2V53A

Crystal structure of a sparc-collagen complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
214
Chain Sequence
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPARC
publication title Structural Basis of Sequence-Specific Collagen Recognition by Sparc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2v53A02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v53A01
1CGJI 1CDPA 2KGBC 3PSRA 2P6BB 1B1GA 3SJSA 1DJZA 1A75B 3CR5X 1CSOI 1PCEA 2LP3A 2KYFA 3KHEA 2G2BA 4MVFA 1YVHA 3HH2C 1IGVA 4YGCB 1U5IB 3GK4X 1YRUB 2I2RE 4SGBI 1RTP1 2WORA 2KQYA 3BQ3A 1OMTA 1HDLA 2WCEA 2NU4I 1TRFA 4UPGA 2TN4A 2WNDA 3TZ1A 1UVFA 1OE9B 3BUXB 1QS7A 1YX7A 3SGBI 2K7CA 1S5GY 3OHMB 3AKAA 1SGQI 1BG1A 2M7NA 2LHLA 2XRCA 1HJAI 1H8BA 2L5XB 3DD4A 1A75A 2I94A 2LVKA 1QVIY 1YUUA 3O78A 3VGOA 4DCKA 4DS7A 2ARPF 1OSAA 1OMRA 1WY9A 1M8CA 1AJ4A 1WDCB 2JRFA 1KMAA 1K9KA 2LLTA 1DJWA 3DVMA 2KGRA 2AAOA 2MHHA 1J1EA 1QLSA 1MF8B 2NU0I 1UUCA 1SKTA 3JTDB 4OV2A 3I5GC 2F2OA 4JPZB 1YVLA 4PHKA 2NU2I 1WLMA 1YUSA 4N1FA 2Y1NA 2M49B 1QV0A 1Z7KB 1YTZC 3SG2A 1DJYA 3FWCA 1BF5A 2OS8B 5PALA 4N1GA 1TBQR 1CT2I 3TUYB 3EVRA 3EKHA 1BODA 1J7OA 4MLWA 5ER4X 2WCBA 3JVTC 1TTXA 4P5OE 2BL0C 5I2OA 2COLB 1QJTA 4XYNA 1NPQA 4CFRA 1F4QA 2OTGB 4ORAB 4GUKA 1E8AA 1OZSA 1S1EA 1TUSA 2I18A 3FWBA 2OPOA 2Q91A 3TDUA 1SBJA 5JOLA 5HKYA 1NUBA 1JSAA 4YI8A 1CNPA 1JFJA 3SEKC 3SGQI 5JHWC 3BUNB 1H4BA 3ZWHA 2SGFI 4A4CA 2M97A 2EGDA 1UWOA 2NZ0A 1GQMA 2BBMA 1PALA 2G9BA 1TIZA 4GGFC 2L98A 1SCMC 1XYDA 5CSNA 1V1FA 3HX4A 4ORCB 1CMGA 1KK7Y 1N0YA 1NP8A 4ZCVA 4MZKA 2FJUB 2JT0A 3RM1A 1RROA 4MZJA 1S5GZ 4CLNA 4Q04A 2WCYA 2PMYA 2KFHA 2LM5A 1EG3A 4M2PA 5CSFA 1XK4C 1KK8B 1S26D 3VROA 2F3ZA 2RGIA 1Y1BA 2M3WA 1CM4A 1QVIZ 1B7TZ 2DOQA 3HCMA 1PVBA 1K9PA 3BUOB 3KPXA 4DIRA 1EG4A 2WC8A 4PHJA 4PE7A 2BUSA 4QJ4B 3NSIA 1L2OB 2EHBA 2LHIA 4QJ3B 3CZTX 4HGUA 4YGAA 1SL7A 5IBWA 1KQMB 5AERA 2Y5IA 2JWWA 1CFPA 2M1KB 1GGZA 2ZNDA 3LLEA 1K94A 2F8PA 4BY5A 1WRKA 1PSRA 1RWYA 2H61A 1FI5A 1DS2I 2E30A 5B8IB 1LR7A 1IY5A 1FW4A 1AVSA 2M8UA 3A8RA 5DAEA 2CTNA 1NWDA 4OVOA 3I5FB 4OKHA 1MQ1A 3TS5C 1PRWA 1UUSA 4FQOA 2K2FA 4R1EA 1QIVA 2FOTA 1DJIA 1S36A 1AK8A 4PE4A 3GK2A 3EVVA 1TCFA 1CM1A 2LUCA 1F55A 3E3RA 3KO0A 1K2HA 1PPFI 1DF0B 1OOJA 2SGEI 1DTLA 2LMUA 5AANA 2LCPA 4MN0A 3SG3A 1G4YR 1AN1I 2BCXA 1DGVA 2L4HA 5JJGA 2BCAA 1RFJA 5FYXA 2JZIA 2KHNA 4NDDA 1F8HA 3FIAA 3BUMB 3EK4A 1XFUO 1JC2A 1IW4A 3SIAA 1PSBA 1UHKA 1NX0A 1TNXA 1AHRA 3SG5A 5AFPA 1CLLA 1K90D 1XFYO 2Q4UA 3F45A 1G33A 2F3CI 1QLKA 2NLNA 3PATA 4MEWA 3ZNIA 2KMRA 3NSLA 4OVNF 2QQDA 1QX2A 1SGDI 1NCZA 1PK0D 1UHNA 1DVIA 1LXFC 1S6IA 2HF5A 2KBIA 1DF0A 2PRUA 3EVUA 2JOJA 5HLVA 4F0ZB 4C0KA 1SGNI 2JZMA 2FCEA 2EC6C 1WRLA 3H4SE 4PHMA 2KNEA 1QXPA 4TNCA 1TN4A 2L2EA 1M39A 2M29A 2D8NA 2LVVA 3KEVA 3QRXA 1RECA 1L7ZA 2LV7A 3SIBA 2GKRI 2I7AA 2ISDA 1OMDA 4AOMA 1HT9A 2L51A 1X02A 1JWDA 1W7JB 3I5HB 2KCXA 4AQIA 4AQJA 2LC5A 1TNQA 2JNXA 1B8RA 1SPYA 2KMQA 1UHJA 5I2QA 1JF0A 3RLZA 1G8IA 4M2QA 2SGPI 2JQ6A 1H0ZA 1GJYA 4GPLB 5AEQA 1F71A 2LNKA 2JYYA 1UP5A 1QX7A 1UURA 2LVIA 5D7FA 1M45A 1MUXA 1R6PA 2LP2A 3I5IB 2NXQA 2O60A 2KAVA 4YGBB 1C7WA 3PFVA 4A4BA 4CPVA 4FTGA 1IQ5A 3NXAA 2BCBA 1IJ6A 2ERWA 2KMPA 1Y1AA 3VRQA 1CT0I 1B8LA 1DJGA 1QIWA 2LLUA 3A4UB 2MLFC 1WDCC 3VRRA 2VRGA 1KWOB 1SYMA 2MBXA 1NIWA 1KQVA 2MLEC 2MAZA 4MBEA 4OCIA 1IH0A 1SL9A 2M0RA 3EK8A 2QQCA 2KSPA 3SG7A 3VRPA 1CB1A 1QTXA 1SR6B 1KFUS 1XA5A 2MA2A 3JTDC 5CPVA 3TDIA 1EXRA 3GOFA 1MXLC 2KI4B 2F33A 1K93D 4U8DA 2NU1I 3OVOA 1EH2A 1CFDA 1TIHA 1KSOA 3MSEB 2OS8C 2OVOA 1Y1UA 3TUYC 1N65A 1OVOA 1XO5A 