2V53A

Crystal structure of a sparc-collagen complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
214
Chain Sequence
b'PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPARC
publication title Structural Basis of Sequence-Specific Collagen Recognition by Sparc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2v53A02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v53A01
2LUXA 5HYDA 3DF0B 5I8NA 1A75B 1TURA 1YRTB 5AEQA 1QIWA 1C7WA 5TNCA 2K2AA 1N2DA 2PALA 4GUKA 4JWQA 2SASA 4D1EA 3BXKA 1QX5B 2JRFA 4GBAA 4JQ0D 1UVGA 2M29A 4I5NB 2HQ8A 2KFFA 4MZLA 3EK7A 4QJ5B 4CFRA 4E68A 1K96A 1SYMA 2TN4A 2JU0A 5HLVA 1R6PA 2SGFI 1MQ1A 1QASA 1XO5A 3AKBA 3I5IC 3B4VC 4AQIA 2JT0A 1PVBA 1SL8A 2O60A 1BLQA 2NU3I 2EC6C 1SK6D 2KHNA 2Y4QA 4OCIA 4AOMA 2LLTA 4PE0A 2GKVA 2L98A 2KI6C 2JXLA 1GGZA 1SMGA 2OS8B 1B47A 4GGNA 4M2PA 1NYAA 1CDNA 1ZFSA 2M49B 4N1FA 1J7OA 1XK4C 3WHUB 3HH2C 1Q80A 1HDLA 1GJYA 1UHKA 1Y1AA 3AAKA 3BUMB 1PSRA 4ETOA 1B8LA 2P6BB 1J7QA 2K0JA 1ALWA 2KYFA 3D0YA 4I5JA 5AANA 1JF2A 3NSIA 1EG4A 4MVFA 1DJHA 3LCPC 1KMAA 5D7FA 2LEOA 1OMUA 1Y1CA 1OMTA 2WORA 4PE1A 4XJKA 1LA3A 2F8PA 1KCYA 1BR1B 1H4BA 3ZWHA 2N52A 1W7JB 1NCZA 2GV5A 1XA5A 2LLUA 3I5FB 4N5XA 2F3ZA 1X02A 2LVKA 1FI5A 2KMRA 1S6IA 2JNFA 3BUNB 3OVOA 2M1UA 4YI9A 2PMYA 2H61A 3I5FC 1SCMB 3ICBA 5CSIA 1M31A 4HSZA 1PRWA 1CGJI 1CFPA 1J1DA 2K7CA 1QS7A 1H8BA 3TJQA 1TOPA 4YI8A 1WY9A 2M0RA 1KFUS 3PLFB 2BBMA 3EVUA 1YX8A 2MHHA 3GK4X 1M39A 1SKTA 1AVSA 1LR7A 2CBLA 2DOQA 2KOTA 2M97A 5CSJA 1F55A 1YR5A 1FPWA 1CT2I 2NU1I 2Y5IA 3FWBA 1WLZA 3EK8A 2LMTA 3TDIA 3AAJA 3TUYC 3TS5C 1MHOA 1CDMA 1UHJA 2Y1NA 2LHIA 2NU4I 2I18A 1A4PA 4WRIA 2ERWA 1KQVA 3LK0A 5DKQA 3CLNA 1KK7Z 5ER5A 2JXDA 2ZKMX 3DVKA 1LVCD 2FOTA 1CNPA 1CT0I 3IF7A 5GQQC 2OTGB 2BKIB 2IS9A 4M2OA 2KYCA 2KFHA 3KO0A 3PN7C 2LP2A 1JFJA 1A2XA 2KGBC 3EKHA 2L0PA 1HQVA 5KU1A 1SGDI 3I5HC 1CM1A 2LHLA 3QTLD 5CPVA 2L51A 5PALA 1KFXL 2BE6A 4UPGA 1TUSA 1MXLC 2OPOA 1IY5A 2QQDA 1QATA 1YTZC 1SR6C 2LM5A 3IQOA 1MWNA 1FF1A 1CTRA 2FCDA 1QV0A 5CSNA 1QJTA 4ORBB 3BUXB 2CXJA 1KWOB 1CFCA 1SBJA 1BT6A 4HREE 1F8HA 2NLNA 2BL0B 1XYDA 3H4SE 5FYXA 2KDHA 1Y0VH 2JYYA 1KWOC 1SCVA 1OVOA 1A03A 5B8IB 1PK0D 5HKZA 1KK8B 1WRZA 3NSKA 1ZACA 4OV2A 1YVLA 3SG3A 5DKNA 1CSOI 2CNPA 1V1FA 2CTNA 2QPTA 2MLFC 2LMVA 3FWCA 4M2QA 1KQMB 3LK1A 4YGAA 1F70A 1SL9A 2SGQI 4CFQA 1OOJA 1K9KA 1IKUA 3VRNA 1K8UA 4QJ3B 1KQMC 4YBHB 2JTTA 4BY5A 5DKRA 1DF0B 2B1UA 4AQJA 3KHEA 3GOFA 1BUSA 1J55A 1CMFA 2WNDA 1YRUB 2SGPI 1R0RI 1JFKA 2KAXA 4OVNF 3MSEB 2PASA 3WHTB 2I2RE 4Q04A 2JT3A 4BY4A 1WDCB 4L9MA 2ZRTA 2M5XA 1Y1XA 1GQMA 2Y1MA 2BUSA 3AKAA 4PHKA 1YX7A 2BCBA 1IRJA 1SY9A 1K94A 1E8AA 1QLSA 1TCOB 4NDDA 1CLBA 1DTLA 1RROA 1L7ZA 1PSBA 1OZOA 3OHMB 4CPVA 1BU3A 4PALA 4FQOA 3CR2A 1LR8A 5G08A 3TDZA 1AJ5A 1CT4I 2LC5A 3F45A 3VRRA 2D8NA 4MLWA 1MF8B 3WNXB 3CGAA 1C07A 2KGRA 3GK2A 5F6TA 1CB1A 5AFPA 1SW8A 4OKHA 1WLMA 1N0YA 4P2YB 2M1KB 1B7TY 2E30A 2KI4B 3CTNA 2PSRA 1SL7A 2NCPA 2OS8C 2KMQA 3EK4A 1M45A 2A4JA 1YUSA 1EJ3A 1GGWA 2KI4C 1OSAA 1S36A 2HETA 2LVJA 2LV7A 1MXEA 1SGRI 5HLOA 4HRHA 1FW4A 1KSMA 4MEWA 4OR9B 1K90D 3EVRA 1F54A 1TBQR 2KFGA 1K93D 3SGQI 2N71A 1YU6C 1Y6WA 1Y1UA 3D0YB 2GGMA 1MR8A 2CT9A 1IWQA 1KFXS 1SPYA 1IJ6A 1EL4A 2RGIA 4DRWA 2ZN8A 1M8BA 4HRGA 3O2PA 4MZJA 4PCWA 3SJSA 4XJKB 1TTXA 3I5GB 1ALVA 2F2OA 1XVJA 4YGEB 3FIAA 2OVOA 1NCYA 1OQPA 1XFUO 4XYNA 1OE9B 4F0ZB 1NIWA 1PALA 2MAZA 3I5GC 4ICBA 1SCMC 2F33A 3QRXA 5DAEA 2KMPA 1Y1BA 1W7IB 3ZNIA 1XFXO 3RLZA 1D1OA 1AUIB 1UHHA 2KBIA 2ZNEA 2JXCA 2MA2A 3KEVA 4ZCVA 1JUOA 3EVVA 3FS7A 1JBAA 5KTYA 3RM1A 1QX7A 1QTXA 5JJGA 1OZSA 1JF0A 1NPQA 1BOCA 1UP5A 4GPLB 1SRAA 1UUSA 2JPTA 4C0JA 1G8IA 2MJWB 1OYVI 2KMOA 2AMIA 4YRUA 1L2OB 3VRPA 2JTZA 1NSHA 2L5XB 4I5KA 2M3WA 1QX2A 1IQ3A 2F3CI 4WQ3A 5IBWA 3DVMA 3PATA 2Q4UA 2QQCA 2BE4A 3SG5A 2OTGC 4USLA 4C0LA 2GGZA 2JOJA 2BCXA 1TIHA 4DCKA 3SG4A 1CE3A 2L4HA 1QIVA 5J3XA 1YUTA 1TBRR 1UVFA 2BBNA 3CS1A 3SEKC 1NUBA 2LP3A 5ER4X 2KQYA 2K7OA 2BKHB 2K8MB 1DS2I 2MRDA 4PHJA 1KK7Y 1M46A 2K7BA 4PHMA 5CSFA 4YGBB 1IW4A 3D10A 4QJ4B 1IH0A 3SG7A 1PJUA 2BL0C 4I5LB 2I7AA 1EXRA 4NDCA 1FYBA 2JULA 1QVIZ 1TNPA 1SGYI 4CIDA 1RWYA 3BOWA 1TIZA 1RTP1 4MBEA 1YVHA 1U5IA 1KK8C 1S5GZ 2JNXA 2K2FA 1K2HA 2K7DA 3LL8B 1H0ZA 2ZNDA 4GNKB 5JHWC 1OMVA 1TNWA 1QLKA 2BCAA 3O78A 3LLEA 2G2BA 1PCEA 1PPFI 3BYAA 1UHIA 2ISDA 4MRYA 1NWDA 3PSRA 1BJFA 2JT8A 1S3PA 2FCEA 1B1GA 3CWGA 2QACA 2F3YA 3VGOA 2JWWA 1NX1A 4GGFC 4R1EA 2G9BA 3SIAA 1TGSI 1TCFA 1SGPI 2PRUA 1AHRA 2P6AC 3M0WA 2L2EA 1WDCC 1BG1A 2M8UA 1JC2A 2LE9B 2SCPA 2I94A 1G33A 1DJXA 1S26D 2Q91A 3DF0A 1A75A 1LINA 2BECA 2JZIA 3A8RA 4ZCUA 3NSLA 4MSPA 2JC2A 1MT1A 2WCYA 4FTGA 2LCPA 1B7TZ 4DUQA 1ZUZA 4PE7A 4GAOA 1AK8A 4GI3C 5JOLA 3OB1B 1TNQA 3C1VA 1CFDA 2ZN9A 3O4YA 1EH2A 1UURA 4C0KA 1DJGA 1F71A 1IGVA 3I5IB 1DVIA 1TNXA 4A4CA 3CR5X 1TN4A 3OX5A 4MZKA 2GKRI 2EGDA 2KBMA 1OMRA 2KNEA 2EC6B 2ZRSA 1XK4A 1PULA 1OMDA 2HPSA 3VRQA 3VROA 1LR9A 2WOSA 1BMOA 3KPXA 5D69A 1N13A 2KAYA 1CHOI 1XFWO 3DVJA 3SG6A 1CGII 1DJIA 1ZMZA 1DJYA 1ODBA 3OX6A 3OP0A 5I2LA 1G4YR 2LAPA 2WC8A 1FI6A 2EHBA 5I2QA 1PVAA 3BQ3A 2LNKA 1SGEI 1K95A 1BR4B 4NQGA 1DT7B 1ZOTB 1NP8A 5HKWA 1C7VA 1F4OA 3DVEA 4OVOA 1NCXA 1IY6A 1DGUA 3HCMA 1CDLA 3CR4X 2N17A 2H61C 2LUCA 1RK9A 1BF5A 1R2UA 4PHNA 1RFJA 1K9PA 1DMOA 2O5GA 4CLNA 1V1GA 1J7PA 3SG2A 1RJVA 3O6BA 1HPTA 1AP4A 2HQWA 1S1EA 3HX4A 1XFVO 1RECA 4YGDB 3TDUA 1CKKA 1AN1I 1B8RA 3SGBI 1BODA 2COLB 2LANA 1JWDA 1Z7KB 2AUCA 4MRXA 2WCFA 1SNLA 1YTPA 2M7NA 4DS7A 1B8CA 1S6JA 3PFVA 2JZMA 1L2OC 1DGVA 1NX2A 1HT9A 1CMGA 2FJUB 1LKJA 2CCMA 1LXFC 4U8DA 1XFYO 2KCXA 1TRFA 3TUYB 1S6CA 5BPJA 3TS5B 4WQ2A 2L50A 2MLEC 1HJAI 4ORCB 2E6WA 1B9AA 2PVBA 2HF5A 3OB2B 4SGBI 1DJZA 3JTDB 2H2KA 1CLMA 1N65A 3DD4A 1VRKA 1CLLA 2M9GA 1A29A 2WCBA 1J1EA 1J7RA 1EG3A 2KSPA 2KAVA 4PDZA 1F4QA 3JTDC 1IG5A 2LMUA 2LVVA 4NDBA 1YURA 5AERA 3PN7B 1IJ5A 3JVTB 5K89A 2JQ6A 1SGQI 2SGDI 3BUOB 1CFFA 3I5HB 1WRLA 2V53A 4P5OE 2NXQA 1QXPA 4IL1A 2L4IA 2NCOA 4N1GA 2ZFDA 3JVTC 4YGCB 1YUUA 3A4UB 5KSZA 2NZ0A 1B4CA 1SR6B 1XFZO 3SIBA 1UUCA 3IQQA 3BUWB 1WRKA 1LA0A 2ARPF 1DS3I 1UHNA 1DJWA 3BOWB 3NXAA 2KQ6A 3PALA 1U5IB 4TNCA 5HKYA 2GKTI 2B0UC 1IQ5A 2K61A 3PM8A 4A4BA 1QV1A 2NU2I 5AXIA 2AAOA 4ORAB 3CZTX 2LLSA 1KFUL 1AJ4A 1NX3A 2F2PA 2KI6D 3K21A 4PE4A 4DIRA 2NU0I 1NX0A 2LVIA 2R2IA 1DF0A 1MUXA 2VRGA 2M7LA 1CM4A 1QVIY 4GGFA 1CDPA 4GFTA 3KF9A 1FBVA 1KSOA 1S5GY 2SGEI 3NSOA 4JPZB 2WCEA 3TZ1A 3E3RA 1K9UA 4MN0A 3GK1A 2XRCA 1JSAA 3WXAA 1M63B 5I2OA 1M8CA 1SGNI 4HGUA 2MBXA 3EKJA 1UWOA
chains in the Genus database with same CATH superfamily
