;  2KMP A;  3AKA A;  2QQE A;  3CR4 X;  2M3W A;  1FW4 A;  1QTX A;  4QJ4 B;  4MBE A;  1GJY A;  4GGN A;  3KF9 A;  3BOW A;  3FWB A;  3BUO B;  1JC2 A;  4HGU A;  2ZNE A;  2WND A;  3F45 A;  3EVU A;  1UUR A;  1WRL A;  4U8D A;  2N1A B;  1QV1 A;  1MF8 B;  1SCM C;  2LVI A;  1CDP A;  5CSJ A;  1JBA A;  4A24 A;  1ODB A;  2OTG B;  1N2D A;  3E3R A;  2JQ6 A;  3SIA A;  4YRU A;  5HLO A;  5AAN A;  4A4B A;  4N5X A;  2FCE A;  3TUY C;  1A03 A;  2B0U C;  1DS2 I;  2MBX A;  1SW8 A;  2JT3 A;  4WQ3 A;  3I5G B;  2ENZ A;  1EG3 A;  1DMO A;  3RM1 A;  3I5F B;  1JFK A;  4JWQ A;  2KQ6 A;  2A20 A;  2KQY A;  1OZS A;  2NLN A;  3SG4 A;  1HT9 A;  2SGD I;  2KI6 D;  4ICB A;  4FQO A;  2WCE A;  3BQ3 A;  4E1R A;  1XYD A;  3TZ1 A;  1M45 A;  1PK0 D;  2E30 A;  2UZ3 A;  3O6B A;  1KSM A;  1XVJ A;  1XFX O;  2LLU A;  3CR5 X;  1Y1C A;  2M1U A;  5ER5 A;  2MLF C;  1TNW A;  2KYC A;  1YUR A;  1IKU A;  5EX3 A;  4F0Z B;  1EL4 A;  2L4I A;  4HRH A;  1K2H A;  1QLK A;  1ZAC A;  5I2L A;  2AUC A;  4OCI A;  1LA0 A;  1A2X A;  2LE9 B;  3GK1 A;  1WLM A;  4NDC A;  2GKV A;  1R2U A;  1SGD I;  2JTZ A;  3UGI A;  1XFW O;  1VRK A;  1XA5 A;  2RGI A;  4ZCU A;  3OXL A;  3SG2 A;  4OVN F;  4R1E A;  5ER4 X;  3FWC A;  2JC2 A;  3I5I C;  4HSZ A;  1K9P A;  1WDC C;  3QWP A;  2HPS A;  5HYD A;  1TBQ R;  4DRW A;  5F6T A;  2LC5 A;  4TNC A;  1LR8 A;  1NCX A;  2PAL A;  1KMA A;  1KFU L;  3UGD A;  1U5I A;  1FYB A;  4YI9 A;  1R0R I;  5HQ8 A;  1UUS A;  2ZND A;  3RLZ A;  1AJ4 A;  1NIW A;  4ORC B;  1TNQ A;  2JXL A;  4QJ3 B;  5D69 A;  1ZFS A;  2CJS C;  4N1G A;  3PN7 B;  3EVV A;  1YVH A;  2M0R A;  1BJF A;  1YRT B;  3IQQ A;  1LA3 A;  1TCO B;  1B9A A;  2HF5 A;  2KNE A;  4XJK A;  3VRQ A;  1DT7 B;  1Y1U A;  2BEC A;  2HQW A;  2QPO A;  4OV2 A;  2DB6 A;  1K93 D;  2LM5 A;  2WOS A;  4P5O E;  1AN1 I;  1TGS I;  1CMF A;  2GV5 A;  2F2O A;  3SG5 A;  4DCK A;  1PAL A;  1LKJ A;  1S36 A;  1NX1 A;  4AQJ A;  2W0T A;  5I8N A;  1KQM C;  1SL9 A;  2CXJ A;  2MHH A;  4PCW A;  2QQC A;  1B8R A;  1M39 A;  5J3X A;  3CS1 A;  4C0K A;  4N1F A;  5AXI A;  1CT2 I;  2JU0 A;  3BYA A;  1Y1X A;  1BG1 A;  5FUW A;  1OVO A;  1Y0V H;  1KBF A;  4I5L B;  1NUB A;  2BBM A;  1BOC A;  2BCX A;  1TOT A;  2NU1 I;  3PDN A;  2K7B A;  2DIP A;  2I94 A;  2KMQ A;  3LCP C;  3AAK A;  3DVM A;  1ALW A;  1QVI Y;  1SR6 