4YI9A 4CFQA 3WHUB 2L50A 1FF1A 2GKVA 2CXJA 2QPTA 1ALWA 5KTYA 1Y1CA 1CLBA 2ZRSA 2GV5A 1TCOB 2OTGC 4I5LB 2KFFA 3LK1A 3LL8B 2O5GA 3NSKA 4MRXA 1M31A 1R0RI 1Y6WA 1XK4A 2LLSA 1SGYI 4GFTA 3AAKA 4YGEB 3DVEA 5KSZA 2F3YA 1MXEA 1ZFSA 1YRTB 4OR9B 3PN7B 1EL4A 3NSOA 1SMGA 1EJ3A 4PHNA 4M2OA 1C07A 1K95A 2SCPA 1KCYA 1SGPI 4HREE 3D0YB 5DKRA 4WRIA 2JPTA 2ZNEA 1BR1B 1NX1A 3O4YA 1Q80A 4N5XA 1KSMA 1IWQA 1SCVA 2JT3A 5F6TA 2AMIA 2HPSA 1NX2A 1W7IB 2KFGA 2CCMA 4GNKB 4MZLA 1TOPA 1MR8A 1YX8A 4HRGA 2GKTI 1OMVA 1DJHA 4PE1A 2GGMA 1KK8C 2PSRA 3OX5A 2P6AC 3B4VC 2H61C 5HYDA 2KYCA 1SL8A 2LUXA 2FCDA 2K7BA 1TURA 1TNPA 1CGII 3D0YA 4I5JA 2JXCA 1L2OC 3VRNA 1QASA 3IQQA 1S6JA 2E6WA 3CR2A 5HKWA 1RK9A 5I8NA 1KFXS 1FPWA 1A4PA 1QATA 1V1GA 2NCPA 1N13A 2KDHA 3IQOA 4IL1A 1CTRA 1TBRR 4BY4A 2K2AA 1KQMC 2ZFDA 1KK7Z 1PJUA 1F70A 1F54A 1ALVA 1YURA 1TGSI 3CS1A 1IJ5A 1LVCD 2SASA 1DT7B 3BUWB 2JT8A 1CHOI 1MWNA 2KAXA 2K0JA 1YU6C 4HSZA 1HPTA 1SY9A 2HETA 2LAPA 4D1EA 2R2IA 4QJ5B 1KFUL 1CDMA 2L0PA 1S6CA 3I5FC 2K7OA 4PCWA 1F4OA 5KU1A 3C1VA 1PVAA 2JTTA 5ER5A 3TDZA 2ZN8A 1OZOA 2A4JA 1J7QA 3I5GB 1SK6D 2JU0A 2M1UA 1JF2A 1BR4B 1UHIA 4JQ0D 1BLQA 5CSIA 2K61A 2JXLA 1D1OA 2SGDI 1WRZA 5GQQC 2BECA 1TNWA 2KOTA 2PALA 1J7RA 4MSPA 4NDBA 2Y4QA 4XJKB 1IQ3A 4WQ3A 1A03A 1K96A 2KI6D 2BKHB 3JVTB 4WQ2A 4PE0A 1ZACA 2BL0B 1DS3I 3D10A 1AUIB 4USLA 1M63B 1A29A 4YGDB 4GI3C 2JULA 3K21A 1CFFA 4GBAA 1IKUA 3PLFB 4GGNA 1CFCA 3WNXB 1DJXA 2MJWB 1SGEI 3WHTB 1BU3A 2KAYA 1RJVA 1B7TY 1JFKA 3IF7A 2N71A 1U5IA 1BOCA 1ZOTB 1SNLA 4GAOA 5TNCA 1CDNA 1MHOA 2BKIB 1CT4I 2CBLA 4XJKA 2KMOA 4PDZA 2KBMA 1SCMB 1FI6A 2LMVA 1BUSA 1K8UA 3LCPC 1LR8A 3FS7A 1OMUA 4L9MA 2L4IA 1WLZA 4DUQA 1BT6A 1A2XA 3ICBA 1K9UA 3M0WA 3I5HC 5K89A 4NQGA 1CMFA 1J55A 1ODBA 4MRYA 2V53A 2IS9A 1KFXL 1Y0VH 2ZRTA 1XFXO 1B8CA 2AUCA 2BE4A 2K7DA 1FYBA 1CDLA 4P2YB 5AXIA 4HRHA 2CNPA 1UVGA 2KI6C 1AP4A 4GGFA 1B4CA 4ORBB 1CLMA 3CLNA 4ETOA 2ZN9A 1CKKA 1LINA 1XFWO 3I5IC 1VRKA 2H2KA 5D69A 3O6BA 2LE9B 1XFZO 1B9AA 1C7VA 1SGRI 1OQPA 1JUOA 2HQWA 2MRDA 3AAJA 3AKBA 3DF0B 1NSHA 2M7LA 3GK1A 1NCXA 3BYAA 2M5XA 1B47A 1NYAA 1KWOC 2Y1MA 4ZCUA 1N2DA 3TS5B 3WXAA 1LA0A 1QV1A 1QX5B 2WOSA 2N52A 4DRWA 1SR6C 5BPJA 2LVJA 1XFVO 1AJ5A 4JWQA 2BE6A 2PASA 1YTPA 4C0JA 2JC2A 2KI4C 3O2PA 4I5NB 1MT1A 1M8BA 2LEOA 1NCYA 2K8MB 1R2UA 5HLOA 1J7PA 2F2PA 4E68A 5CSJA 2HQ8A 3EK7A 3BOWB 5DKNA 4YRUA 1LR9A 2LANA 1BMOA 3DF0A 1ZMZA 3PALA 2JXDA 2NU3I 5I2LA 1FBVA 1DMOA 1M46A 1BJFA 1DGUA 2NCOA 1NX3A 3CGAA 3TJQA 3PM8A 1IY6A 2KQ6A 4NDCA 1LKJA 2JNFA 1JBAA 3BXKA 2WCFA 1YR5A 2CT9A 2ZKMX 1ZUZA 4I5KA 1SW8A 2BBNA 4ICBA 1J1DA 3OB1B 2B1UA 2B0UC 5G08A 1PULA 2N17A 2JTZA 3EKJA 3PN7C 1IG5A 1SRAA 3CR4X 3KF9A 2GGZA 5J3XA 2LMTA 3QTLD 3CTNA 3SG4A 1Y1XA 1HQVA 3BOWA 4C0LA 4PALA 1XVJA 4YBHB 2SGQI 3OP0A 2PVBA 5DKQA 3LK0A 3DVKA 2EC6B 1GGWA 1CE3A 1IRJA 2M9GA 3CWGA 5HKZA 1OYVI 3OB2B 1S3PA 3DVJA 3SG6A 1UHHA 2QACA 4CIDA 1YUTA 1LA3A 3OX6A
chains in the Genus database with same CATH superfamily
3SJSA 2K60A 1CSOI 1PCEA 3BJHA 1IGVA 4YGCB 4SGBI 1YRUB 2E5RA 2NU4I 1TRFA 2L7XA 3TZ1A 2CWGA 1UVFA 2L8EA 3BUXB 3SGBI 1BG1A 2I94A 1QVIY 2ARPF 1WTJA 1OMRA 1WDCB 2LLTA 5E3PA 1DJWA 2YUUA 1ULMA 1SKTA 3JTDB 2NU2I 4N1FA 4FQTA 1DJYA 2OS8B 1TBQR 3EVRA 3EKHA 5ER4X 2WCBA 1WKXA 5I2OA 1F4QA 1Q9BA 1S1EA 1WGTA 1TUSA 3FWBA 1JSAA 1CNPA 3MEKA 3SEKC 3ZWHA 4GGFC 1XYDA 1KK7Y 3D78A 1RROA 3PDNA 2KFHA 2LM5A 3VROA 1B7TZ 3BUOB 3KPXA 1EG4A 2BUSA 4QJ4B 4QJ3B 4YGAA 1SL7A 1XFRA 2Y5IA 2JWWA 2M1KB 1GGZA 3LLEA 1RWYA 1FI5A 2E30A 1FW4A 1AVSA 1Z2IA 2QPOA 4FKDA 1F55A 5I94A 1PPFI 2LCPA 4MN0A 