5I8NA 1TUJA 3TOBA 2PALA 3OXGA 4GUKA 2ERBA 1K96A 1SYMA 2TN4A 2SGFI 1MQ1A 3I5IC 1SK6D 2KHNA 2Y4QA 4AOMA 4PE0A 1GGZA 1SMGA 3R5AA 1NYAA 1GJYA 3AAKA 1PSRA 4ETOA 1B8LA 1J7QA 2K0JA 2KYFA 1JF2A 3NHTA 2QDIA 3B86A 4PE1A 4XJKA 1K7TA 1KCYA 2RIJA 1W7JB 1NCZA 1XA5A 2LLUA 2LVKA 2KMRA 2JNFA 2M1UA 2PMYA 3I5FC 3ICBA 5CSIA 2PYQA 5I94A 1TOPA 1YX8A 3DXLA 2CBLA 1CT2I 2Y5IA 3EK8A 7WGAA 3TUYC 3TS5C 1Y8FA 1V1HA 3UOEA 2H8VA 1CNPA 1TBNA 2IS9A 4M2OA 2KFHA 3EKHA 5HL1A 2BE6A 2OPOA 1QATA 3IQOA 3EG5B 1FF1A 2FCDA 1QV0A 5CSNA 3BUXB 1KWOB 1SBJA 1BT6A 2NLNA 1Y0VH 5B8IB 4OV2A 1YVLA 4AMLA 2CNPA 2QPTA 3FWCA 4YGAA 2SGQI 1OOJA 1K8UA 2JTTA 2B1UA 3KHEA 1LS8A 2SGPI 3D74A 3MSEB 2I2RE 1GM0A 2BCBA 1TCOB 5FI2A 3SS5A 3OHMB 1LR8A 3Q8IA 2QQEA 3VRRA 3WNXB 3GK2A 1SW8A 4OKHA 4P2YB 3CTNA 5EX0A 3D73A 2GIVA 2NCPA 3EK4A 1M45A 2DKVA 2KI4C 1MXEA 4MEWA 1K90D 1YU6C 3D0YB 2QEVA 2ZN8A 1M8BA 2F2OA 1XVJA 3FIAA 1NCYA 4XYNA 1OE9B 3I5GC 1PALA 2MAZA 4ICBA 2F33A 3RLZA 1AUIB 3EVVA 1BOCA 4INXA 1RFHA 1DEKA 3S0BA 1L2OB 4INWA 2F3CI 2QQCA 2Q4UA 9WGAA 2Y0MA 4USLA 2BCXA 3BFBA 3UGLA 3SG4A 2K60A 1QIVA 1TBRR 3CS1A 2K7OA 2K7BA 1IW4A 3SG7A 2JULA 3VE5A 4MBEA 1S5GZ 2YQPA 3D76A 4GNKB 1OMVA 2G2BA 1UHIA 3PSRA 3FE8A 2JT8A 2X3TA 1B1GA 2JWWA 4GGFC 2K9HA 3SIAA 3TO9A 3TOAA 2P6AC 3SS4A 1JC2A 1DJXA 3DF0A 2BECA 2JZIA 3NSLA 4MSPA 1MT1A 4DUQA 3S0GA 1CFDA 3O4YA 1EH2A 1TUZA 4JD9A 4JCVE 3OX5A 1OMRA 2KNEA 1OMDA 2HPSA 3VRQA 3VROA 3KPXA 1N13A 2WC5A 1CHOI 3SG6A 3D00A 1ZMZA 3OX6A 2LAPA 1PVAA 2ORWA 2J9RA 2LNKA 1K95A 1BR4B 3DVEA 1DGUA 1WKXA 1CDLA 2ORVA 2H61C 1BF5A 1NXUA 3SG2A 3O6BA 1HPTA 1WTJA 1AP4A 3HX4A 1XFVO 3TDUA 1B8RA 1Z7KB 2M7NA 2JZMA 1L2OC 1DGVA 2FJUB 1LKJA 1LXFC 4WQ2A 3UFFA 3OB2B 4SGBI 1N65A 2M9GA 1A29A 2WCBA 1J7RA 1EG3A 2KAVA 1IG5A 2LMUA 5AERA 2A20A 2WCJA 1IJ5A 3I5HB 1QXPA 5CCLA 1XFZO 3B6XA 2B8TA 3UNWA 2K61A 4A4BA 1QV1A 2NU2I 5AXIA 2BNXA 1KFUL 2F2PA 3K21A 4DIRA 1NX0A 1QVIY 4GFTA 3KF9A 3RU0A 2SGEI 1Z2CB 3GK1A 2XRCA 3VDUA 1A75B 1N2DA 4JQ0D 4I5NB 4QJ5B 4CFRA 4E68A 5HLVA 1XO5A 4AQIA 2JT0A 2GKVA 2L98A 4KYNA 2JXLA 4GGNA 1B47A 1ZFSA 2M49B 1J7OA 3WHUB 4PT1A 1Q80A 1UHKA 3BUMB 5AANA 3NSIA 1EG4A 4MVFA 1LA3A 1BR1B 1H4BA 3I5FB 2F3ZA 1X02A 3BUNB 4YI9A 3D78A 1QS7A 2CWGA 4YI8A 2M0RA 1KFUS 3PLFB 2BBMA 3EVUA 2MHHA 1M39A 1AVSA 5CSJA 3TDIA 3AAJA 2QEBA 3S0DA 1UHJA 2ERWA 5DKQA 3CLNA 2CJSC 2ZKMX 2FOTA 5GQQC 2BKIB 1Z2IA 3KO0A 1JFJA 1A2XA 5KU1A 3I5HC 2LHLA 2UVOA 1FY7A 5PALA 1MXLC 2QQDA 2L7XA 1CTRA 3OBVA 2L2CA 2BL0B 3H4SE 2KDHA 1TWOA 2GVIA 1WRZA 1ORGA 1CSOI 5DKNA 3E59A 2V1CC 2CTNA 3OL0A 2MLFC 4M2QA 5D3OA 1F70A 1SL9A 1K9KA 4QJ3B 1KQMC 5DKRA 2KAXA 4OVNF 2PASA 3WHTB 3VDPA 3QMEA 1WDCB 1Y1XA 2ODDA 3E2IA 1DQEA 2BUSA 3AKAA 4NDDA 3BJHA 4FQOA 3TO6A 1CT4I 2LC5A 3F45A 1MF8B 1WLMA 2M1KB 2KI4B 1SL7A 1S36A 2HETA 4HRHA 2N71A 1Y6WA 1MR8A 2CT9A 3V2LA 2RGIA 4DRWA 4HRGA 4PCWA 3SJSA 1TTXA 3I5GB 1NIWA 1FARA 1W7IB 1D1OA 1UHHA 4ZCVA 2JXCA 2MA2A 1JBAA 1JF0A 1UP5A 1SRAA 1UUSA 2MJWB 1OYVI 3VRPA 1NSHA 4I5KA 1V1IA 2ELIA 2FNFX 1XFRA 1QX2A 1IQ3A 4WQ3A 5IBWA 2BE4A 3FSYA 3SG5A 2GGZA 4E1RA 2L4HA 3D77A 1YUTA 1UVFA 2BKHB 2K8MB 4FKDA 5CSFA 1OW4A 4YGBB 3D10A 1PJUA 2BL0C 4I5LB 2I7AA 1FYBA 1QVIZ 1TNPA 3DYEA 4CIDA 3BOWA 1YVHA 1U5IA 3B7AA 1H0ZA 1TNWA 2BCAA 4MRYA 1BJFA 2KLEA 2FCEA 2F3YA 1TGSI 1VDDA 1TCFA 1W4RA 2PRUA 3M0WA 1WDCC 5FUXA 1BG1A 2M8UA 2LE9B 1G33A 1S26D 3S0EA 3A8RA 4ZCUA 2JC2A 4PE7A 1XBTA 1KBFA 5JOLA 3OB1B 4MPIA 2ZN9A 3QAHA 1F71A 1DJGA 4OZDA 1C3YA 2CWFA 3CR5X 1XK4A 2QPOA 2LUYA 1LR9A 3K1EA 5D69A 1QWVA 2P71A 3OP0A 1FI6A 5I2QA 3BQ3A 4NQGA 1ZOTB 2KLDA 5HKWA 3KY9A 2O5GA 1RJVA 4IJ7A 3SGBI 1S1EA 4YGDB 2CWHA 3S0FA 2LANA 4MRXA 1U5KA 3GOXA 3R72A 1B8CA 3PFVA 1NX2A 1CMGA 1HT9A 2CCMA 2WCLA 5BPJA 4ORCB 2H2KA 1VRKA 1J1EA 1YURA 3UGDA 5K89A 2OU2A 1XX6A 3BUOB 2V53A 4IL1A 2L4IA 1YUUA 3FE9A 3RZSA 1B4CA 1SR6B 3CZ1A 3SIBA 1LA0A 1UHNA 1OOHA 3PALA 1MJBA 5HKYA 2B0UC 2AAOA 4ORAB 1DC1A 3CZTX 1AJ4A 2KI6D 3DZTA 4PE4A 1TBOA 2M7LA 4GGFA 4JPZB 3E3RA 3WXAA 5I2OA 1M8CA 1SGNI 1P9ZA 2LUXA 5HYDA 1TURA 1YRTB 1C7WA 2FJYA 2K2AA 3FSXA 3BXKA 2JRFA 4GBAA 2HQ8A 2KFFA 4MZLA 2WC6A 1SL8A 1BLQA 2LLTA 2KI6C 2OS8B 4M2PA 1CDNA 4N1FA 1HDLA 3HH2C 1Y1AA 2P6BB 3R5CA 1WGTA 3D0YA 4I5JA 1DJHA 1KMAA 5D7FA 2LEOA 1OMUA 1Y1CA 2WORA 2F8PA 3ZWHA 2N52A 2GV5A 4N5XA 1S6IA 1PTQA 2H61A 1PRWA 1CGJI 2LB7A 1CFPA 1H8BA 1X4SA 3TJQA 2OD1A 1W9ZA 3B87A 2E5RA 1LR7A 3QWPA 2YGUA 2KOTA 2M97A 1YR5A 2WCHA 1FPWA 1MHOA 1CDMA 3UGIA 2I18A 4WRIA 3NGVA 3LK0A 5FI6A 2JXDA 3DVKA 1LVCD 1CT0I 3IF7A 3R5BA 1HQVA 2YUUA 2DIPA 5CPVA 4UPGA 1TUSA 1YTZC 2LM5A 1SR6C 4WP4A 1MWNA 4UXHA 1QJTA 2CXJA 3B88A 1CFCA 1MJAA 2X52A 1XYDA 5FYXA 2JYYA 1OVOA 1A03A 1PK0D 1ZACA 1KBEA 1SSEB 1V1FA 2GTEA 1KQMB 3CDNA 1P28A 3VRNA 4BY5A 1DF0B 3GOFA 1BUSA 1J55A 1CMFA 1R0RI 1JFKA 4Q04A 2ZRTA 3S0AA 4PHKA 1SY9A 1IRJA 1K7VA 1L7ZA 1OZOA 4CPVA 1BU3A 2JPOA 3CR2A 3R1PA 2ROWA 2D8NA 4MLWA 3CGAA 3IVTA 5F6TA 3PJIA 5AFPA 1CB1A 1N0YA 3UEYA 2E30A 2E73A 5HI7A 2OS8C 2A4JA 1GGWA 1EJ3A 1OSAA 2LVJA 2LV7A 1SGRI 1TBQR 3EVRA 1F54A 2KFGA 3SGQI 1Y1UA 5E3PA 1EL4A 2WCMA 3O2PA 4XJKB 1ALVA 1OQPA 1XFUO 3N7HA 4F0ZB 3QRXA 4UXJA 1PTRA 3ZNIA 3KEVA 4UXIA 1JUOA 5KTYA 1QTXA 5JJGA 2JPTA 2KPHA 2KMOA 2AMIA 2M3WA 3R5DA 2JOJA 1TIHA 2PQ8A 2BBNA 1FAQA 3SEKC 2LP3A 2KQYA 5FI7A 4PHJA 1KK7Y 4PHMA 4QJ4B 4NDCA 1EXRA 1SGYI 1RTP1 2K2FA 1IIOA 2K7DA 3LL8B 5JHWC 1PPFI 3BYAA 3OGNA 1NWDA 1XA6A 1S3PA 3L47A 1SGPI 1OOFA 2VRWB 3R1VA 1AHRA 2I94A 2Q91A 1A75A 1LINA 1P9GA 2WCYA 4FTGA 2LCPA 1B7TZ 4GAOA 3C1VA 1DVIA 4A4CA 2L5YA 2RC4A 2GKRI 2EGDA 2EC6B 2ZRSA 1TOTA 1PULA 2WOSA 1BMOA 2KAYA 5EX3A 1XFWO 1CGII 1DJYA 3L4AA 1ULMA 1G4YR 2WC8A 2EHBA 1C3ZA 1C7VA 1NCXA 1IY6A 3HCMA 3CR4X 2LUCA 1RK9A 1DMOA 1J7PA 1CKKA 1BODA 1JWDA 5FUVA 1UHAA 4DS7A 1S6JA 1XFYO 1TRFA 1HJAI 2OZUA 1B9AA 2PVBA 1DJZA 3DD4A 2KSPA 1DELA 3JTDC 3PN7B 2SGDI 2JQ6A 1WRLA 4P5OE 2NXQA 4YGCB 3JVTC 3A4UB 1ULNA 2NZ0A 1Z4HA 1UUCA 2WCKA 3IQQA 3BUWB 2W0TA 2ARPF 1DS3I 1DJWA 3NXAA 4TNCA 2GKTI 1IQ5A 3UEJA 2LLSA 2WVJA 4FQTA 5FUYA 2NU0I 2R2IA 2VRGA 1S20A 1FBVA 3NSOA 4MN0A 1M63B 4HGUA 2ZNEA 1UWOA 3DF0B 5AEQA 1QIWA 3SS3A 5TNCA 4JWQA 2SASA 4D1EA 1QX5B 1UVGA 2M29A 3BFAA 4F7FA 3EK7A 4E1PA 2JU0A 3D75A 1R6PA 1QASA 3AKBA 3B4VC 1PVBA 2O60A 2NU3I 2EC6C 4OCIA 2ENZA 1XK4C 1ALWA 3LCPC 1OMTA 1T14A 1FI5A 3OVOA 3MEKA 1SCMB 1M31A 4HSZA 1J1DA 2K7CA 1WY9A 2QEHA 3GK4X 1SKTA 2DOQA 2J87A 1F55A 2NU1I 3FWBA 1WLZA 2LMTA 4B6DA 5EL2A 2Y1NA 2NU4I 2LHIA 1A4PA 1KQVA 1KK7Z 2UZ3A 5ER5A 5J8CA 2OTGB 2KYCA 3CABA 3PN7C 2QQ0A 2LP2A 2KGBC 2L0PA 1SGDI 1CM1A 3QTLD 2L51A 1KFXL 1IY5A 4ORBB 4JKTA 1Q9BA 1F8HA 4HREE 5DICA 1WGCA 1KWOC 1SCVA 5HKZA 1KK8B 3NSKA 3SG3A 2N1AB 2LMVA 3LK1A 4CFQA 1IKUA 1R79A 4YBHB 4AQJA 3FC3A 2JA1A 3TO7A 2WNDA 