C;  2I7A A;  1KWO C;  1YRU B;  1FBV A;  2KAY A;  2Y1N A;  2AAO A;  1OQP A;  2LMV A;  3D0Y B;  3DF0 A;  3I5H C;  3DVJ A;  4MZJ A;  2ISD A;  3SG3 A;  1KCY A;  3LL8 B;  3C1V A;  4MZK A;  5AEQ A;  3BUX B;  4ZCV A;  1J7P A;  3AAJ A;  4MRX A;  1N0Y A;  1TN4 A;  2FJU B;  2XRC A;  1JUO A;  5KTY A;  4GBA A;  3HH2 C;  3VDU A;  3AKB A;  1J1E A;  2K61 A;  1Q80 A;  3ZWH A;  1CFF A;  1F8H A;  1PVB A;  4CFQ A;  4I5N B;  4GAO A;  1DJI A;  4B6D A;  4BY4 A;  2SAS A;  2PVB A;  4I5J A;  2L7X A;  4NQG A;  2LCP A;  1E8A A;  2K7O A;  3PM8 A;  5B8I B;  2OPO A;  4D1E A;  2V53 A;  2M8U A;  1UWO A;  4ETO A;  1Y6W A;  1J7R A;  2KYF A;  1YR5 A;  4XYN A;  3MSE B;  2M5X A;  1QXP A;  2DOQ A;  2JOJ A;  3OXF A;  3CXL A;  2FOT A;  3HX4 A;  2F2P A;  4YI8 A;  4GUK A;  2LLT A;  3I5F C;  2KCX A;  1TNP A;  4OVO A;  2LUX A;  3CWG A;  3KY9 A;  4OR9 B;  2J87 A;  5JJG A;  1SRA A;  1YX8 A;  5CSI A;  1KBE A;  2WCY A;  1BMO A;  2ZKM X;  1TNX A;  4UXJ A;  2LUC A;  3EK4 A;  1XBT A;  3UEY A;  3BUM B;  2P6B B;  1B47 A;  1N65 A;  2F3Z A;  1CM4 A;  1AK8 A;  1DF0 B;  2KFH A;  1B7T Y;  2HET A;  3NSL A;  3M0W A;  2BCA A;  2EHB A;  1SKT A;  1F71 A;  2Y1M A;  1FF1 A;  3PFV A;  5JOL A;  1F70 A;  2BBN A;  1PRW A;  2EC6 B;  1JFJ A;  1SGP I;  3SJS A;  2BKI B;  1AP4 A;  2NCP A;  1MHO A;  2JT0 A;  2WCB A;  5DKR A;  5FUX A;  1JF0 A;  5HKZ A;  3EK7 A;  1NWD A;  5IBW A;  2TN4 A;  3VE5 A;  2LHI A;  2JT8 A;  2M7N A;  1QJT A;  1CDM A;  2ELI A;  1QIV A;  2SCP A;  2F8P A;  3GOX A;  4MZL A;  5CSN A;  1CFC A;  1TRF A;  4GGF C;  2LVK A;  3UEJ A;  1CGJ I;  4A4C A;  5I2Q A;  1ZMZ A;  4CLN A;  2BL0 B;  5BPJ A;  2V1C C;  1CLB A;  1TUS A;  2NU4 I;  4GGF A;  4UXH A;  3CTN A;  1IG5 A;  1GGZ A;  1FI5 A;  2N17 A;  1RTP 1;  2ZRS A;  4PDZ A;  2V1C A;  1CLL A;  1Y8F A;  4BY5 A;  2MRD A;  5FUV A;  1GQM A;  1UHJ A;  4MSP A;  4YGD B;  2NU3 I;  4DIR A;  2G9B A;  3QRX A;  2K7D A;  2R2I A;  3OVO A;  1AHR A;  1YTZ C;  2K2A A;  2ZFD A;  3EK8 A;  1SGQ I;  1OYV I;  1SBJ A;  2O5G A;  1ZOT B;  1B8L A;  4C0J A;  1CDN A;  1K90 D;  2PAS A;  1BLQ A;  1CSO I;  1S6I A;  1XFU O;  1B4C A;  3OXG A;  1MWN A;  1CFP A;  1IQ3 A;  5HI7 A;  3O4Y A;  2CNP A;  2M1K B;  1BR4 B;  1DVI A;  1LVC D;  1A4P A;  1WRK A;  1OE9 B;  3PAT A;  3VRN A;  5I2O A;  1SGN I;  1U5K A;  1LR7 