2BCXA 1DGVA 5JJGA 5EX0A 3UGIA 4NDDA 2GVIA 1JC2A 1PSBA 1TNXA 1CLLA 1K90D 1OOHA 3F45A 2NLNA 1UHNA 1S6IA 2PRUA 3EVUA 3N7HA 1VDDA 1WRLA 2KPHA 1U5KA 3CZ2A 3GOXA 1ORGA 3SIBA 2NU0I 2GKRI 2ISDA 1OMDA 1HT9A 2L51A 2KCXA 2KMQA 1B8RA 5I2QA 1G8IA 4M2QA 4GPLB 1QX7A 1UURA 3FE8A 5D7FA 2PYQA 4FTGA 3NXAA 2BCBA 1IJ6A 2LLUA 3SS5A 1SYMA 2MBXA 1NIWA 4MBEA 2KSPA 2MA2A 3TDIA 1XA5A 1MXLC 2KI4B 2F33A 1XA6A 1EH2A 3E2IA 1N65A 1XO5A 4CFQA 3UOEA 2ZRSA 3NSKA 3LL8B 1M31A 1SGYI 4YGEB 5KSZA 1MXEA 1ZFSA 3D75A 1PTRA 3R1PA 1C07A 3BFAA 2JPTA 1Q80A 1KSMA 1SCVA 4MZLA 1TOPA 1DJHA 4PE1A 1KK8C 2P6AC 2FCDA 2K7BA 1CGII 3D0YA 1L2OC 5HKWA 1FPWA 3IQOA 1CTRA 2K2AA 1KQMC 2ZFDA 1F70A 1TGSI 3CS1A 1DT7B 2FJYA 2JT8A 1YU6C 1KFUL 4PCWA 4UXJA 2A4JA 1SK6D 4JQ0D 5CSIA 2J87A 2SGDI 1D1OA 1WRZA 4JKTA 4MSPA 1K96A 2KI6D 3JVTB 1ZACA 4USLA 3EG5B 4GBAA 2FNFX 1IKUA 3PLFB 3WNXB 1DJXA 2MJWB 1BU3A 1RJVA 1JFKA 2N71A 1BOCA 1ZOTB 4GAOA 5TNCA 1CDNA 2BKIB 3FE9A 1ULNA 2KMOA 4PDZA 1SCMB 1K8UA 3LCPC 4UXHA 3CDNA 1Y8FA 2L4IA 4B6DA 1OW4A 2V1CA 4DUQA 1BT6A 1K9UA 3I5HC 4NQGA 2LUYA 1J55A 3BFHA 2AUCA 3OXFA 2CNPA 4ORBB 2GTEA 3CLNA 1CKKA 2H2KA 3O6BA 1SGRI 3D77A 1NCXA 3RZSA 3TS5B 1KBFA 1LA0A 2WOSA 2LVJA 4I5NB 3EK7A 1LR9A 5DICA 1BMOA 3DYEA 2UVOA 2KLEA 2WVJA 2JXDA 3CABA 1M46A 1S20A 1ZUZA 4I5KA 3R72A 1FAQA 4A24A 5J3XA 2GGZA 3CTNA 4C0LA 4PALA 1XVJA 2EC6B 1GGWA 1UHAA 1OYVI 5HL1A 3QRXA 4YI9A 1CGJI 1CDPA 2P6BB 2CJSC 3CR5X 2LP3A 2G2BA 1U5IB 3TOAA 2I2RE 3Q8IA 1QS7A 1S5GY 3AKAA 4WP4A 1H8BA 2L5XB 3DD4A 1A75A 1YUUA 1OSAA 1NXUA 1WY9A 1M8CA 1AJ4A 2F2OA 4PHKA 1YTZC 3FWCA 1BF5A 3B88A 1MJ9A 4INXA 1BODA 5J8CA 1TTXA 2BL0C 2COLB 2V1CC 2JW6A 3R5DA 2WGCA 3SGQI 3B7AA 1JFJA 3BUNB 1H4BA 2SGFI 1PALA 1N0YA 3D00A 4MZKA 2JT0A 4CLNA 4Q04A 2WCYA 5CSFA 1XK4C 2F3ZA 1Y1BA 1QVIZ 2DOQA 3HCMA 3NHTA 1OOIX 4JD9A 1OOGA 2N1AB 5IBWA 1CFPA 4BY5A 1WRKA 1PSRA 3OGNA 2H61A 3TO6A 1DS2I 3A8RA 1MJAA 5FUVA 4OKHA 1UUSA 2FOTA 1DJIA 3GK2A 3EVVA 2LUCA 3KO0A 1DF0B 3O4XA 2WCKA 1DTLA 1AN1I 1G4YR 2ENZA 2L4HA 2KHNA 3FIAA 3SG5A 5AFPA 2Q4UA 1XFYO 3CXLA 2F3CI 1QLKA 4MEWA 4YBHB 3CZ0A 2A20A 2FCEA 3H4SE 1QXPA 1T14A 2OZUA 2LVVA 3L47A 4AOMA 2RIJA 4AQIA 3DZTA 4AQJA 1Z2CB 2JNXA 1SPYA 1UHJA 3DY9A 2SGPI 1F71A 1UP5A 2LVIA 1MUXA 1R6PA 2QQ0A 1TWOA 2QEVA 3KY9A 2KMPA 1B8LA 2MLEC 3SG7A 1CB1A 1QTXA 1KFUS 3MSEB 3R1VA 3TUYC 3WHUB 1FF1A 1TUJA 2QPTA 5KTYA 1TCOB 2OTGC 4MRXA 2O5GA 1R0RI 3R1OA 1YRTB 4OR9B 3NSOA 2JA1A 1SGPI 2ZNEA 1NX1A 1IWQA 2JT3A 3DXLA 2ELIA 3CZ1A 2HPSA 1MR8A 3BFBA 2H61C 2KYCA 3CR2A 2E6WA 1RK9A 1A4PA 1QATA 2KDHA 1ALVA 1LVCD 4HSZA 1HPTA 1SY9A 2HETA 2YQPA 2R2IA 3I5FC 1S6CA 2K7OA 1P9GA 2ZN8A 1OZOA 2WCMA 5GQQC 2BECA 2KOTA 2PALA 1J7RA 1IQ3A 2Y4QA 4WQ3A 2BKHB 4GI3C 1CFCA 2KAYA 1B7TY 3IF7A 1U5IA 3VE5A 1SNLA 2K9HA 2CBLA 4XJKA 3S0FA 3UFFA 4L9MA 2WCLA 1A2XA 3ICBA 5K89A 2X52A 3SS3A 1P28A 3UEJA 4MRYA 3TO7A 1Y0VH 2ZRTA 1XFXO 2KLDA 1PTQA 1FYBA 1CDLA 2KI6C 1AP4A 1KBEA 3I5IC 5EX3A 1B9AA 1C7VA 1OQPA 1JUOA 2MRDA 3AAJA 3DF0B 2M7LA 3BYAA 3FSXA 1NYAA 1KWOC 2Y1MA 1QX5B 4DRWA 1SR6C 5BPJA 1AJ5A 3VB1A 2LEOA 1NCYA 1J7PA 5CSJA 5I2LA 1FBVA 1DMOA 1BJFA 2NCOA 1NX3A 2UZ3A 3BXKA 2WCFA 2CT9A 2ZKMX 2B0UC 2B1UA 5G08A 3EKJA 3PN7C 2QEOA 2BNXA 1Y1XA 3BOWA 3OP0A 5DKQA 4CIDA 3OX6A 2KGBC 3PSRA 1DJZA 4MVFA 3GK4X 1K7TA 5CCMA 2KQYA 3BQ3A 1OMTA 1HDLA 3S0EA 4INWA 2ORVA 1YX7A 2K7CA 3S0DA 2LHLA 3OXGA 4DNCA 1DC1A 4DS7A 2ROWA 1K9KA 5EL2A 3DVMA 2KGRA 4UXIA 1J1EA 1MF8B 4OV2A 3I5GC 4JPZB 2Y1NA 5FI7A 1Z7KB 2WC6A 3SG2A 5PALA 1HEVA 4MLWA 4AMLA 3FE6A 4P5OE 1TUZA 4XYNA 1NPQA 4CFRA 4ORAB 1E8AA 3OL0A 2OPOA 2Q91A 3R5AA 4YI8A 