3FE6A 1YRUB 2JT3A 4BY4A 4L9MA 2M5XA 3CYZA 1GQMA 2Y1MA 1YX7A 1K94A 1E8AA 1QLSA 1CLBA 1DTLA 1HEVA 5E3RA 1RROA 3CZ2A 3R1OA 1PSBA 4PALA 5G08A 3TDZA 1AJ5A 1C07A 2KGRA 1B7TY 2PSRA 2KMQA 1YUSA 5HLOA 1FW4A 1KSMA 4OR9B 1K93D 2GGMA 2ENNA 1IWQA 1KFXS 1SPYA 1IJ6A 2PQLA 5FUWA 4MZJA 4YGEB 2OVOA 5DAEA 1SCMC 2KMPA 1Y1BA 1XFXO 2KBIA 2WGCA 3FS7A 3RM1A 1QX7A 1OZSA 1NPQA 4GPLB 3DY9A 4C0JA 1G8IA 4YRUA 2JTZA 2L5XB 3DVMA 3PATA 3NHIA 2OTGC 4C0LA 2QEOA 4DCKA 1CE3A 5J3XA 1K7UA 3CXLA 1NUBA 5ER4X 1DS2I 2MRDA 2P70A 1M46A 1IH0A 1ULKA 1RWYA 1TIZA 2JNXA 1KK8C 1K2HA 2ZNDA 1QLKA 3O78A 3LLEA 1PCEA 4A24A 3PDNA 2ISDA 3CWGA 2QACA 2L8EA 3VGOA 1NX1A 4R1EA 2G9BA 5E3QA 3BFHA 2L2EA 1X74A 1W3SA 2SCPA 1ZUZA 1AK8A 4GI3C 1TNQA 3VB1A 1UURA 4C0KA 1IGVA 3I5IB 1TNXA 1TN4A 3PM2A 4MZKA 2KBMA 3DVJA 1DJIA 1ODBA 5I2LA 1SGEI 1DT7B 1NP8A 1F4OA 4OVOA 1OOIX 2N17A 1R2UA 4PHNA 1RFJA 1K9PA 4CLNA 1V1GA 4DNCA 2JW6A 2HQWA 1AN1I 5J8FA 1RECA 2COLB 2AUCA 2WCFA 1SNLA 1YTPA 2DB6A 4U8DA 2KCXA 3TUYB 1S6CA 3TS5B 2L50A 2MLEC 2E6WA 3OXFA 2HF5A 3JTDB 1CLMA 5HQ8A 3UO9A 1CLLA 3OXLA 1MJ9A 4PDZA 1F4QA 2LVVA 1OOGA 4NDBA 3JVTB 1SGQI 1CFFA 4N1GA 2NCOA 2ZFDA 5KSZA 1WRKA 2BAPA 3BOWB 2V1CA 2KQ6A 3O4XA 1U5IB 3PM8A 3BJIA 1NX3A 3L4LA 2LVIA 1DF0A 1MUXA 1CM4A 3CZ0A 1CDPA 1KSOA 1S5GY 2WCEA 3TZ1A 5CCMA 1K9UA 1JSAA 2MBXA 3EKJA
chains in the Genus database with same CATH topology
2LUXA 5HYDA 3DF0B 5I8NA 1A75B 1TURA 1YRTB 5AEQA 1QIWA 1C7WA 5TNCA 2K2AA 1N2DA 2PALA 4GUKA 4JWQA 2SASA 4D1EA 3OXGA 3BXKA 1QX5B 2JRFA 4GBAA 4JQ0D 1UVGA 2M29A 4I5NB 2HQ8A 2KFFA 4MZLA 3EK7A 4QJ5B 4CFRA 4E68A 1K96A 1SYMA 2TN4A 2JU0A 5HLVA 4E1PA 1R6PA 2SGFI 1MQ1A 1QASA 1XO5A 3AKBA 3I5IC 3B4VC 4AQIA 2JT0A 1PVBA 1SL8A 2O60A 1BLQA 2NU3I 2EC6C 1SK6D 2KHNA 2Y4QA 4OCIA 4AOMA 2LLTA 4PE0A 2GKVA 2L98A 2KI6C 2JXLA 2ENZA 1GGZA 1SMGA 2OS8B 1B47A 4GGNA 4M2PA 1NYAA 1CDNA 1ZFSA 2M49B 4N1FA 1J7OA 1XK4C 3WHUB 3HH2C 1Q80A 1HDLA 1GJYA 1UHKA 1Y1AA 3AAKA 3BUMB 1PSRA 4ETOA 1B8LA 2P6BB 1J7QA 2K0JA 1ALWA 2KYFA 3D0YA 4I5JA 5AANA 1JF2A 3NSIA 1EG4A 4MVFA 1DJHA 3LCPC 1KMAA 5D7FA 2LEOA 1OMUA 1Y1CA 1OMTA 2WORA 4PE1A 4XJKA 1LA3A 2F8PA 1KCYA 1BR1B 1H4BA 3ZWHA 2N52A 1W7JB 1NCZA 2GV5A 1XA5A 2LLUA 3I5FB 4N5XA 2F3ZA 1X02A 2LVKA 1FI5A 2KMRA 1S6IA 2JNFA 3BUNB 1PTQA 2M1UA 4YI9A 3OVOA 3MEKA 2PMYA 2H61A 3I5FC 1SCMB 3ICBA 5CSIA 1M31A 4HSZA 1PRWA 1CGJI 1CFPA 1J1DA 2K7CA 1QS7A 1H8BA 1X4SA 3TJQA 1TOPA 4YI8A 1WY9A 2M0RA 1KFUS 3PLFB 2BBMA 3EVUA 2OD1A 1YX8A 2MHHA 2E5RA 3GK4X 1M39A 1SKTA 1AVSA 1LR7A 3QWPA 2CBLA 2DOQA 2KOTA 2J87A 2M97A 5CSJA 1F55A 1YR5A 1FPWA 1CT2I 2NU1I 2Y5IA 3FWBA 1WLZA 3EK8A 2LMTA 3TDIA 3AAJA 3TUYC 4B6DA 3TS5C 1MHOA 1Y8FA 1CDMA 1UHJA 2Y1NA 2LHIA 2NU4I 2I18A 3UGIA 1A4PA 4WRIA 2ERWA 1KQVA 3LK0A 5DKQA 1V1HA 3CLNA 1KK7Z 2UZ3A 5ER5A 2CJSC 2JXDA 2ZKMX 3DVKA 1LVCD 2FOTA 1CNPA 1CT0I 3IF7A 5GQQC 2OTGB 1TBNA 2BKIB 2IS9A 4M2OA 2KYCA 2KFHA 3KO0A 3PN7C 2QQ0A 2LP2A 1JFJA 1A2XA 2KGBC 3EKHA 2L0PA 1HQVA 2YUUA 5KU1A 1SGDI 3I5HC 1CM1A 2LHLA 3QTLD 2DIPA 5CPVA 2L51A 5PALA 1KFXL 2BE6A 4UPGA 1TUSA 1MXLC 2OPOA 1IY5A 2QQDA 1QATA 1YTZC 1SR6C 2LM5A 3IQOA 1MWNA 1FF1A 2L7XA 1CTRA 2FCDA 1QV0A 4UXHA 5CSNA 1QJTA 4ORBB 3BUXB 2CXJA 1KWOB 1CFCA 1SBJA 1BT6A 4HREE 1F8HA 2NLNA 2BL0B 1XYDA 3H4SE 5FYXA 2KDHA 1Y0VH 2JYYA 1KWOC 1SCVA 1OVOA 1A03A 5B8IB 2GVIA 1PK0D 5HKZA 1KK8B 1WRZA 3NSKA 1ZACA 4OV2A 1YVLA 5DAEA 1KBEA 3SG3A 5DKNA 1CSOI 2N1AB 3E59A 2CNPA 2V1CC 1V1FA 2CTNA 3OL0A 2QPTA 2MLFC 2LMVA 3FWCA 4M2QA 1KQMB 3LK1A 4YGAA 1F70A 1SL9A 2SGQI 4CFQA 1OOJA 1K9KA 1IKUA 3VRNA 1K8UA 4QJ3B 1R79A 1KQMC 4YBHB 2JTTA 4BY5A 5DKRA 1DF0B 2B1UA 4AQJA 3KHEA 3FC3A 3GOFA 2JA1A 1BUSA 1J55A 1CMFA 2WNDA 1YRUB 2SGPI 1R0RI 1JFKA 2KAXA 4OVNF 3MSEB 2PASA 3WHTB 2I2RE 4Q04A 3VDPA 2JT3A 4BY4A 1WDCB 4L9MA 2ZRTA 2M5XA 1Y1XA 1GQMA 2ODDA 3E2IA 2Y1MA 2BUSA 3AKAA 4PHKA 1YX7A 2BCBA 1IRJA 1SY9A 1K94A 1E8AA 1QLSA 1TCOB 4NDDA 1CLBA 1DTLA 1RROA 1L7ZA 1PSBA 1OZOA 3OHMB 4CPVA 1BU3A 4PALA 4FQOA 3CR2A 1LR8A 5G08A 3TDZA 1AJ5A 2QQEA 1CT4I 2LC5A 3F45A 3VRRA 2ROWA 2D8NA 4MLWA 1MF8B 3WNXB 3CGAA 1C07A 2KGRA 3GK2A 5F6TA 1CB1A 5AFPA 1SW8A 4OKHA 1WLMA 1N0YA 3UEYA 4P2YB 2M1KB 1B7TY 2E30A 2KI4B 3CTNA 2E73A 2PSRA 1SL7A 5EX0A 5HI7A 2NCPA 2OS8C 2KMQA 3EK4A 1M45A 2A4JA 1YUSA 1EJ3A 1GGWA 2KI4C 1OSAA 1S36A 2HETA 2LVJA 2LV7A 1MXEA 1SGRI 5HLOA 4HRHA 1FW4A 1KSMA 4MEWA 4OR9B 1K90D 3EVRA 1F54A 1TBQR 2KFGA 1K93D 3SGQI 2N71A 1YU6C 1Y6WA 1Y1UA 3D0YB 2GGMA 1MR8A 2CT9A 2ENNA 1IWQA 1KFXS 1SPYA 1IJ6A 1EL4A 2RGIA 4DRWA 2ZN8A 1M8BA 4HRGA 3O2PA 5FUWA 4MZJA 4PCWA 3SJSA 4XJKB 1TTXA 3I5GB 1ALVA 2F2OA 1XVJA 4YGEB 3FIAA 2OVOA 1NCYA 1OQPA 1XFUO 4XYNA 1OE9B 4F0ZB 1NIWA 1PALA 2MAZA 3I5GC 4ICBA 1SCMC 2F33A 3QRXA 4UXJA 1PTRA 2KMPA 1FARA 1Y1BA 1W7IB 3ZNIA 1XFXO 3RLZA 1D1OA 1AUIB 1UHHA 2KBIA 2ZNEA 2JXCA 2MA2A 3KEVA 4ZCVA 4UXIA 1JUOA 3EVVA 3FS7A 1JBAA 5KTYA 3RM1A 1QX7A 1QTXA 5JJGA 1OZSA 1JF0A 1NPQA 1BOCA 1RFHA 1UP5A 4GPLB 1SRAA 1UUSA 2JPTA 4C0JA 1G8IA 2MJWB 1OYVI 2KMOA 2AMIA 4YRUA 1L2OB 3VRPA 2JTZA 1NSHA 2L5XB 4I5KA 1V1IA 2ELIA 2M3WA 2FNFX 1QX2A 1IQ3A 2F3CI 4WQ3A 5IBWA 3DVMA 3PATA 2Q4UA 2QQCA 2BE4A 3SG5A 2OTGC 4USLA 4C0LA 2GGZA 2JOJA 2BCXA 4E1RA 1TIHA 3UGLA 4DCKA 3SG4A 1CE3A 2L4HA 1QIVA 5J3XA 1YUTA 1TBRR 1UVFA 2BBNA 3CS1A 3CXLA 1FAQA 3SEKC 1NUBA 2LP3A 5ER4X 2KQYA 2K7OA 2BKHB 2K8MB 1DS2I 4FKDA 2MRDA 4PHJA 1KK7Y 1M46A 2K7BA 4PHMA 5CSFA 4YGBB 1IW4A 3D10A 4QJ4B 1IH0A 3SG7A 1PJUA 2BL0C 4I5LB 2I7AA 1EXRA 4NDCA 1FYBA 2JULA 1QVIZ 1TNPA 3VE5A 1SGYI 4CIDA 1RWYA 3BOWA 1TIZA 1RTP1 4MBEA 1YVHA 1U5IA 1KK8C 1S5GZ 2JNXA 2K2FA 2YQPA 1K2HA 2K7DA 3LL8B 1H0ZA 2ZNDA 4GNKB 5JHWC 1OMVA 1TNWA 1QLKA 2BCAA 3O78A 3LLEA 2G2BA 1PCEA 1PPFI 3BYAA 4A24A 1UHIA 3PDNA 2ISDA 4MRYA 1NWDA 3PSRA 1BJFA 1XA6A 2JT8A 1S3PA 2FCEA 1B1GA 3CWGA 2QACA 2F3YA 3VGOA 2JWWA 1NX1A 2L8EA 4GGFC 2K9HA 4R1EA 2G9BA 3SIAA 1TGSI 1VDDA 1TCFA 1SGPI 1W4RA 2PRUA 2VRWB 3VDUA 1AHRA 2P6AC 3M0WA 2L2EA 1WDCC 5FUXA 1BG1A 1X74A 2M8UA 1JC2A 2LE9B 1W3SA 2SCPA 2I94A 1G33A 1DJXA 1S26D 2Q91A 3DF0A 1A75A 1LINA 2BECA 2JZIA 3A8RA 4ZCUA 3NSLA 4MSPA 2JC2A 1MT1A 2WCYA 4FTGA 2LCPA 1B7TZ 4DUQA 1ZUZA 4PE7A 4GAOA 1AK8A 1XBTA 5JOLA 4GI3C 3OB1B 1TNQA 1KBFA 3C1VA 1CFDA 2ZN9A 3O4YA 1EH2A 1UURA 4C0KA 1DJGA 1F71A 1IGVA 3I5IB 1DVIA 1TNXA 4A4CA 4JCVE 3CR5X 1TN4A 3OX5A 4MZKA 2GKRI 2EGDA 2KBMA 1OMRA 2KNEA 2EC6B 2ZRSA 1XK4A 1TOTA 2QPOA 2LUYA 1PULA 1OMDA 2HPSA 3VRQA 3VROA 1LR9A 2WOSA 1BMOA 3KPXA 5D69A 1N13A 2KAYA 1CHOI 5EX3A 1XFWO 3DVJA 3SG6A 1CGII 3D00A 1DJIA 1ZMZA 1DJYA 1ODBA 3OX6A 3OP0A 5I2LA 1G4YR 2LAPA 2WC8A 1FI6A 2EHBA 5I2QA 1PVAA 3BQ3A 2ORWA 2J9RA 2LNKA 1SGEI 1K95A 1BR4B 4NQGA 1DT7B 1ZOTB 1NP8A 5HKWA 