A;  1NCY A;  2SGF I;  2NCO A;  4HRE E;  1KFX S;  2ENN A;  3WHT B;  1NSH A;  1CT0 I;  1NX2 A;  3TUY B;  2Y5I A;  1W7I B;  4C0L A;  1A29 A;  3D0Y A;  1WRZ A;  1H8B A;  2CTN A;  1SNL A;  3TS5 B;  1SMG A;  1IY6 A;  2H61 A;  5TNC A;  5EX0 A;  1JF2 A;  5K89 A;  1WY9 A;  4P2Y B;  1C7W A;  1NX3 A;  1SGY I;  2OS8 C;  1YU6 C;  3E2I A;  1EH2 A;  1K9U A;  5D7F A;  2WVJ A;  3E59 A;  3VRO A;  1DJH A;  3VRP A;  1AVS A;  1PVA A;  3KPX A;  3VGO A;  1FI6 A;  5PAL A;  3SG7 A;  1B8C A;  3TDI A;  4MLW A;  1W4R A;  2CCM A;  3ZNI A;  2H2K A;  1TCF A;  2JNX A;  3CZT X;  2BCB A;  1KQV A;  5CCM A;  1V1G A;  2KGB C;  1RFH A;  4CFR A;  1IQ5 A;  2KSP A;  2LHL A;  3OL0 A;  3FS7 A;  3LK0 A;  1BUS A;  3HCM A;  1J1D A;  1G33 A;  2LV7 A;  2SGE I;  4MN0 A;  2JXD A;  1X02 A;  4HRG A;  1U5I B;  2F3Y A;  1HDL A;  2K8M B;  2MJW B;  2KMO A;  1K96 A;  1KSO A;  1CMG A;  3O78 A;  2LEO A;  2LLS A;  1M8C A;  1SK6 D;  1IY5 A;  1WDC B;  2FCD A;  3SGQ I;  1QS7 A;  1M8B A;  1BU3 A;  1DS3 I;  1XX6 A;  1S5G Z;  3DVE A;  2JW6 A;  2I2R E;  1UHN A;  2KAV A;  1FAQ A;  2L8E A;  3WHU B;  2L98 A;  1NX0 A;  2MA2 A;  1OMR A;  2KBI A;  3MEK A;  5HLV A;  1L2O B;  2L2E A;  2CBL A;  1YUU A;  2MAZ A;  1EJ3 A;  3JTD B;  4YGE B;  2M7L A;  1F4Q A;  1BOD A;  1YUS A;  1B1G A;  1M63 B;  3SEK C;  2IS9 A;  2K2F A;  2OTG C;  2M49 B;  1Z7K B;  2KFF A;  3KO0 A;  1DF0 A;  2GGZ A;  1UHH A;  1TBO A;  2ROW A;  1C07 A;  1CE3 A;  3I5G C;  1KK8 B;  2GGM A;  1BT6 A;  4NDB A;  1LXF C;  1SY9 A;  3FIA A;  3O2P A;  1QIW A;  1PTR A;  5DKQ A;  1G4Y R;  2KI6 C;  4PE7 A;  1TBN A;  2B1U A;  1JWD A;  1DGU A;  2QQD A;  4I5K A;  1AJ5 A;  1KQM B;  3NXA A;  4FTG A;  4WRI A;  1DGV A;  3ICB A;  1CLM A;  1OSA A;  1PSR A;  2KBM A;  2LMT A;  2ZN8 A;  4YGA A;  2J9R A;  3SGB I;  1SYM A;  1X74 A;  2JZM A;  1CDL A;  1KK7 Z;  3RU0 A;  1MUX A;  5HKY A;  2ARP F;  3PLF B;  1OMD A;  2KAX A;  2JZI A;  4E68 A;  3PAL A;  1SR6 B;  1OMU A;  1KWO B;  1CTR A;  1NYA A;  3DVK A;  1KFX L;  2LVJ A;  2OVO A;  4E1P A;  4DS7 A;  1MQ1 A;  2ORW A;  2K9H A;  2LAP A;  5KSZ A;  4ORA B;  1BF5 A;  1HPT A;  1QX7 A;  4GI3 C;  3JVT B;  3TDZ A;  1SL8 A;  4M2O A;  1IH0 A;  1SGR I;  1YTP A;  2LVV A;  1DJW A;  3GK4 X;  4JQ0 D;  2GVI A;  2JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...