2EGDA 2NZ0A 1GQMA 2L98A 1V1FA 4ORCB 4ZCVA 5HI7A 2FJUB 1S5GZ 2PMYA 7WGAA 1KK8B 1S26D 2RGIA 2E73A 1PVBA 1K9PA 4DIRA 4PHJA 2WC8A 4PE7A 1L2OB 2LHIA 4HGUA 1KQMB 5AERA 2ZNDA 1K94A 2LB7A 1IY5A 3NGVA 1V1HA 5DAEA 2CTNA 2L2CA 2DKVA 1MQ1A 1PRWA 2CWFA 4R1EA 1CM1A 3OBVA 3E3RA 3L4LA 1OOJA 2LMUA 2WC5A 3K1EA 1IIOA 1WGCA 2X3TA 1XFUO 1NX0A 1AHRA 3SS4A 3RU0A 3UGDA 1DELA 1G33A 2KMRA 2QQDA 3NSLA 1SGDI 1PK0D 2KBIA 3IVTA 2JOJA 5HLVA 4F0ZB 4C0KA 1SGNI 2JZMA 3OXLA 2WCHA 4TNCA 2L2EA 1M39A 2M29A 2D8NA 3KEVA 2LV7A 2I7AA 1X02A 2QQEA 1W7JB 3I5HB 1TNQA 3VDPA 4MPIA 3RLZA 2LNKA 1M45A 2LP2A 2NXQA 2O60A 2KAVA 3VDUA 4YGBB 1IQ5A 3UNWA 1Y1AA 3VRQA 1CT0I 1DJGA 3S0GA 1QIWA 3A4UB 1WDCC 2VRGA 3UO9A 1KQVA 4OCIA 1SL9A 2M0RA 2QQCA 3VRPA 3JTDC 1EXRA 3GOFA 4U8DA 3OVOA 1CFDA 2OS8C 2WCJA 5FUYA 4F7FA 4E1PA 2L50A 2CXJA 1ALWA 1Y1CA 1CLBA 4I5LB 3LK1A 1SSEB 1Y6WA 1ULKA 4GFTA 3AAKA 3B86A 1EL4A 1SMGA 4PHNA 4M2OA 1K95A 2SCPA 4HREE 3D0YB 5DKRA 1BR1B 5FUWA 1Z4HA 5F6TA 2KFGA 4HRGA 2GIVA 1OMVA 2GGMA 2PSRA 2QEHA 5HYDA 1SL8A 2LUXA 1TURA 1TNPA 1QASA 1N13A 2NCPA 3B87A 4IL1A 1W9ZA 1KK7Z 1PJUA 1F54A 1YURA 1IJ5A 2OU2A 3BUWB 1CHOI 2KAXA 1W3SA 2RC4A 4QJ5B 2L0PA 1F4OA 1PVAA 2M1UA 2K61A 2W0TA 1K7UA 4NDBA 1X74A 1A03A 4WQ2A 2BL0B 1DS3I 3D10A 1AUIB 1M63B 2JULA 3K21A 1CFFA 5E3RA 4GGNA 1XBTA 1V1IA 1CT4I 2KBMA 1LR8A 3FS7A 3M0WA 3UGLA 2V53A 1KFXL 1B8CA 5AXIA 1UVGA 4ETOA 2ZN9A 1LINA 1XFWO 1VRKA 1XFZO 2HQWA 5FUXA 3AKBA 1NSHA 3GK1A 2M5XA 1B47A 4ZCUA 1FARA 2PQLA 1XFVO 2BE6A 1YTPA 4C0JA 2JC2A 2KI4C 1M8BA 3S0BA 4YRUA 5DKNA 3PJIA 1ZMZA 3PALA 1DGUA 3CGAA 1IY6A 4NDCA 1C3YA 2JNFA 5HQ8A 1YR5A 5CCLA 2BBNA 2L5YA 1J1DA 2N17A 1SRAA 2VRWB 3KF9A 3QTLD 3SG4A 1HQVA 2PVBA 1P9ZA 1IRJA 3BJIA 3CWGA 5HKZA 3OB2B 3DVJA 1UHHA 1YUTA 3EK4A 1LA3A 3TOBA 1B1GA 1A75B 2KYFA 3KHEA 3HH2C 1YVHA 1RTP1 2WORA 2WCEA 4UPGA 2TN4A 2WNDA 1OE9B 2ORWA 3TO9A 3OHMB 1SGQI 2M7NA 1HJAI 2LVKA 3O78A 3VGOA 4DCKA 1KMAA 4KYNA 2JRFA 1R79A 1GM0A 2AAOA 2MHHA 1QLSA 1UUCA 1YVLA 3UEYA 1WLMA 1YUSA 3R5BA 2M49B 1QV0A 4N1GA 1CT2I 3TUYB 1J7OA 2BAPA 1OOFA 3JVTC 1QJTA 2OTGB 4GUKA 2QEBA 1W4RA 1OZSA 2I18A 3TDUA 1SBJA 5JOLA 5HKYA 1NUBA 5JHWC 4A4CA 2M97A 1UWOA 2BBMA 2G9BA 1TIZA 2YGUA 1SCMC 5CSNA 3HX4A 1CMGA 3R5CA 1NP8A 3RM1A 4MZJA 1K7VA 5FI2A 1EG3A 4M2PA 4OZDA 4IJ7A 2M3WA 1CM4A 2P70A 4JCVE 3NSIA 2EHBA 3CZTX 1TBOA 2F8PA 5B8IB 1LR7A 2M8UA 1NWDA 4OVOA 3I5FB 3TS5C 4FQOA 2K2FA 1QIVA 1S36A 1AK8A 4PE4A 1TCFA 1K2HA 5AANA 3SG3A 2BCAA 1RFJA 5FYXA 2JZIA 5FI6A 1F8HA 3BUMB 1IW4A 3SIAA 1UHKA 3ZNIA 3PATA 2ERBA 4OVNF 1QX2A 3FC3A 1NCZA 2HF5A 2DIPA 1DVIA 1LXFC 1DF0A 2EC6C 4PHMA 2KNEA 1TN4A 2XRCA 2J9RA 1RECA 1L7ZA 1JWDA 1DEKA 2LC5A 1JF0A 2JQ6A 1H0ZA 1GJYA 5AEQA 2JYYA 9WGAA 3I5IB 1C7WA 3PFVA 4A4BA 4CPVA 3QMEA 2ERWA 3E59A 4E1RA 2MLFC 3VRRA 1KWOB 2MAZA 1IH0A 3EK8A 1SR6B 5CPVA 1K93D 2NU1I 1TIHA 2ODDA 1KSOA 2Y0MA 2OVOA 3CYZA 1Y1UA 1OVOA 2GKVA 2GV5A 1FY7A 2DB6A 2SGEI 2KFFA 2P71A 1XK4A 2LLSA 3V2LA 3DVEA 2F3YA 1RFHA 1TOTA 3PN7B 1EJ3A 1KCYA 2QDIA 4WRIA 3O4YA 4N5XA 2AMIA 1NX2A 1W7IB 2CCMA 4GNKB 3QAHA 1YX8A 2GKTI 3QWPA 3OX5A 3B4VC 1C3ZA 3NHIA 4I5JA 2JXCA 3VRNA 3IQQA 1S6JA 5I8NA 1KFXS 1QWVA 1V1GA 1TBRR 3D74A 4BY4A 3D76A 2SASA 1MWNA 2K0JA 2LAPA 4D1EA 1CDMA 5KU1A 3C1VA 2JTTA 5ER5A 3TDZA 2H8VA 2CWHA 1J7QA 3I5GB 2JU0A 1JF2A 1BR4B 1UHIA 1BLQA 2JXLA 1TNWA 1XX6A 5J8FA 4XJKB 4PE0A 4YGDB 1A29A 5D3OA 1SGEI 3WHTB 1TBNA 3PM2A 1MHOA 1FI6A 2LMVA 1BUSA 1OMUA 1WLZA 2B8TA 1CMFA 1MJBA 5E3QA 1ODBA 2IS9A 2BE4A 2K7DA 4P2YB 4HRHA 2OD1A 4GGFA 1LS8A 1B4CA 1CLMA 1X4SA 5D69A 2LE9B 2JPOA 1DQEA 1N2DA 3WXAA 1QV1A 2N52A 4JWQA 2PASA 3FSYA 1MT1A 3O2PA 2K8MB 1R2UA 5HLOA 2F2PA 4E68A 2HQ8A 3BOWB 2LANA 3DF0A 4PT1A 3S0AA 2NU3I 3TJQA 3PM8A 2KQ6A 1LKJA 1JBAA 1SW8A 4ICBA 3OB1B 2PQ8A 1PULA 2JTZA 1IG5A 3L4AA 3CR4X 2LMTA 2SGQI 3LK0A 3DVKA 1CE3A 2ENNA 2M9GA 3B6XA 3D73A 1S3PA 3SG6A 2QACA