1C7VA 1F4OA 3DVEA 4OVOA 1NCXA 1IY6A 1DGUA 3HCMA 3KY9A 1CDLA 3CR4X 2N17A 2H61C 2ORVA 2LUCA 1RK9A 1BF5A 1R2UA 4PHNA 1RFJA 1K9PA 1DMOA 2O5GA 4CLNA 1V1GA 1J7PA 3SG2A 1RJVA 3O6BA 1HPTA 1AP4A 2JW6A 2HQWA 1S1EA 3HX4A 1XFVO 1RECA 4YGDB 3TDUA 1CKKA 1AN1I 1B8RA 3SGBI 1BODA 2COLB 2LANA 1JWDA 1Z7KB 2AUCA 4MRXA 5FUVA 2WCFA 1SNLA 1U5KA 1YTPA 2M7NA 4DS7A 2DB6A 3GOXA 1B8CA 1S6JA 3PFVA 2JZMA 1L2OC 1DGVA 1NX2A 1HT9A 1CMGA 2FJUB 1LKJA 2CCMA 1LXFC 4U8DA 1XFYO 2KCXA 1TRFA 3TUYB 1S6CA 5BPJA 3TS5B 4WQ2A 2L50A 2MLEC 1HJAI 4ORCB 3UFFA 2E6WA 3OXFA 1B9AA 2PVBA 2HF5A 3OB2B 4SGBI 1DJZA 3JTDB 2H2KA 1CLMA 1N65A 3DD4A 1VRKA 5HQ8A 1CLLA 2M9GA 3OXLA 1A29A 2WCBA 1J1EA 1J7RA 1EG3A 2KSPA 2KAVA 4PDZA 1F4QA 3JTDC 1IG5A 2LMUA 2LVVA 4NDBA 1YURA 5AERA 3PN7B 2A20A 3UGDA 1IJ5A 3JVTB 5K89A 2JQ6A 1SGQI 1XX6A 2SGDI 3BUOB 1CFFA 3I5HB 1WRLA 2V53A 4P5OE 2NXQA 1QXPA 4IL1A 2L4IA 2NCOA 4N1GA 2ZFDA 3JVTC 4YGCB 5CCLA 1YUUA 3A4UB 5KSZA 2NZ0A 1B4CA 1SR6B 1XFZO 3SIBA 1UUCA 3IQQA 3BUWB 1WRKA 1LA0A 2W0TA 2B8TA 2ARPF 1DS3I 1UHNA 1DJWA 3BOWB 3NXAA 2V1CA 2KQ6A 3PALA 1U5IB 4TNCA 5HKYA 2GKTI 2B0UC 1IQ5A 2K61A 3PM8A 4A4BA 3UEJA 1QV1A 2NU2I 5AXIA 2AAOA 4ORAB 3CZTX 2LLSA 2WVJA 1KFUL 3BJIA 1AJ4A 1NX3A 2F2PA 2KI6D 3K21A 4PE4A 4DIRA 5FUYA 2NU0I 1TBOA 1NX0A 2LVIA 2R2IA 1DF0A 1MUXA 2VRGA 2M7LA 1CM4A 1QVIY 4GGFA 1CDPA 4GFTA 3KF9A 3RU0A 1FBVA 1KSOA 1S5GY 2SGEI 3NSOA 4JPZB 2WCEA 3TZ1A 5CCMA 3E3RA 1K9UA 4MN0A 3GK1A 2XRCA 1JSAA 3WXAA 1M63B 5I2OA 1M8CA 1SGNI 4HGUA 2MBXA 3EKJA 1UWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUX A;  5HYD A;  3DF0 B;  5I8N A;  1A75 B;  1TUR A;  1YRT B;  5AEQ A;  1QIW A;  1C7W A;  5TNC A;  2K2A A;  1N2D A;  2PAL A;  4GUK A;  4JWQ A;  2SAS A;  4D1E A;  3BXK A;  1QX5 B;  2JRF A;  4GBA A;  4JQ0 D;  1UVG A;  2M29 A;  4I5N B;  2HQ8 A;  2KFF A;  4MZL A;  3EK7 A;  4QJ5 B;  4CFR A;  4E68 A;  1K96 A;  1SYM A;  2TN4 A;  2JU0 A;  5HLV A;  1R6P A;  2SGF I;  1MQ1 A;  1QAS A;  1XO5 A;  3AKB A;  3I5I C;  3B4V C;  4AQI A;  2JT0 A;  1PVB A;  1SL8 A;  2O60 A;  1BLQ A;  2NU3 I;  2EC6 C;  1SK6 D;  2KHN A;  2Y4Q A;  4OCI A;  4AOM A;  2LLT A;  4PE0 A;  2GKV A;  2L98 A;  2KI6 C;  2JXL A;  1GGZ A;  1SMG A;  2OS8 B;  1B47 A;  4GGN A;  4M2P A;  1NYA A;  1CDN A;  1ZFS A;  2M49 B;  4N1F A;  1J7O A;  1XK4 C;  3WHU B;  3HH2 C;  1Q80 A;  1HDL A;  1GJY A;  1UHK A;  1Y1A A;  3AAK A;  3BUM B;  1PSR A;  4ETO A;  1B8L A;  2P6B B;  1J7Q A;  2K0J A;  1ALW A;  2KYF A;  3D0Y A;  4I5J A;  5AAN A;  1JF2 A;  3NSI A;  1EG4 A;  4MVF A;  1DJH A;  3LCP C;  1KMA A;  5D7F A;  2LEO A;  1OMU A;  1Y1C A;  1OMT A;  2WOR A;  4PE1 A;  4XJK A;  1LA3 A;  2F8P A;  1KCY A;  1BR1 B;  1H4B A;  3ZWH A;  2N52 A;  1W7J B;  1NCZ A;  2GV5 A;  1XA5 A;  2LLU A;  3I5F B;  4N5X A;  2F3Z A;  1X02 A;  2LVK A;  1FI5 A;  2KMR A;  1S6I A;  2JNF A;  3BUN B;  3OVO A;  2M1U A;  4YI9 A;  2PMY A;  2H61 A;  3I5F C;  1SCM B;  3ICB A;  5CSI A;  1M31 A;  4HSZ A;  1PRW A;  1CGJ I;  1CFP A;  1J1D A;  2K7C A;  1QS7 A;  1H8B A;  3TJQ A;  1TOP A;  4YI8 A;  1WY9 A;  2M0R A;  1KFU S;  3PLF B;  2BBM A;  3EVU A;  1YX8 A;  2MHH A;  3GK4 X;  1M39 A;  1SKT A;  1AVS A;  1LR7 A;  2CBL A;  2DOQ A;  2KOT A;  2M97 A;  5CSJ A;  1F55 A;  1YR5 A;  1FPW A;  1CT2 I;  2NU1 I;  2Y5I A;  3FWB A;  1WLZ A;  3EK8 A;  2LMT A;  3TDI A;  3AAJ A;  3TUY C;  3TS5 C;  1MHO A;  1CDM A;  1UHJ A;  2Y1N A;  2LHI A;  2NU4 I;  2I18 A;  1A4P A;  4WRI A;  2ERW A;  1KQV A;  3LK0 A;  5DKQ A;  3CLN A;  1KK7 Z;  5ER5 A;  2JXD A;  2ZKM X;  3DVK A;  1LVC D;  2FOT A;  1CNP A;  1CT0 I;  3IF7 A;  5GQQ C;  2OTG B;  2BKI B;  2IS9 A;  4M2O A;  2KYC A;  2KFH A;  3KO0 A;  3PN7 C;  2LP2 A;  1JFJ A;  1A2X A;  2KGB C;  3EKH A;  2L0P A;  1HQV A;  5KU1 A;  1SGD I;  3I5H C;  1CM1 A;  2LHL A;  3QTL D;  5CPV A;  2L51 A;  5PAL A;  1KFX L;  2BE6 A;  4UPG A;  1TUS A;  1MXL C;  2OPO A;  1IY5 A;  2QQD A;  1QAT A;  1YTZ C;  1SR6 C;  2LM5 A;  3IQO A;  1MWN A;  1FF1 A;  1CTR A;  2FCD A;  1QV0 A;  5CSN A;  1QJT A;  4ORB B;  3BUX B;  2CXJ A;  1KWO B;  1CFC A;  1SBJ A;  1BT6 A;  4HRE E;  1F8H A;  2NLN A;  2BL0 B;  1XYD A;  3H4S E;  5FYX A;  2KDH A;  1Y0V H;  2JYY A;  1KWO C;  1SCV A;  1OVO A;  1A03 A;  5B8I B;  1PK0 D;  5HKZ A;  1KK8 B;  1WRZ A;  3NSK A;  1ZAC A;  4OV2 A;  1YVL A;  3SG3 A;  5DKN A;  1CSO I;  2CNP A;  1V1F A;  2CTN A;  2QPT A;  2MLF C;  2LMV A;  3FWC A;  4M2Q A;  1KQM B;  3LK1 A;  4YGA A;  1F70 A;  1SL9 A;  2SGQ I;  4CFQ A;  1OOJ A;  1K9K A;  1IKU A;  3VRN A;  1K8U A;  4QJ3 B;  1KQM C;  4YBH B;  2JTT A;  4BY5 A;  5DKR A;  1DF0 B;  2B1U A;  4AQJ A;  3KHE A;  3GOF A;  1BUS A;  1J55 A;  1CMF A;  2WND A;  1YRU B;  2SGP I;  1R0R I;  1JFK A;  2KAX A;  4OVN F;  3MSE B;  2PAS A;  3WHT B;  2I2R E;  4Q04 A;  2JT3 A;  4BY4 A;  1WDC B;  4L9M A;  2ZRT A;  2M5X A;  1Y1X A;  1GQM A;  2Y1M A;  2BUS A;  3AKA A;  4PHK A;  1YX7 A;  2BCB A;  1IRJ A;  1SY9 A;  1K94 A;  1E8A A;  1QLS A;  1TCO B;  4NDD A;  1CLB A;  1DTL A;  1RRO A;  1L7Z A;  1PSB A;  1OZO A;  3OHM B;  4CPV A;  1BU3 A;  4PAL A;  4FQO A;  3CR2 A;  1LR8 A;  5G08 A;  3TDZ A;  1AJ5 A;  1CT4 I;  2LC5 A;  3F45 A;  3VRR A;  2D8N A;  4MLW A;  1MF8 B;  3WNX B;  3CGA A;  1C07 A;  2KGR A;  3GK2 A;  5F6T A;  1CB1 A;  5AFP A;  1SW8 A;  4OKH A;  1WLM A;  1N0Y A;  4P2Y B;  2M1K B;  1B7T Y;  2E30 A;  2KI4 B;  3CTN A;  2PSR A;  1SL7 A;  2NCP A;  2OS8 C;  2KMQ A;  3EK4 A;  1M45 A;  2A4J A;  1YUS A;  1EJ3 A;  1GGW A;  2KI4 C;  1OSA A;  1S36 A;  2HET A;  2LVJ A;  2LV7 A;  1MXE A;  1SGR I;  5HLO A;  4HRH A;  1FW4 A;  1KSM A;  4MEW A;  4OR9 B;  1K90 D;  3EVR A;  1F54 A;  1TBQ R;  2KFG A;  1K93 D;  3SGQ I;  2N71 A;  1YU6 C;  1Y6W A;  1Y1U A;  3D0Y B;  2GGM A;  1MR8 A;  2CT9 A;  1IWQ A;  1KFX S;  1SPY A;  1IJ6 A;  1EL4 A;  2RGI A;  4DRW A;  2ZN8 A;  1M8B A;  4HRG A;  3O2P A;  4MZJ A;  4PCW A;  3SJS A;  4XJK B;  1TTX A;  3I5G B;  1ALV A;  2F2O A;  1XVJ A;  4YGE B;  3FIA A;  2OVO A;  1NCY A;  1OQP A;  1XFU O;  4XYN A;  1OE9 B;  4F0Z B;  1NIW A;  1PAL A;  2MAZ A;  3I5G C;  4ICB A;  1SCM C;  2F33 A;  3QRX A;  5DAE A;  2KMP A;  1Y1B A;  1W7I B;  3ZNI A;  1XFX O;  3RLZ A;  1D1O A;  1AUI B;  1UHH A;  2KBI A;  2ZNE A;  2JXC A;  2MA2 A;  3KEV A;  4ZCV A;  1JUO A;  3EVV A;  3FS7 A;  1JBA A;  5KTY A;  3RM1 A;  1QX7 A;  1QTX A;  5JJG A;  1OZS A;  1JF0 A;  1NPQ A;  1BOC A;  1UP5 A;  4GPL B;  1SRA A;  1UUS A;  2JPT A;  4C0J A;  1G8I A;  2MJW B;  1OYV I;  2KMO A;  2AMI A;  4YRU A;  1L2O B;  3VRP A;  2JTZ A;  1NSH A;  2L5X B;  4I5K A;  2M3W A;  1QX2 A;  1IQ3 A;  2F3C I;  4WQ3 A;  5IBW A;  3DVM A;  3PAT A;  