chains in the Genus database with same CATH topology
1CGJI 1CDPA 2KGBC 3PSRA 2P6BB 1B1GA 3SJSA 1DJZA 2CJSC 1A75B 3CR5X 1CSOI 1PCEA 2LP3A 2KYFA 3KHEA 2G2BA 4MVFA 1YVHA 3HH2C 1IGVA 4YGCB 1U5IB 3GK4X 1YRUB 2I2RE 4SGBI 1RTP1 5CCMA 2WORA 2KQYA 3BQ3A 1OMTA 2E5RA 1HDLA 2WCEA 2NU4I 1TRFA 2L7XA 4UPGA 2TN4A 2WNDA 3TZ1A 1UVFA 1OE9B 2L8EA 2ORWA 3BUXB 1QS7A 1YX7A 2ORVA 3SGBI 2K7CA 1S5GY 3OHMB 3AKAA 1SGQI 1BG1A 2M7NA 2LHLA 3OXGA 2XRCA 1HJAI 1H8BA 2L5XB 3DD4A 1A75A 2I94A 2LVKA 1QVIY 1YUUA 3O78A 3VGOA 4DCKA 4DS7A 2ARPF 1OSAA 1OMRA 1WY9A 1M8CA 1AJ4A 1WDCB 2JRFA 1R79A 2ROWA 1K9KA 1KMAA 2LLTA 1DJWA 3DVMA 2KGRA 4UXIA 2YUUA 2AAOA 2MHHA 1J1EA 1QLSA 1MF8B 2NU0I 1UUCA 1SKTA 3JTDB 4OV2A 3I5GC 2F2OA 4JPZB 1YVLA 4PHKA 2NU2I 3UEYA 1WLMA 1YUSA 4N1FA 2Y1NA 2M49B 1QV0A 1Z7KB 1YTZC 3SG2A 1DJYA 3FWCA 1BF5A 2OS8B 5PALA 4N1GA 1TBQR 1CT2I 3TUYB 3EVRA 3EKHA 1BODA 1J7OA 4MLWA 5ER4X 2WCBA 3JVTC 1TTXA 4P5OE 2BL0C 5I2OA 2COLB 1QJTA 2V1CC 4XYNA 1NPQA 4CFRA 1F4QA 2JW6A 2OTGB 4ORAB 4GUKA 1E8AA 1W4RA 1OZSA 3OL0A 1S1EA 1TUSA 2I18A 3FWBA 2OPOA 2Q91A 3TDUA 1SBJA 5JOLA 5HKYA 1NUBA 1JSAA 4YI8A 1CNPA 1JFJA 3MEKA 3SEKC 3SGQI 5JHWC 3BUNB 1H4BA 3ZWHA 2SGFI 4A4CA 2M97A 2EGDA 1UWOA 2NZ0A 1GQMA 2BBMA 1PALA 2G9BA 1TIZA 4GGFC 2L98A 1SCMC 1XYDA 5CSNA 1V1FA 3HX4A 4ORCB 1CMGA 1KK7Y 1N0YA 1NP8A 3D00A 4ZCVA 4MZKA 5HI7A 2FJUB 2JT0A 3RM1A 1RROA 4MZJA 1S5GZ 4CLNA 4Q04A 3PDNA 2WCYA 2PMYA 2KFHA 2LM5A 1EG3A 4M2PA 5CSFA 1XK4C 1KK8B 1S26D 3VROA 2F3ZA 2RGIA 1Y1BA 2M3WA 1CM4A 1QVIZ 2E73A 1B7TZ 2DOQA 4JCVE 3HCMA 1PVBA 1K9PA 3BUOB 3KPXA 4DIRA 1EG4A 2WC8A 4PHJA 4PE7A 2BUSA 4QJ4B 3NSIA 1L2OB 2EHBA 2LHIA 4QJ3B 3CZTX 4HGUA 4YGAA 2N1AB 1SL7A 5IBWA 1TBOA 1KQMB 5AERA 2Y5IA 2JWWA 1CFPA 2M1KB 1GGZA 2ZNDA 3LLEA 1K94A 2F8PA 4BY5A 1WRKA 1PSRA 1RWYA 2H61A 1FI5A 1DS2I 2E30A 5B8IB 1LR7A 1IY5A 1FW4A 1AVSA 2M8UA 1V1HA 3A8RA 5DAEA 2CTNA 1NWDA 4OVOA 5FUVA 2QPOA 3I5FB 4OKHA 1MQ1A 3TS5C 1PRWA 1UUSA 4FQOA 2K2FA 4FKDA 4R1EA 1QIVA 2FOTA 1DJIA 1S36A 1AK8A 4PE4A 3GK2A 3EVVA 1TCFA 1CM1A 2LUCA 1F55A 3E3RA 3KO0A 1K2HA 1PPFI 1DF0B 1OOJA 2SGEI 1DTLA 2LMUA 5AANA 2LCPA 4MN0A 3SG3A 1G4YR 1AN1I 2ENZA 2BCXA 1DGVA 2L4HA 5JJGA 2BCAA 1RFJA 5FYXA 2JZIA 2KHNA 5EX0A 4NDDA 1F8HA 3FIAA 2GVIA 3BUMB 3EK4A 1XFUO 1JC2A 3UGIA 1IW4A 3SIAA 1PSBA 1UHKA 1NX0A 1TNXA 1AHRA 3SG5A 3RU0A 5AFPA 1CLLA 3UGDA 1K90D 1XFYO 2Q4UA 3F45A 1G33A 3CXLA 2F3CI 1QLKA 2NLNA 3PATA 4MEWA 3ZNIA 2KMRA 3NSLA 4OVNF 2QQDA 1QX2A 1SGDI 3FC3A 1NCZA 1PK0D 1UHNA 1DVIA 1LXFC 1S6IA 2HF5A 2KBIA 1DF0A 2PRUA 3EVUA 1VDDA 2JOJA 5HLVA 4F0ZB 4C0KA 1SGNI 2A20A 2JZMA 2FCEA 2EC6C 3OXLA 1WRLA 3H4SE 4PHMA 1U5KA 3GOXA 2KNEA 1QXPA 4TNCA 1TN4A 2L2EA 1M39A 2M29A 2D8NA 2LVVA 3KEVA 3QRXA 1RECA 1L7ZA 2LV7A 3SIBA 2GKRI 2I7AA 2ISDA 1OMDA 4AOMA 1HT9A 2L51A 1X02A 1JWDA 2QQEA 1W7JB 3I5HB 2KCXA 4AQIA 4AQJA 2LC5A 1TNQA 2JNXA 1B8RA 1SPYA 2KMQA 3VDPA 1UHJA 5I2QA 1JF0A 3RLZA 1G8IA 4M2QA 2SGPI 2JQ6A 1H0ZA 1GJYA 4GPLB 5AEQA 1F71A 2LNKA 2JYYA 1UP5A 1QX7A 1UURA 2LVIA 5D7FA 1M45A 1MUXA 1R6PA 2LP2A 3I5IB 2NXQA 2O60A 2KAVA 3VDUA 4YGBB 1C7WA 3PFVA 4A4BA 4CPVA 4FTGA 2QQ0A 1IQ5A 3NXAA 2BCBA 1IJ6A 2ERWA 3KY9A 2KMPA 1Y1AA 3VRQA 1CT0I 1B8LA 1DJGA 1QIWA 3E59A 4E1RA 2LLUA 3A4UB 2MLFC 1WDCC 3VRRA 2VRGA 1KWOB 1SYMA 2MBXA 1NIWA 1KQVA 2MLEC 2MAZA 4MBEA 4OCIA 1IH0A 1SL9A 2M0RA 3EK8A 2QQCA 2KSPA 3SG7A 3VRPA 1CB1A 1QTXA 1SR6B 1KFUS 1XA5A 2MA2A 3JTDC 5CPVA 3TDIA 1EXRA 3GOFA 1MXLC 2KI4B 2F33A 1K93D 1XA6A 4U8DA 2NU1I 3OVOA 1EH2A 1CFDA 1TIHA 1KSOA 2ODDA 3E2IA 3MSEB 2OS8C 2OVOA 1Y1UA 3TUYC 5FUYA 1N65A 1OVOA 1XO5A 4YI9A 4E1PA 4CFQA 3WHUB 2L50A 1FF1A 2GKVA 2CXJA 2QPTA 1ALWA 5KTYA 1Y1CA 1CLBA 2ZRSA 2GV5A 1TCOB 2OTGC 4I5LB 2KFFA 3LK1A 3LL8B 2O5GA 3NSKA 4MRXA 1M31A 1R0RI 1Y6WA 1XK4A 2LLSA 1SGYI 4GFTA 3AAKA 4YGEB 3DVEA 5KSZA 2F3YA 1RFHA 1MXEA 1TOTA 1ZFSA 1YRTB 4OR9B 3PN7B 1PTRA 1EL4A 3NSOA 1SMGA 1EJ3A 4PHNA 4M2OA 1C07A 2DB6A 1K95A 2JA1A 2SCPA 1KCYA 1SGPI 4HREE 3D0YB 5DKRA 4WRIA 2JPTA 2ZNEA 1BR1B 1NX1A 3O4YA 1Q80A 4N5XA 1KSMA 5FUWA 1IWQA 1SCVA 2JT3A 2ELIA 5F6TA 2AMIA 2HPSA 1NX2A 1W7IB 2KFGA 2CCMA 4GNKB 4MZLA 1TOPA 1MR8A 1YX8A 4HRGA 2GKTI 1OMVA 1DJHA 4PE1A 2GGMA 1KK8C 2PSRA 3OX5A 3QWPA 2P6AC 3B4VC 2H61C 5HYDA 2KYCA 1SL8A 2LUXA 2FCDA 2K7BA 1TURA 1TNPA 1CGII 3D0YA 4I5JA 2JXCA 1L2OC 3VRNA 1QASA 3IQQA 1S6JA 2E6WA 3CR2A 5HKWA 1RK9A 5I8NA 1KFXS 1FPWA 1A4PA 1QATA 1V1GA 2NCPA 1N13A 2KDHA 3IQOA 4IL1A 1CTRA 1TBRR 4BY4A 2K2AA 1KQMC 2ZFDA 1KK7Z 1PJUA 1F70A 1F54A 1ALVA 1YURA 1TGSI 3CS1A 1IJ5A 1LVCD 2SASA 1DT7B 3BUWB 2JT8A 1CHOI 1MWNA 2KAXA 2K0JA 1YU6C 4HSZA 1W3SA 1HPTA 1SY9A 2HETA 2LAPA 4D1EA 2R2IA 2YQPA 4QJ5B 1KFUL 1CDMA 2L0PA 1S6CA 3I5FC 2K7OA 4PCWA 4UXJA 1F4OA 5KU1A 3C1VA 1PVAA 2JTTA 5ER5A 3TDZA 2ZN8A 1OZOA 2A4JA 1J7QA 3I5GB 1SK6D 2JU0A 2M1UA 1JF2A 1BR4B 1UHIA 4JQ0D 1BLQA 5CSIA 2K61A 2W0TA 2J87A 2JXLA 1D1OA 2SGDI 1WRZA 5GQQC 2BECA 1TNWA 2KOTA 2PALA 1J7RA 4MSPA 4NDBA 2Y4QA 4XJKB 1IQ3A 1X74A 4WQ3A 1XX6A 1A03A 1K96A 2KI6D 2BKHB 3JVTB 4WQ2A 4PE0A 1ZACA 2BL0B 1DS3I 3D10A 1AUIB 4USLA 1M63B 1A29A 4YGDB 4GI3C 2JULA 3K21A 1CFFA 4GBAA 2FNFX 1IKUA 3PLFB 4GGNA 1CFCA 3WNXB 1DJXA 2MJWB 1SGEI 1XBTA 3WHTB 1BU3A 2KAYA 1RJVA 1TBNA 1B7TY 1V1IA 1JFKA 3IF7A 2N71A 1U5IA 1BOCA 1ZOTB 1SNLA 3VE5A 4GAOA 5TNCA 1CDNA 1MHOA 2K9HA 2BKIB 1CT4I 2CBLA 4XJKA 2KMOA 4PDZA 2KBMA 1SCMB 1FI6A 2LMVA 1BUSA 1K8UA 3LCPC 1LR8A 3FS7A 3UFFA 2DIPA 4UXHA 1OMUA 4L9MA 2L4IA 1Y8FA 4B6DA 2V1CA 1WLZA 2B8TA 4DUQA 1BT6A 1A2XA 3ICBA 1K9UA 3M0WA 3I5HC 5K89A 4NQGA 1CMFA 2LUYA 1J55A 3UEJA 3UGLA 1ODBA 4MRYA 2V53A 2IS9A 1KFXL 1Y0VH 2ZRTA 1XFXO 1B8CA 2AUCA 2BE4A 2K7DA 1PTQA 1CDLA 4P2YB 3OXFA 1FYBA 5AXIA 4HRHA 2OD1A 2CNPA 1UVGA 2KI6C 1AP4A 4GGFA 1B4CA 4ORBB 1KBEA 1CLMA 3CLNA 4ETOA 1X4SA 2ZN9A 1CKKA 1LINA 1XFWO 3I5IC 1VRKA 2H2KA 5D69A 5EX3A 3O6BA 2LE9B 1XFZO 1B9AA 1C7VA 1SGRI 1OQPA 1JUOA 2HQWA 2MRDA 3AAJA 5FUXA 3AKBA 3DF0B 1NSHA 2M7LA 3GK1A 1NCXA 3BYAA 2M5XA 1B47A 1NYAA 1KWOC 2Y1MA 4ZCUA 1N2DA 3TS5B 3WXAA 1KBFA 1LA0A 1QV1A 1FARA 1QX5B 2WOSA 2N52A 4DRWA 1SR6C 5BPJA 2LVJA 1XFVO 1AJ5A 4JWQA 2BE6A 2PASA 1YTPA 4C0JA 2JC2A 2KI4C 3O2PA 4I5NB 1MT1A 1M8BA 2LEOA 1NCYA 2K8MB 1R2UA 5HLOA 1J7PA 2F2PA 4E68A 5CSJA 2HQ8A 3EK7A 3BOWB 5DKNA 4YRUA 1LR9A 2LANA 1BMOA 3DF0A 1ZMZA 3PALA 2WVJA 2JXDA 2NU3I 5I2LA 1FBVA 1DMOA 1M46A 1BJFA 1DGUA 2NCOA 1NX3A 3CGAA 3TJQA 3PM8A 2J9RA 2KQ6A 4NDCA 1LKJA 1IY6A 2JNFA 1JBAA 3BXKA 2WCFA 2UZ3A 5HQ8A 1YR5A 5CCLA 2CT9A 2ZKMX 1ZUZA 4I5KA 1SW8A 2BBNA 4ICBA 1J1DA 3OB1B 2B1UA 2B0UC 5G08A 1PULA 2N17A 2JTZA 1FAQA 3EKJA 3PN7C 1IG5A 1SRAA 3CR4X 4A24A 2VRWB 3KF9A 2GGZA 5J3XA 2LMTA 3QTLD 3CTNA 3SG4A 1Y1XA 1HQVA 3BOWA 4C0LA 4PALA 1XVJA 4YBHB 2SGQI 3OP0A 2PVBA 5DKQA 3LK0A 3DVKA 2EC6B 1GGWA 1CE3A 1IRJA 2ENNA 2M9GA 3CWGA 3BJIA 5HKZA 1OYVI 3OB2B 1S3PA 3DVJA 3SG6A 1UHHA 2QACA 4CIDA 1YUTA 1LA3A 3OX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGJ I;  1CDP A;  2KGB