2Q4U A;  2QQC A;  2BE4 A;  3SG5 A;  2OTG C;  4USL A;  4C0L A;  2GGZ A;  2JOJ A;  2BCX A;  1TIH A;  4DCK A;  3SG4 A;  1CE3 A;  2L4H A;  1QIV A;  5J3X A;  1YUT A;  1TBR R;  1UVF A;  2BBN A;  3CS1 A;  3SEK C;  1NUB A;  2LP3 A;  5ER4 X;  2KQY A;  2K7O A;  2BKH B;  2K8M B;  1DS2 I;  2MRD A;  4PHJ A;  1KK7 Y;  1M46 A;  2K7B A;  4PHM A;  5CSF A;  4YGB B;  1IW4 A;  3D10 A;  4QJ4 B;  1IH0 A;  3SG7 A;  1PJU A;  2BL0 C;  4I5L B;  2I7A A;  1EXR A;  4NDC A;  1FYB A;  2JUL A;  1QVI Z;  1TNP A;  1SGY I;  4CID A;  1RWY A;  3BOW A;  1TIZ A;  1RTP 1;  4MBE A;  1YVH A;  1U5I A;  1KK8 C;  1S5G Z;  2JNX A;  2K2F A;  1K2H A;  2K7D A;  3LL8 B;  1H0Z A;  2ZND A;  4GNK B;  5JHW C;  1OMV A;  1TNW A;  1QLK A;  2BCA A;  3O78 A;  3LLE A;  2G2B A;  1PCE A;  1PPF I;  3BYA A;  1UHI A;  2ISD A;  4MRY A;  1NWD A;  3PSR A;  1BJF A;  2JT8 A;  1S3P A;  2FCE A;  1B1G A;  3CWG A;  2QAC A;  2F3Y A;  3VGO A;  2JWW A;  1NX1 A;  4GGF C;  4R1E A;  2G9B A;  3SIA A;  1TGS I;  1TCF A;  1SGP I;  2PRU A;  1AHR A;  2P6A C;  3M0W A;  2L2E A;  1WDC C;  1BG1 A;  2M8U A;  1JC2 A;  2LE9 B;  2SCP A;  2I94 A;  1G33 A;  1DJX A;  1S26 D;  2Q91 A;  3DF0 A;  1A75 A;  1LIN A;  2BEC A;  2JZI A;  3A8R A;  4ZCU A;  3NSL A;  4MSP A;  2JC2 A;  1MT1 A;  2WCY A;  4FTG A;  2LCP A;  1B7T Z;  4DUQ A;  1ZUZ A;  4PE7 A;  4GAO A;  1AK8 A;  4GI3 C;  5JOL A;  3OB1 B;  1TNQ A;  3C1V A;  1CFD A;  2ZN9 A;  3O4Y A;  1EH2 A;  1UUR A;  4C0K A;  1DJG A;  1F71 A;  1IGV A;  3I5I B;  1DVI A;  1TNX A;  4A4C A;  3CR5 X;  1TN4 A;  3OX5 A;  4MZK A;  2GKR I;  2EGD A;  2KBM A;  1OMR A;  2KNE A;  2EC6 B;  2ZRS A;  1XK4 A;  1PUL A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  1LR9 A;  2WOS A;  1BMO A;  3KPX A;  5D69 A;  1N13 A;  2KAY A;  1CHO I;  1XFW O;  3DVJ A;  3SG6 A;  1CGI I;  1DJI A;  1ZMZ A;  1DJY A;  1ODB A;  3OX6 A;  3OP0 A;  5I2L A;  1G4Y R;  2LAP A;  2WC8 A;  1FI6 A;  2EHB A;  5I2Q A;  1PVA A;  3BQ3 A;  2LNK A;  1SGE I;  1K95 A;  1BR4 B;  4NQG A;  1DT7 B;  1ZOT B;  1NP8 A;  5HKW A;  1C7V A;  1F4O A;  3DVE A;  4OVO A;  1NCX A;  1IY6 A;  1DGU A;  3HCM A;  1CDL A;  3CR4 X;  2N17 A;  2H61 C;  2LUC A;  1RK9 A;  1BF5 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  1DMO A;  2O5G A;  4CLN A;  1V1G A;  1J7P A;  3SG2 A;  1RJV A;  3O6B A;  1HPT A;  1AP4 A;  2HQW A;  1S1E A;  3HX4 A;  1XFV O;  1REC A;  4YGD B;  3TDU A;  1CKK A;  1AN1 I;  1B8R A;  3SGB I;  1BOD A;  2COL B;  2LAN A;  1JWD A;  1Z7K B;  2AUC A;  4MRX A;  2WCF A;  1SNL A;  1YTP A;  2M7N A;  4DS7 A;  1B8C A;  1S6J A;  3PFV A;  2JZM A;  1L2O C;  1DGV A;  1NX2 A;  1HT9 A;  1CMG A;  2FJU B;  1LKJ A;  2CCM A;  1LXF C;  4U8D A;  1XFY O;  2KCX A;  1TRF A;  3TUY B;  1S6C A;  5BPJ A;  3TS5 B;  4WQ2 A;  2L50 A;  2MLE C;  1HJA I;  4ORC B;  2E6W A;  1B9A A;  2PVB A;  2HF5 A;  3OB2 B;  4SGB I;  1DJZ A;  3JTD B;  2H2K A;  1CLM A;  1N65 A;  3DD4 A;  1VRK A;  1CLL A;  2M9G A;  1A29 A;  2WCB A;  1J1E A;  1J7R A;  1EG3 A;  2KSP A;  2KAV A;  4PDZ A;  1F4Q A;  3JTD C;  1IG5 A;  2LMU A;  2LVV A;  4NDB A;  1YUR A;  5AER A;  3PN7 B;  1IJ5 A;  3JVT B;  5K89 A;  2JQ6 A;  1SGQ I;  2SGD I;  3BUO B;  1CFF A;  3I5H B;  1WRL A;  2V53 A;  4P5O E;  2NXQ A;  1QXP A;  4IL1 A;  2L4I A;  2NCO A;  4N1G A;  2ZFD A;  3JVT C;  4YGC B;  1YUU A;  3A4U B;  5KSZ A;  2NZ0 A;  1B4C A;  1SR6 B;  1XFZ O;  3SIB A;  1UUC A;  3IQQ A;  3BUW B;  1WRK A;  1LA0 A;  2ARP F;  1DS3 I;  1UHN A;  1DJW A;  3BOW B;  3NXA A;  2KQ6 A;  3PAL A;  1U5I B;  4TNC A;  5HKY A;  2GKT I;  2B0U C;  1IQ5 A;  2K61 A;  3PM8 A;  4A4B A;  1QV1 A;  2NU2 I;  5AXI A;  2AAO A;  4ORA B;  3CZT X;  2LLS A;  1KFU L;  1AJ4 A;  1NX3 A;  2F2P A;  2KI6 D;  3K21 A;  4PE4 A;  4DIR A;  2NU0 I;  1NX0 A;  2LVI A;  2R2I A;  1DF0 A;  1MUX A;  2VRG A;  2M7L A;  1CM4 A;  1QVI Y;  4GGF A;  1CDP A;  4GFT A;  3KF9 A;  1FBV A;  1KSO A;  1S5G Y;  2SGE I;  3NSO A;  4JPZ B;  2WCE A;  3TZ1 A;  3E3R A;  1K9U A;  4MN0 A;  3GK1 A;  2XRC A;  1JSA A;  3WXA A;  1M63 B;  5I2O A;  1M8C A;  1SGN I;  4HGU A;  2MBX A;  3EKJ A;  1UWO A; 
#chains in the Genus database with same CATH topology
 5I8N A;  1TUJ A;  3TOB A;  2PAL A;  3OXG A;  4GUK A;  2ERB A;  1K96 A;  1SYM A;  2TN4 A;  2SGF I;  1MQ1 A;  3I5I C;  1SK6 D;  2KHN A;  2Y4Q A;  4AOM A;  4PE0 A;  1GGZ A;  1SMG A;  3R5A A;  1NYA A;  1GJY A;  3AAK A;  1PSR A;  4ETO A;  1B8L A;  1J7Q A;  2K0J A;  2KYF A;  1JF2 A;  3NHT A;  2QDI A;  3B86 A;  4PE1 A;  4XJK A;  1K7T A;  1KCY A;  2RIJ A;  1W7J B;  1NCZ A;  1XA5 A;  2LLU A;  2LVK A;  2KMR A;  2JNF A;  2M1U A;  2PMY A;  3I5F C;  3ICB A;  5CSI A;  2PYQ A;  5I94 A;  1TOP A;  1YX8 A;  3DXL A;  2CBL A;  1CT2 I;  2Y5I A;  3EK8 A;  7WGA A;  3TUY C;  3TS5 C;  1Y8F A;  1V1H A;  3UOE A;  2H8V A;  1CNP A;  1TBN A;  2IS9 A;  4M2O A;  2KFH A;  3EKH A;  5HL1 A;  2BE6 A;  2OPO A;  1QAT A;  3IQO A;  3EG5 B;  1FF1 A;  2FCD A;  1QV0 A;  5CSN A;  3BUX B;  1KWO B;  1SBJ A;  1BT6 A;  2NLN A;  1Y0V H;  5B8I B;  4OV2 A;  1YVL A;  4AML A;  2CNP A;  2QPT A;  3FWC A;  4YGA A;  2SGQ I;  1OOJ A;  1K8U A;  2JTT A;  2B1U A;  3KHE A;  1LS8 A;  2SGP I;  3D74 A;  3MSE B;  2I2R E;  1GM0 A;  2BCB A;  1TCO B;  5FI2 A;  3SS5 A;  3OHM B;  1LR8 A;  3Q8I A;  2QQE A;  3VRR A;  3WNX B;  3GK2 A;  1SW8 A;  4OKH A;  4P2Y B;  3CTN A;  5EX0 A;  3D73 A;  2GIV A;  2NCP A;  3EK4 A;  1M45 A;  2DKV A;  2KI4 C;  1MXE A;  4MEW A;  1K90 D;  1YU6 C;  3D0Y B;  2QEV A;  2ZN8 A;  1M8B A;  2F2O A;  1XVJ A;  3FIA A;  1NCY A;  4XYN A;  1OE9 B;  3I5G C;  1PAL A;  2MAZ A;  4ICB A;  2F33 A;  3RLZ A;  1AUI B;  3EVV A;  1BOC A;  4INX A;  1RFH A;  1DEK A;  3S0B A;  1L2O B;  4INW A;  2F3C I;  2QQC A;  2Q4U A;  9WGA A;  2Y0M A;  4USL A;  2BCX A;  3BFB A;  3UGL A;  3SG4 A;  2K60 A;  1QIV A;  1TBR R;  3CS1 A;  2K7O A;  2K7B A;  1IW4 A;  3SG7 A;  2JUL A;  3VE5 A;  4MBE A;  1S5G Z;  2YQP A;  3D76 A;  4GNK B;  1OMV A;  2G2B A;  1UHI A;  3PSR A;  3FE8 A;  2JT8 A;  2X3T A;  1B1G A;  2JWW A;  4GGF C;  2K9H A;  3SIA A;  3TO9 A;  3TOA A;  2P6A C;  3SS4 A;  1JC2 A;  1DJX A;  3DF0 A;  2BEC A;  2JZI A;  3NSL A;  4MSP A;  1MT1 A;  4DUQ A;  3S0G A;  1CFD A;  3O4Y A;  1EH2 A;  1TUZ A;  4JD9 A;  4JCV E;  3OX5 A;  1OMR A;  2KNE A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  3KPX A;  1N13 A;  2WC5 A;  1CHO I;  3SG6 A;  3D00 A;  1ZMZ A;  3OX6 A;  2LAP A;  1PVA A;  2ORW A;  2J9R A;  2LNK A;  1K95 A;  1BR4 B;  3DVE A;  1DGU A;  1WKX A;  1CDL A;  2ORV A;  2H61 C;  1BF5 A;  1NXU A;  3SG2 A;  3O6B A;  1HPT A;  1WTJ A;  1AP4 A;  3HX4 A;  1XFV O;  3TDU