C;  3PSR A;  2P6B B;  1B1G A;  3SJS A;  1DJZ A;  1A75 B;  3CR5 X;  1CSO I;  1PCE A;  2LP3 A;  2KYF A;  3KHE A;  2G2B A;  4MVF A;  1YVH A;  3HH2 C;  1IGV A;  4YGC B;  1U5I B;  3GK4 X;  1YRU B;  2I2R E;  4SGB I;  1RTP 1;  2WOR A;  2KQY A;  3BQ3 A;  1OMT A;  1HDL A;  2WCE A;  2NU4 I;  1TRF A;  4UPG A;  2TN4 A;  2WND A;  3TZ1 A;  1UVF A;  1OE9 B;  3BUX B;  1QS7 A;  1YX7 A;  3SGB I;  2K7C A;  1S5G Y;  3OHM B;  3AKA A;  1SGQ I;  1BG1 A;  2M7N A;  2LHL A;  2XRC A;  1HJA I;  1H8B A;  2L5X B;  3DD4 A;  1A75 A;  2I94 A;  2LVK A;  1QVI Y;  1YUU A;  3O78 A;  3VGO A;  4DCK A;  4DS7 A;  2ARP F;  1OSA A;  1OMR A;  1WY9 A;  1M8C A;  1AJ4 A;  1WDC B;  2JRF A;  1KMA A;  1K9K A;  2LLT A;  1DJW A;  3DVM A;  2KGR A;  2AAO A;  2MHH A;  1J1E A;  1QLS A;  1MF8 B;  2NU0 I;  1UUC A;  1SKT A;  3JTD B;  4OV2 A;  3I5G C;  2F2O A;  4JPZ B;  1YVL A;  4PHK A;  2NU2 I;  1WLM A;  1YUS A;  4N1F A;  2Y1N A;  2M49 B;  1QV0 A;  1Z7K B;  1YTZ C;  3SG2 A;  1DJY A;  3FWC A;  1BF5 A;  2OS8 B;  5PAL A;  4N1G A;  1TBQ R;  1CT2 I;  3TUY B;  3EVR A;  3EKH A;  1BOD A;  1J7O A;  4MLW A;  5ER4 X;  2WCB A;  3JVT C;  1TTX A;  4P5O E;  2BL0 C;  5I2O A;  2COL B;  1QJT A;  4XYN A;  1NPQ A;  4CFR A;  1F4Q A;  2OTG B;  4ORA B;  4GUK A;  1E8A A;  1OZS A;  1S1E A;  1TUS A;  2I18 A;  3FWB A;  2OPO A;  2Q91 A;  3TDU A;  1SBJ A;  5JOL A;  5HKY A;  1NUB A;  1JSA A;  4YI8 A;  1CNP A;  1JFJ A;  3SEK C;  3SGQ I;  5JHW C;  3BUN B;  1H4B A;  3ZWH A;  2SGF I;  4A4C A;  2M97 A;  2EGD A;  1UWO A;  2NZ0 A;  1GQM A;  2BBM A;  1PAL A;  2G9B A;  1TIZ A;  4GGF C;  2L98 A;  1SCM C;  1XYD A;  5CSN A;  1V1F A;  3HX4 A;  4ORC B;  1CMG A;  1KK7 Y;  1N0Y A;  1NP8 A;  4ZCV A;  4MZK A;  2FJU B;  2JT0 A;  3RM1 A;  1RRO A;  4MZJ A;  1S5G Z;  4CLN A;  4Q04 A;  2WCY A;  2PMY A;  2KFH A;  2LM5 A;  1EG3 A;  4M2P A;  5CSF A;  1XK4 C;  1KK8 B;  1S26 D;  3VRO A;  2F3Z A;  2RGI A;  1Y1B A;  2M3W A;  1CM4 A;  1QVI Z;  1B7T Z;  2DOQ A;  3HCM A;  1PVB A;  1K9P A;  3BUO B;  3KPX A;  4DIR A;  1EG4 A;  2WC8 A;  4PHJ A;  4PE7 A;  2BUS A;  4QJ4 B;  3NSI A;  1L2O B;  2EHB A;  2LHI A;  4QJ3 B;  3CZT X;  4HGU A;  4YGA A;  1SL7 A;  5IBW A;  1KQM B;  5AER A;  2Y5I A;  2JWW A;  1CFP A;  2M1K B;  1GGZ A;  2ZND A;  3LLE A;  1K94 A;  2F8P A;  4BY5 A;  1WRK A;  1PSR A;  1RWY A;  2H61 A;  1FI5 A;  1DS2 I;  2E30 A;  5B8I B;  1LR7 A;  1IY5 A;  1FW4 A;  1AVS A;  2M8U A;  3A8R A;  5DAE A;  2CTN A;  1NWD A;  4OVO A;  3I5F B;  4OKH A;  1MQ1 A;  3TS5 C;  1PRW A;  1UUS A;  4FQO A;  2K2F A;  4R1E A;  1QIV A;  2FOT A;  1DJI A;  1S36 A;  1AK8 A;  4PE4 A;  3GK2 A;  3EVV A;  1TCF A;  1CM1 A;  2LUC A;  1F55 A;  3E3R A;  3KO0 A;  1K2H A;  1PPF I;  1DF0 B;  1OOJ A;  2SGE I;  1DTL A;  2LMU A;  5AAN A;  2LCP A;  4MN0 A;  3SG3 A;  1G4Y R;  1AN1 I;  2BCX A;  1DGV A;  2L4H A;  5JJG A;  2BCA A;  1RFJ A;  5FYX A;  2JZI A;  2KHN A;  4NDD A;  1F8H A;  3FIA A;  3BUM B;  3EK4 A;  1XFU O;  1JC2 A;  1IW4 A;  3SIA A;  1PSB A;  1UHK A;  1NX0 A;  1TNX A;  1AHR A;  3SG5 A;  5AFP A;  1CLL A;  1K90 D;  1XFY O;  2Q4U A;  3F45 A;  1G33 A;  2F3C I;  1QLK A;  2NLN A;  3PAT A;  4MEW A;  3ZNI A;  2KMR A;  3NSL A;  4OVN F;  2QQD A;  1QX2 A;  1SGD I;  1NCZ A;  1PK0 D;  1UHN A;  1DVI A;  1LXF C;  1S6I A;  2HF5 A;  2KBI A;  1DF0 A;  2PRU A;  3EVU A;  2JOJ A;  5HLV A;  4F0Z B;  4C0K A;  1SGN I;  2JZM A;  2FCE A;  2EC6 C;  1WRL A;  3H4S E;  4PHM A;  2KNE A;  1QXP A;  4TNC A;  1TN4 A;  2L2E A;  1M39 A;  2M29 A;  2D8N A;  2LVV A;  3KEV A;  3QRX A;  1REC A;  1L7Z A;  