A;  1B8R A;  1Z7K B;  2M7N A;  2JZM A;  1L2O C;  1DGV A;  2FJU B;  1LKJ A;  1LXF C;  4WQ2 A;  3UFF A;  3OB2 B;  4SGB I;  1N65 A;  2M9G A;  1A29 A;  2WCB A;  1J7R A;  1EG3 A;  2KAV A;  1IG5 A;  2LMU A;  5AER A;  2A20 A;  2WCJ A;  1IJ5 A;  3I5H B;  1QXP A;  5CCL A;  1XFZ O;  3B6X A;  2B8T A;  3UNW A;  2K61 A;  4A4B A;  1QV1 A;  2NU2 I;  5AXI A;  2BNX A;  1KFU L;  2F2P A;  3K21 A;  4DIR A;  1NX0 A;  1QVI Y;  4GFT A;  3KF9 A;  3RU0 A;  2SGE I;  1Z2C B;  3GK1 A;  2XRC A;  3VDU A;  1A75 B;  1N2D A;  4JQ0 D;  4I5N B;  4QJ5 B;  4CFR A;  4E68 A;  5HLV A;  1XO5 A;  4AQI A;  2JT0 A;  2GKV A;  2L98 A;  4KYN A;  2JXL A;  4GGN A;  1B47 A;  1ZFS A;  2M49 B;  1J7O A;  3WHU B;  4PT1 A;  1Q80 A;  1UHK A;  3BUM B;  5AAN A;  3NSI A;  1EG4 A;  4MVF A;  1LA3 A;  1BR1 B;  1H4B A;  3I5F B;  2F3Z A;  1X02 A;  3BUN B;  4YI9 A;  3D78 A;  1QS7 A;  2CWG A;  4YI8 A;  2M0R A;  1KFU S;  3PLF B;  2BBM A;  3EVU A;  2MHH A;  1M39 A;  1AVS A;  5CSJ A;  3TDI A;  3AAJ A;  2QEB A;  3S0D A;  1UHJ A;  2ERW A;  5DKQ A;  3CLN A;  2CJS C;  2ZKM X;  2FOT A;  5GQQ C;  2BKI B;  1Z2I A;  3KO0 A;  1JFJ A;  1A2X A;  5KU1 A;  3I5H C;  2LHL A;  2UVO A;  1FY7 A;  5PAL A;  1MXL C;  2QQD A;  2L7X A;  1CTR A;  3OBV A;  2L2C A;  2BL0 B;  3H4S E;  2KDH A;  1TWO A;  2GVI A;  1WRZ A;  1ORG A;  1CSO I;  5DKN A;  3E59 A;  2V1C C;  2CTN A;  3OL0 A;  2MLF C;  4M2Q A;  5D3O A;  1F70 A;  1SL9 A;  1K9K A;  4QJ3 B;  1KQM C;  5DKR A;  2KAX A;  4OVN F;  2PAS A;  3WHT B;  3VDP A;  3QME A;  1WDC B;  1Y1X A;  2ODD A;  3E2I A;  1DQE A;  2BUS A;  3AKA A;  4NDD A;  3BJH A;  4FQO A;  3TO6 A;  1CT4 I;  2LC5 A;  3F45 A;  1MF8 B;  1WLM A;  2M1K B;  2KI4 B;  1SL7 A;  1S36 A;  2HET A;  4HRH A;  2N71 A;  1Y6W A;  1MR8 A;  2CT9 A;  3V2L A;  2RGI A;  4DRW A;  4HRG A;  4PCW A;  3SJS A;  1TTX A;  3I5G B;  1NIW A;  1FAR A;  1W7I B;  1D1O A;  1UHH A;  4ZCV A;  2JXC A;  2MA2 A;  1JBA A;  1JF0 A;  1UP5 A;  1SRA A;  1UUS A;  2MJW B;  1OYV I;  3VRP A;  1NSH A;  4I5K A;  1V1I A;  2ELI A;  2FNF X;  1XFR A;  1QX2 A;  1IQ3 A;  4WQ3 A;  5IBW A;  2BE4 A;  3FSY A;  3SG5 A;  2GGZ A;  4E1R A;  2L4H A;  3D77 A;  1YUT A;  1UVF A;  2BKH B;  2K8M B;  4FKD A;  5CSF A;  1OW4 A;  4YGB B;  3D10 A;  1PJU A;  2BL0 C;  4I5L B;  2I7A A;  1FYB A;  1QVI Z;  1TNP A;  3DYE A;  4CID A;  3BOW A;  1YVH A;  1U5I A;  3B7A A;  1H0Z A;  1TNW A;  2BCA A;  4MRY A;  1BJF A;  2KLE A;  2FCE A;  2F3Y A;  1TGS I;  1VDD A;  1TCF A;  1W4R A;  2PRU A;  3M0W A;  1WDC C;  5FUX A;  1BG1 A;  2M8U A;  2LE9 B;  1G33 A;  1S26 D;  3S0E A;  3A8R A;  4ZCU A;  2JC2 A;  4PE7 A;  1XBT A;  1KBF A;  5JOL A;  3OB1 B;  4MPI A;  2ZN9 A;  3QAH A;  1F71 A;  1DJG A;  4OZD A;  1C3Y A;  2CWF A;  3CR5 X;  1XK4 A;  2QPO A;  2LUY A;  1LR9 A;  3K1E A;  5D69 A;  1QWV A;  2P71 A;  3OP0 A;  1FI6 A;  5I2Q A;  3BQ3 A;  4NQG A;  1ZOT B;  2KLD A;  5HKW A;  3KY9 A;  2O5G A;  1RJV A;  4IJ7 A;  3SGB I;  1S1E A;  4YGD B;  2CWH A;  3S0F A;  2LAN A;  4MRX A;  1U5K A;  3GOX A;  3R72 A;  1B8C A;  3PFV A;  1NX2 A;  1CMG A;  1HT9 A;  2CCM A;  2WCL A;  5BPJ A;  4ORC B;  2H2K A;  1VRK A;  1J1E A;  1YUR A;  3UGD A;  5K89 A;  2OU2 A;  1XX6 A;  3BUO B;  2V53 A;  4IL1 A;  2L4I A;  1YUU A;  3FE9 A;  3RZS A;  1B4C A;  1SR6 B;  3CZ1 A;  3SIB A;  1LA0 A;  1UHN A;  1OOH A;  3PAL A;  1MJB A;  5HKY A;  2B0U C;  2AAO A;  4ORA B;  1DC1 A;  3CZT X;  1AJ4 A;  2KI6 D;  3DZT A;  4PE4 A;  1TBO A;  2M7L A;  4GGF A;  4JPZ B;  3E3R A;  3WXA A;  5I2O A;  1M8C A;  1SGN I;  1P9Z A;  2LUX A;  5HYD A;  1TUR A;  1YRT B;  1C7W A;  2FJY A;  2K2A A;  3FSX A;  3BXK A;  2JRF A;  4GBA A;  2HQ8 A;  2KFF A;  4MZL A;  2WC6 A;  1SL8 A;  1BLQ A;  2LLT A;  2KI6 C;  2OS8 B;  4M2P A;  1CDN A;  4N1F A;  1HDL A;  3HH2 C;  1Y1A A;  2P6B B;  3R5C A;  1WGT A;  3D0Y A;  4I5J A;  1DJH A;  1KMA A;  5D7F A;  2LEO A;  1OMU A;  1Y1C A;  2WOR A;  2F8P A;  3ZWH A;  2N52 A;  2GV5 A;  4N5X A;  1S6I A;  1PTQ A;  2H61 A;  1PRW A;  1CGJ I;  2LB7 A;  1CFP A;  1H8B A;  1X4S A;  3TJQ A;  2OD1 A;  1W9Z A;  3B87 A;  2E5R A;  1LR7 A;  3QWP A;  2YGU A;  2KOT A;  2M97 A;  1YR5 A;  2WCH A;  1FPW A;  1MHO A;  1CDM A;  3UGI A;  2I18 A;  4WRI A;  3NGV A;  3LK0 A;  5FI6 A;  2JXD A;  3DVK A;  1LVC D;  1CT0 I;  3IF7 A;  3R5B A;  1HQV A;  2YUU A;  2DIP A;  5CPV A;  4UPG A;  1TUS A;  1YTZ C;  2LM5 A;  1SR6 C;  4WP4 A;  1MWN A;  4UXH A;  1QJT A;  2CXJ A;  3B88 A;  1CFC A;  1MJA A;  2X52 A;  1XYD A;  5FYX A;  2JYY A;  1OVO A;  1A03 A;  1PK0 D;  1ZAC A;  1KBE A;  1SSE B;  1V1F A;  2GTE A;  1KQM B;  3CDN A;  1P28 A;  3VRN A;  4BY5 A;  1DF0 B;  3GOF A;  1BUS A;  1J55 A;  1CMF A;  1R0R I;  1JFK A;  4Q04 A;  2ZRT A;  3S0A A;  4PHK A;  1SY9 A;  1IRJ A;  1K7V A;  1L7Z A;  1OZO A;  4CPV A;  1BU3 A;  2JPO A;  3CR2 A;  3R1P A;  2ROW A;  2D8N A;  4MLW A;  3CGA A;  3IVT A;  5F6T A;  3PJI A;  5AFP A;  1CB1 A;  1N0Y A;  3UEY A;  2E30 A;  2E73 A;  5HI7 A;  2OS8 C;  2A4J A;  1GGW A;  1EJ3 A;  1OSA A;  2LVJ A;  2LV7 A;  1SGR I;  1TBQ R;  3EVR A;  1F54 A;  2KFG A;  3SGQ I;  1Y1U A;  5E3P A;  1EL4 A;  2WCM A;  3O2P A;  4XJK B;  1ALV A;  1OQP A;  1XFU O;  3N7H A;  4F0Z B;  3QRX A;  4UXJ A;  1PTR A;  3ZNI A;  3KEV A;  4UXI A;  1JUO A;  5KTY A;  1QTX A;  5JJG A;  2JPT A;  2KPH A;  2KMO A;  2AMI A;  2M3W A;  3R5D A;  2JOJ A;  1TIH A;  2PQ8 A;  2BBN A;  1FAQ A;  3SEK C;  2LP3 A;  2KQY A;  5FI7 A;  4PHJ A;  1KK7 Y;  4PHM A;  4QJ4 B;  4NDC A;  1EXR A;  1SGY I;  1RTP 1;  2K2F A;  1IIO A;  2K7D A;  3LL8 B;  5JHW C;  1PPF I;  3BYA A;  3OGN A;  1NWD A;  1XA6 A;  1S3P A;  3L47 A;  1SGP I;  1OOF A;  2VRW B;  3R1V A;  1AHR A;  2I94 A;  2Q91 A;  1A75 A;  1LIN A;  1P9G A;  2WCY A;  4FTG A;  2LCP A;  1B7T Z;  4GAO A;  3C1V A;  1DVI A;  4A4C A;  2L5Y A;  2RC4 A;  2GKR I;  2EGD A;  2EC6 B;  2ZRS A;  1TOT A;  1PUL A;  2WOS A;  1BMO A;  2KAY A;  5EX3 A;  1XFW O;  1CGI I;  1DJY A;  3L4A A;  1ULM A;  1G4Y R;  2WC8 A;  2EHB A;  1C3Z A;  1C7V A;  1NCX A;  1IY6 A;  3HCM A;  3CR4 X;  2LUC A;  1RK9 A;  1DMO A;  1J7P A;  1CKK A;  1BOD A;  1JWD A;  5FUV A;  1UHA A;  4DS7 A;  1S6J A;  1XFY O;  1TRF A;  1HJA I;  2OZU A;  1B9A A;  2PVB A;  1DJZ A;  3DD4 A;  2KSP A;  1DEL A;  3JTD C;  3PN7 B;  2SGD I;  2JQ6 A;  1WRL A;  4P5O E;  2NXQ A;  4YGC B;  3JVT C;  3A4U B;  1ULN A;  2NZ0 A;  1Z4H A;  1UUC A;  2WCK A;  3IQQ A;  3BUW B;  2W0T A;  2ARP F;  1DS3 I;  1DJW A;  3NXA A;  4TNC A;  2GKT I;  1IQ5 A;  3UEJ A;  2LLS A;  2WVJ A;  4FQT A;  5FUY A;  2NU0 I;  2R2I A;  2VRG A;  1S20 A;  1FBV A;  3NSO A;  4MN0 A;  1M63 B;  4HGU A;  2ZNE A;  1UWO A;  3DF0 B;  5AEQ A;  1QIW A;  3SS3 A;  5TNC A;  4JWQ A;  2SAS A;  4D1E A;  1QX5 B;  1UVG A;  2M29 A;  3BFA A;  4F7F A;  3EK7 A;  4E1P A;  2JU0 A;  3D75 A;  1R6P A;  1QAS A;  3AKB A;  3B4V C;  1PVB A;  2O60 A;  2NU3 I;  2EC6 C;  4OCI A;  2ENZ A;  1XK4 C;  1ALW A;  3LCP C;  1OMT A;  1T14 A;  1FI5 A;  3OVO A;  3MEK A;  1SCM B;  1M31 A;  4HSZ A;  1J1D A;  2K7C A;  1WY9 A;  2QEH A;  3GK4 X;  1SKT A;  2DOQ A;  2J87 A;  1F55 A;  2NU1 I;  3FWB A;  1WLZ A;  2LMT A;  4B6D A;  5EL2 A;  2Y1N A;  2NU4 I;  2LHI A;  1A4P A;  1KQV A;  1KK7 Z;  2UZ3 A;  5ER5 A;  5J8C A;  2OTG B;  2KYC A;  3CAB A;  3PN7 C;  2QQ0 A;  2LP2 A;  2KGB C;  2L0P A;  1SGD I;  1CM1 A;  3QTL D;  2L51 A;  1KFX L;  1IY5 A;  4ORB B;  4JKT A;  1Q9B A;  1F8H A;  4HRE E;  5DIC A;  1WGC A;  1KWO C;  1SCV A;  5HKZ A;  1KK8 B;  3NSK A;  3SG3 A;  2N1A B;  2LMV A;  3LK1 A;  4CFQ A;  1IKU A;  1R79 A;  4YBH B;  4AQJ A;  3FC3 A;  2JA1 A;  3TO7 A;  2WND A;  3FE6 A;  1YRU B;  2JT3 A;  4BY4 A;  4L9M A;  2M5X A;  3CYZ A;  1GQM A;  2Y1M A;  1YX7 A;  1K94 A;  1E8A A;  1QLS A;  1CLB A;  1DTL A;  1HEV A;  5E3R A;  1RRO A;  3CZ2 A;  3R1O A;  1PSB A;  4PAL A;  5G08 A;  3TDZ A;  1AJ5 A;  1C07 A;  2KGR A;  1B7T Y;  2PSR A;  2KMQ A;  1YUS A;  5HLO A;  1FW4 A;  1KSM A;  4OR9 B;  1K93 D;  2GGM A;  2ENN A;  1IWQ A;  1KFX S;  1SPY A;  1IJ6 A;  2PQL A;  5FUW A;  4MZJ A;  4YGE B;  2OVO A;  5DAE A;  1SCM C;  2KMP A;  1Y1B A;  1XFX O;  2KBI A;  2WGC A;  3FS7 A;  3RM1 A;  1QX7 A;  1OZS A;  1NPQ A;  4GPL B;  3DY9 A;  4C0J A;  1G8I A;  4YRU A;  2JTZ A;  2L5X B;  3DVM A;  3PAT A;  3NHI A;  2OTG C;  4C0L A;  2QEO A;  4DCK A;  1CE3 A;  5J3X A;  1K7U A;  3CXL A;  1NUB A;  5ER4 X;  1DS2 I;  2MRD A;  2P70 A;  1M46 A;  1IH0 A;  1ULK A;  1RWY A;  1TIZ A;  2JNX A;  1KK8 C;  1K2H A;  2ZND A;  1QLK A;  3O78 A;  3LLE A;  1PCE A;  4A24 A;  3PDN A;  2ISD A;  3CWG A;  2QAC A;  2L8E A;  3VGO A;  1NX1 A;  4R1E A;  2G9B A;  5E3Q A;  3BFH A;  2L2E A;  1X74 A;  1W3S A;  2SCP A;  1ZUZ A;  1AK8 A;  4GI3 C;  1TNQ A;  3VB1 A;  1UUR A;  4C0K A;  1IGV A;  3I5I B;  1TNX A;  1TN4 A;  3PM2 A;  4MZK A;  2KBM A;  3DVJ A;  1DJI A;  1ODB A;  5I2L A;  1SGE I;  1DT7 B;  1NP8 A;  1F4O A;  4OVO A;  1OOI X;  2N17 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  4CLN A;  1V1G A;  4DNC A;  2JW6 A;  2HQW A;  1AN1 I;  5J8F A;  1REC A;  2COL B;  2AUC A;  2WCF A;  1SNL A;  1YTP A;  2DB6 A;  4U8D A;  2KCX A;  3TUY B;  1S6C A;  3TS5 B;  2L50 A;  2MLE C;  2E6W A;  3OXF A;  2HF5 A;  3JTD B;  1CLM A;  5HQ8 A;  3UO9 A;  1CLL A;  3OXL A;  1MJ9 A;  4PDZ A;  1F4Q A;  2LVV A;  1OOG A;  4NDB A;  3JVT B;  1SGQ I;  1CFF A;  4N1G A;  2NCO A;  2ZFD A;  5KSZ A;  1WRK A;  2BAP A;  3BOW B;  2V1C A;  2KQ6 A;  3O4X A;  1U5I B;  3PM8 A;  3BJI A;  1NX3 A;  3L4L A;  2LVI A;  1DF0 A;  1MUX A;  1CM4 A;  3CZ0 A;  1CDP A;  1KSO A;  1S5G Y;  2WCE A;  3TZ1 A;  5CCM A;  1K9U A;  1JSA A;  2MBX A;  3EKJ A; 
#chains in the Genus database with same CATH homology
 2LUX A;  5HYD A;  3DF0 B;  5I8N A;  1A75 B;  1TUR A;  1YRT B;  5AEQ A;  1QIW A;  1C7W A;  5TNC A;  2K2A A;  1N2D A;  2PAL A;  4GUK A;  4JWQ A;  2SAS A;  4D1E A;  3OXG A;  3BXK A;  1QX5 B;  2JRF A;  4GBA A;  4JQ0 D;  1UVG A;  2M29 A;  4I5N B;  2HQ8 A;  2KFF A;  4MZL A;  3EK7 A;  4QJ5 B;  4CFR A;  4E68 A;  1K96 A;  1SYM A;  2TN4 A;  2JU0 A;  5HLV A;  4E1P A;  1R6P A;  2SGF I;  1MQ1 A;  1QAS A;  1XO5 A;  3AKB A;  3I5I C;  3B4V C;  4AQI A;  2JT0 A;  1PVB A;  1SL8 A;  2O60 A;  1BLQ A;  2NU3 I;  2EC6 C;  1SK6 D;  2KHN A;  2Y4Q A;  4OCI A;  4AOM A;  2LLT A;  4PE0 A;  2GKV A;  2L98 A;  2KI6 C;  2JXL A;  2ENZ A;  1GGZ A;  1SMG A;  2OS8 B;  1B47 A;  4GGN A;  4M2P A;  1NYA A;  1CDN A;  1ZFS A;  2M49 B;  4N1F A;  1J7O A;  1XK4 C;  3WHU B;  3HH2 C;  1Q80 A;  1HDL A;  1GJY A;  1UHK A;  1Y1A A;  3AAK A;  3BUM B;  1PSR A;  4ETO A;  1B8L A;  2P6B B;  1J7Q A;  2K0J A;  1ALW A;  2KYF A;  3D0Y A;  4I5J A;  5AAN A;  1JF2 A;  3NSI A;  1EG4 A;  4MVF A;  1DJH A;  3LCP C;  1KMA A;  5D7F A;  2LEO A;  1OMU A;  1Y1C A;  1OMT A;  2WOR A;  4PE1 A;  4XJK A;  1LA3 A;  2F8P A;  1KCY A;  1BR1 B;  1H4B A;  3ZWH A;  2N52 A;  1W7J B;  1NCZ A;  2GV5 A;  1XA5 A;  2LLU A;  3I5F B;  4N5X A;  2F3Z A;  1X02 A;  2LVK A;  1FI5 A;  2KMR A;  1S6I A;  2JNF A;  3BUN B;  1PTQ A;  2M1U A;  4YI9 A;  3OVO A;  3MEK A;  2PMY A;  2H61 A;  3I5F C;  1SCM B;  3ICB A;  5CSI A;  1M31 A;  4HSZ A;  1PRW A;  1CGJ I;  1CFP A;  1J1D A;  2K7C A;  1QS7 A;  1H8B A;  1X4S A;  3TJQ A;  1TOP A;  4YI8 A;  1WY9 A;  2M0R A;  1KFU S;  3PLF B;  2BBM A;  3EVU A;  2OD1 A;  1YX8 A;  2MHH A;  2E5R A;  3GK4 X;  1M39 A;  1SKT A;  1AVS A;  1LR7 A;  3QWP A;  2CBL A;  2DOQ A;  2KOT A;  2J87 A;  2M97 A;  5CSJ A;  1F55 A;  1YR5 A;  1FPW A;  1CT2 I;  2NU1 I;  2Y5I A;  3FWB A;  1WLZ A;  3EK8 A;  2LMT A;  3TDI A;  3AAJ A;  3TUY C;  4B6D A;  3TS5 C;  1MHO A;  1Y8F A;  1CDM A;  1UHJ A;  2Y1N A;  2LHI A;  2NU4 I;  2I18 A;  3UGI A;  1A4P A;  4WRI A;  2ERW A;  1KQV A;  3LK0 A;  5DKQ A;  1V1H A;  3CLN A;  1KK7 Z;  2UZ3 A;  5ER5 A;  2CJS C;  2JXD A;  2ZKM X;  3DVK A;  1LVC D;  2FOT A;  1CNP A;  1CT0 I;  3IF7 A;  5GQQ C;  2OTG B;  1TBN A;  2BKI B;  2IS9 A;  4M2O A;  2KYC A;  2KFH A;  3KO0 A;  3PN7 C;  2QQ0 A;  2LP2 A;  1JFJ A;  1A2X A;  2KGB C;  3EKH A;  2L0P A;  1HQV A;  2YUU A;  5KU1 A;  1SGD I;  3I5H C;  1CM1 A;  2LHL A;  3QTL D;  2DIP A;  5CPV A;  2L51 A;  5PAL A;  1KFX L;  2BE6 A;  4UPG A;  1TUS A;  1MXL C;  2OPO A;  1IY5 A;  2QQD A;  1QAT A;  1YTZ C;  1SR6 C;  2LM5 A;  3IQO A;  1MWN A;  1FF1 A;  2L7X A;  1CTR A;  2FCD A;  1QV0 A;  4UXH A;  5CSN A;  1QJT A;  4ORB B;  3BUX B;  2CXJ A;  1KWO B;  1CFC A;  1SBJ A;  1BT6 A;  4HRE E;  1F8H A;  2NLN A;  2BL0 B;  1XYD A;  3H4S E;  5FYX A;  2KDH A;  1Y0V H;  2JYY A;  1KWO C;  1SCV A;  1OVO A;  1A03 A;  5B8I B;  2GVI A;  1PK0 D;  5HKZ A;  1KK8 B;  1WRZ A;  3NSK A;  1ZAC A;  4OV2 A;  1YVL A;  5DAE A;  1KBE A;  3SG3 A;  5DKN A;  1CSO I;  2N1A B;  3E59 A;  2CNP A;  2V1C C;  1V1F A;  2CTN A;  3OL0 A;  2QPT A;  2MLF C;  2LMV A;  3FWC A;  4M2Q A;  1KQM B;  3LK1 A;  4YGA A;  1F70 A;  1SL9 A;  2SGQ I;  4CFQ A;  1OOJ A;  1K9K A;  1IKU A;  3VRN A;  1K8U A;  4QJ3 B;  1R79 A;  1KQM C;  4YBH B;  2JTT A;  4BY5 A;  5DKR A;  1DF0 B;  2B1U A;  4AQJ A;  3KHE A;  3FC3 A;  3GOF A;  2JA1 A;  1BUS A;  1J55 A;  1CMF A;  2WND A;  1YRU B;  2SGP I;  1R0R I;  1JFK A;  2KAX A;  4OVN F;  3MSE B;  2PAS A;  3WHT B;  2I2R E;  4Q04 A;  3VDP A;  2JT3 A;  4BY4 A;  1WDC B;  4L9M A;  2ZRT A;  2M5X A;  1Y1X A;  1GQM A;  2ODD A;  3E2I A;  2Y1M A;  2BUS A;  3AKA A;  4PHK A;  1YX7 A;  2BCB A;  1IRJ A;  1SY9 A;  1K94 A;  1E8A A;  1QLS A;  1TCO B;  4NDD A;  1CLB A;  1DTL A;  1RRO A;  1L7Z A;  1PSB A;  1OZO A;  3OHM B;  4CPV A;  1BU3 A;  4PAL A;  4FQO A;  3CR2 A;  1LR8 A;  5G08 A;  3TDZ A;  1AJ5 A;  2QQE A;  1CT4 I;  2LC5 A;  3F45 A;  3VRR A;  2ROW A;  2D8N A;  4MLW A;  1MF8 B;  3WNX B;  3CGA A;  1C07 A;  2KGR A;  3GK2 A;  5F6T A;  1CB1 A;  5AFP A;  1SW8 A;  4OKH A;  1WLM A;  1N0Y A;  3UEY A;  4P2Y B;  2M1K B;  1B7T Y;  2E30 A;  2KI4 B;  3CTN A;  2E73 A;  2PSR A;  1SL7 A;  5EX0 A;  5HI7 A;  2NCP A;  2OS8 C;  2KMQ A;  3EK4 A;  1M45 A;  2A4J A;  1YUS A;  1EJ3 A;  1GGW A;  2KI4 C;  1OSA A;  1S36 A;  2HET A;  2LVJ A;  2LV7 A;  1MXE A;  1SGR I;  5HLO A;  4HRH A;  1FW4 A;  1KSM A;  4MEW A;  4OR9 B;  1K90 D;  3EVR A;  1F54 A;  1TBQ R;  2KFG A;  1K93 D;  3SGQ I;  2N71 A;  1YU6 C;  1Y6W A;  1Y1U A;  3D0Y B;  2GGM A;  1MR8 A;  2CT9 A;  2ENN A;  1IWQ A;  1KFX S;  1SPY A;  1IJ6 A;  1EL4 A;  2RGI A;  4DRW A;  2ZN8 A;  1M8B A;  4HRG A;  3O2P A;  5FUW A;  4MZJ A;  4PCW A;  3SJS A;  4XJK B;  1TTX A;  3I5G B;  1ALV A;  2F2O A;  1XVJ A;  4YGE B;  3FIA A;  2OVO A;  1NCY A;  1OQP A;  1XFU O;  4XYN A;  1OE9 B;  4F0Z B;  1NIW A;  1PAL A;  2MAZ A;  3I5G C;  4ICB A;  1SCM C;  2F33 A;  3QRX A;  4UXJ A;  1PTR A;  2KMP A;  1FAR A;  1Y1B A;  1W7I B;  3ZNI A;  1XFX O;  3RLZ A;  1D1O A;  1AUI B;  1UHH A;  2KBI A;  2ZNE A;  2JXC A;  2MA2 A;  3KEV A;  4ZCV A;  4UXI A;  1JUO A;  3EVV A;  3FS7 A;  1JBA A;  5KTY A;  3RM1 A;  1QX7 A;  1QTX A;  5JJG A;  1OZS A;  1JF0 A;  1NPQ A;  1BOC A;  1RFH A;  1UP5 A;  4GPL B;  1SRA A;  1UUS A;  2JPT A;  4C0J A;  1G8I A;  2MJW B;  1OYV I;  2KMO A;  2AMI A;  4YRU A;  1L2O B;  3VRP A;  2JTZ A;  1NSH A;  2L5X B;  4I5K A;  1V1I A;  2ELI A;  2M3W A;  2FNF X;  1QX2 A;  1IQ3 A;  2F3C I;  4WQ3 A;  5IBW A;  3DVM A;  3PAT A;  2Q4U A;  2QQC A;  2BE4 A;  3SG5 A;  2OTG C;  4USL A;  4C0L A;  2GGZ A;  2JOJ A;  2BCX A;  4E1R A;  1TIH A;  3UGL A;  4DCK A;  3SG4 A;  1CE3 A;  2L4H A;  1QIV A;  5J3X A;  1YUT A;  1TBR R;  1UVF A;  2BBN A;  3CS1 A;  3CXL A;  1FAQ A;  3SEK C;  1NUB A;  2LP3 A;  5ER4 X;  2KQY A;  2K7O A;  2BKH B;  2K8M B;  1DS2 I;  4FKD A;  2MRD A;  4PHJ A;  1KK7 Y;  1M46 A;  2K7B A;  4PHM A;  5CSF A;  4YGB B;  1IW4 A;  3D10 A;  4QJ4 B;  1IH0 A;  3SG7 A;  1PJU A;  2BL0 C;  4I5L B;  2I7A A;  1EXR A;  4NDC A;  1FYB A;  2JUL A;  1QVI Z;  1TNP A;  3VE5 A;  1SGY I;  4CID A;  1RWY A;  3BOW A;  1TIZ A;  1RTP 1;  4MBE A;  1YVH A;  1U5I A;  1KK8 C;  1S5G Z;  2JNX A;  2K2F A;  2YQP A;  1K2H A;  2K7D A;  3LL8 B;  1H0Z A;  2ZND A;  4GNK B;  5JHW C;  1OMV A;  1TNW A;  1QLK A;  2BCA A;  3O78 A;  3LLE A;  2G2B A;  1PCE A;  1PPF I;  3BYA A;  4A24 A;  1UHI A;  3PDN A;  2ISD A;  4MRY A;  1NWD A;  3PSR A;  1BJF A;  1XA6 A;  2JT8 A;  1S3P A;  2FCE A;  1B1G A;  3CWG A;  2QAC A;  2F3Y A;  3VGO A;  2JWW A;  1NX1 A;  2L8E A;  4GGF C;  2K9H A;  4R1E A;  2G9B A;  3SIA A;  1TGS I;  1VDD A;  1TCF A;  1SGP I;  1W4R A;  2PRU A;  2VRW B;  3VDU A;  1AHR A;  2P6A C;  3M0W A;  2L2E A;  1WDC C;  5FUX A;  1BG1 A;  1X74 A;  2M8U A;  1JC2 A;  2LE9 B;  1W3S A;  2SCP A;  2I94 A;  1G33 A;  1DJX A;  1S26 D;  2Q91 A;  3DF0 A;  1A75 A;  1LIN A;  2BEC A;  2JZI A;  3A8R A;  4ZCU A;  3NSL A;  4MSP A;  2JC2 A;  1MT1 A;  2WCY A;  4FTG A;  2LCP A;  1B7T Z;  4DUQ A;  1ZUZ A;  4PE7 A;  4GAO A;  1AK8 A;  1XBT A;  5JOL A;  4GI3 C;  3OB1 B;  1TNQ A;  1KBF A;  3C1V A;  1CFD A;  2ZN9 A;  3O4Y A;  1EH2 A;  1UUR A;  4C0K A;  1DJG A;  1F71 A;  1IGV A;  3I5I B;  1DVI A;  1TNX A;  4A4C A;  4JCV E;  3CR5 X;  1TN4 A;  3OX5 A;  4MZK A;  2GKR I;  2EGD A;  2KBM A;  1OMR A;  2KNE A;  2EC6 B;  2ZRS A;  1XK4 A;  1TOT A;  2QPO A;  2LUY A;  1PUL A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  1LR9 A;  2WOS A;  1BMO A;  3KPX A;  5D69 A;  1N13 A;  2KAY A;  1CHO I;  5EX3 A;  1XFW O;  3DVJ A;  3SG6 A;  1CGI I;  3D00 A;  1DJI A;  1ZMZ A;  1DJY A;  1ODB A;  3OX6 A;  3OP0 A;  5I2L A;  1G4Y R;  2LAP A;  2WC8 A;  1FI6 A;  2EHB A;  5I2Q A;  1PVA A;  3BQ3 A;  2ORW A;  2J9R A;  2LNK A;  1SGE I;  1K95 A;  1BR4 B;  4NQG A;  1DT7 B;  1ZOT B;  1NP8 A;  5HKW A;  1C7V A;  1F4O A;  3DVE A;  4OVO A;  1NCX A;  1IY6 A;  1DGU A;  3HCM A;  3KY9 A;  1CDL A;  3CR4 X;  2N17 A;  2H61 C;  2ORV A;  2LUC A;  1RK9 A;  1BF5 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  1DMO A;  2O5G A;  4CLN A;  1V1G A;  1J7P A;  3SG2 A;  1RJV A;  3O6B A;  1HPT A;  1AP4 A;  2JW6 A;  2HQW A;  1S1E A;  3HX4 A;  1XFV O;  1REC A;  4YGD B;  3TDU A;  1CKK A;  1AN1 I;  1B8R A;  3SGB I;  1BOD A;  2COL B;  2LAN A;  1JWD A;  1Z7K B;  2AUC A;  4MRX A;  5FUV A;  2WCF A;  1SNL A;  1U5K A;  1YTP A;  2M7N A;  4DS7 A;  2DB6 A;  3GOX A;  1B8C A;  1S6J A;  3PFV A;  2JZM A;  1L2O C;  1DGV A;  1NX2 A;  1HT9 A;  1CMG A;  2FJU B;  1LKJ A;  2CCM A;  1LXF C;  4U8D A;  1XFY O;  2KCX A;  1TRF A;  3TUY B;  1S6C A;  5BPJ A;  3TS5 B;  4WQ2 A;  2L50 A;  2MLE C;  1HJA I;  4ORC B;  3UFF A;  2E6W A;  3OXF A;  1B9A A;  2PVB A;  2HF5 A;  3OB2 B;  4SGB I;  1DJZ A;  3JTD B;  2H2K A;  1CLM A;  1N65 A;  3DD4 A;  1VRK A;  5HQ8 A;  1CLL A;  2M9G A;  3OXL A;  1A29 A;  2WCB A;  1J1E A;  1J7R A;  1EG3 A;  2KSP A;  2KAV A;  4PDZ A;  1F4Q A;  3JTD C;  1IG5 A;  2LMU A;  2LVV A;  4NDB A;  1YUR A;  5AER A;  3PN7 B;  2A20 A;  3UGD A;  1IJ5 A;  3JVT B;  5K89 A;  2JQ6 A;  1SGQ I;  1XX6 A;  2SGD I;  3BUO B;  1CFF A;  3I5H B;  1WRL A;  2V53 A;  4P5O E;  2NXQ A;  1QXP A;  4IL1 A;  2L4I A;  2NCO A;  4N1G A;  2ZFD A;  3JVT C;  4YGC B;  5CCL A;  1YUU A;  3A4U B;  5KSZ A;  2NZ0 A;  1B4C A;  1SR6 B;  1XFZ O;  3SIB A;  1UUC A;  3IQQ A;  3BUW B;  1WRK A;  1LA0 A;  2W0T A;  2B8T A;  2ARP F;  1DS3 I;  1UHN A;  1DJW A;  3BOW B;  3NXA A;  2V1C A;  2KQ6 A;  3PAL A;  1U5I B;  4TNC A;  5HKY A;  2GKT I;  2B0U C;  1IQ5 A;  2K61 A;  3PM8 A;  4A4B A;  3UEJ A;  1QV1 A;  2NU2 I;  5AXI A;  2AAO A;  4ORA B;  3CZT X;  2LLS A;  2WVJ A;  1KFU L;  3BJI A;  1AJ4 A;  1NX3 A;  2F2P A;  2KI6 D;  3K21 A;  4PE4 A;  4DIR A;  5FUY A;  2NU0 I;  1TBO A;  1NX0 A;  2LVI A;  2R2I A;  1DF0 A;  1MUX A;  2VRG A;  2M7L A;  1CM4 A;  1QVI Y;  4GGF A;  1CDP A;  4GFT A;  3KF9 A;  3RU0 A;  1FBV A;  1KSO A;  1S5G Y;  2SGE I;  3NSO A;  4JPZ B;  2WCE A;  3TZ1 A;  5CCM A;  3E3R A;  1K9U A;  4MN0 A;  3GK1 A;  2XRC A;  1JSA A;  3WXA A;  1M63 B;  5I2O A;  1M8C A;  1SGN I;  4HGU A;  2MBX A;  3EKJ A;  1UWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...