2LV7 A;  3SIB A;  2GKR I;  2I7A A;  2ISD A;  1OMD A;  4AOM A;  1HT9 A;  2L51 A;  1X02 A;  1JWD A;  1W7J B;  3I5H B;  2KCX A;  4AQI A;  4AQJ A;  2LC5 A;  1TNQ A;  2JNX A;  1B8R A;  1SPY A;  2KMQ A;  1UHJ A;  5I2Q A;  1JF0 A;  3RLZ A;  1G8I A;  4M2Q A;  2SGP I;  2JQ6 A;  1H0Z A;  1GJY A;  4GPL B;  5AEQ A;  1F71 A;  2LNK A;  2JYY A;  1UP5 A;  1QX7 A;  1UUR A;  2LVI A;  5D7F A;  1M45 A;  1MUX A;  1R6P A;  2LP2 A;  3I5I B;  2NXQ A;  2O60 A;  2KAV A;  4YGB B;  1C7W A;  3PFV A;  4A4B A;  4CPV A;  4FTG A;  1IQ5 A;  3NXA A;  2BCB A;  1IJ6 A;  2ERW A;  2KMP A;  1Y1A A;  3VRQ A;  1CT0 I;  1B8L A;  1DJG A;  1QIW A;  2LLU A;  3A4U B;  2MLF C;  1WDC C;  3VRR A;  2VRG A;  1KWO B;  1SYM A;  2MBX A;  1NIW A;  1KQV A;  2MLE C;  2MAZ A;  4MBE A;  4OCI A;  1IH0 A;  1SL9 A;  2M0R A;  3EK8 A;  2QQC A;  2KSP A;  3SG7 A;  3VRP A;  1CB1 A;  1QTX A;  1SR6 B;  1KFU S;  1XA5 A;  2MA2 A;  3JTD C;  5CPV A;  3TDI A;  1EXR A;  3GOF A;  1MXL C;  2KI4 B;  2F33 A;  1K93 D;  4U8D A;  2NU1 I;  3OVO A;  1EH2 A;  1CFD A;  1TIH A;  1KSO A;  3MSE B;  2OS8 C;  2OVO A;  1Y1U A;  3TUY C;  1N65 A;  1OVO A;  1XO5 A;  4YI9 A;  4CFQ A;  3WHU B;  2L50 A;  1FF1 A;  2GKV A;  2CXJ A;  2QPT A;  1ALW A;  5KTY A;  1Y1C A;  1CLB A;  2ZRS A;  2GV5 A;  1TCO B;  2OTG C;  4I5L B;  2KFF A;  3LK1 A;  3LL8 B;  2O5G A;  3NSK A;  4MRX A;  1M31 A;  1R0R I;  1Y6W A;  1XK4 A;  2LLS A;  1SGY I;  4GFT A;  3AAK A;  4YGE B;  3DVE A;  5KSZ A;  2F3Y A;  1MXE A;  1ZFS A;  1YRT B;  4OR9 B;  3PN7 B;  1EL4 A;  3NSO A;  1SMG A;  1EJ3 A;  4PHN A;  4M2O A;  1C07 A;  1K95 A;  2SCP A;  1KCY A;  1SGP I;  4HRE E;  3D0Y B;  5DKR A;  4WRI A;  2JPT A;  2ZNE A;  1BR1 B;  1NX1 A;  3O4Y A;  1Q80 A;  4N5X A;  1KSM A;  1IWQ A;  1SCV A;  2JT3 A;  5F6T A;  2AMI A;  2HPS A;  1NX2 A;  1W7I B;  2KFG A;  2CCM A;  4GNK B;  4MZL A;  1TOP A;  1MR8 A;  1YX8 A;  4HRG A;  2GKT I;  1OMV A;  1DJH A;  4PE1 A;  2GGM A;  1KK8 C;  2PSR A;  3OX5 A;  2P6A C;  3B4V C;  2H61 C;  5HYD A;  2KYC A;  1SL8 A;  2LUX A;  2FCD A;  2K7B A;  1TUR A;  1TNP A;  1CGI I;  3D0Y A;  4I5J A;  2JXC A;  1L2O C;  3VRN A;  1QAS A;  3IQQ A;  1S6J A;  2E6W A;  3CR2 A;  5HKW A;  1RK9 A;  5I8N A;  1KFX S;  1FPW A;  1A4P A;  1QAT A;  1V1G A;  2NCP A;  1N13 A;  2KDH A;  3IQO A;  4IL1 A;  1CTR A;  1TBR R;  4BY4 A;  2K2A A;  1KQM C;  2ZFD A;  1KK7 Z;  1PJU A;  1F70 A;  1F54 A;  1ALV A;  1YUR A;  1TGS I;  3CS1 A;  1IJ5 A;  1LVC D;  2SAS A;  1DT7 B;  3BUW B;  2JT8 A;  1CHO I;  1MWN A;  2KAX A;  2K0J A;  1YU6 C;  4HSZ A;  1HPT A;  1SY9 A;  2HET A;  2LAP A;  4D1E A;  2R2I A;  4QJ5 B;  1KFU L;  1CDM A;  2L0P A;  1S6C A;  3I5F C;  2K7O A;  4PCW A;  1F4O A;  5KU1 A;  3C1V A;  1PVA A;  2JTT A;  5ER5 A;  3TDZ A;  2ZN8 A;  1OZO A;  2A4J A;  1J7Q A;  3I5G B;  1SK6 D;  2JU0 A;  2M1U A;  1JF2 A;  1BR4 B;  1UHI A;  4JQ0 D;  1BLQ A;  5CSI A;  2K61 A;  2JXL A;  1D1O A;  2SGD I;  1WRZ A;  5GQQ C;  2BEC A;  1TNW A;  2KOT A;  2PAL A;  1J7R A;  4MSP A;  4NDB A;  2Y4Q A;  4XJK B;  1IQ3 A;  4WQ3 A;  1A03 A;  1K96 A;  2KI6 D;  2BKH B;  3JVT B;  4WQ2 A;  4PE0 A;  1ZAC A;  2BL0 B;  1DS3 I;  3D10 A;  1AUI B;  4USL A;  1M63 B;  1A29 A;  4YGD B;  4GI3 C;  2JUL A;  3K21 A;  1CFF A;  4GBA A;  1IKU A;  3PLF B;  4GGN A;  1CFC A;  3WNX B;  1DJX A;  2MJW B;  1SGE I;  3WHT B;  1BU3 A;  2KAY A;  1RJV A;  1B7T Y;  1JFK A;  3IF7 A;  2N71 A;  1U5I A;  1BOC A;  1ZOT B;  1SNL A;  4GAO A;  5TNC A;  1CDN A;  1MHO A;  2BKI B;  1CT4 I;  2CBL A;  4XJK A;  2KMO A;  4PDZ A;  2KBM A;  1SCM B;  1FI6 A;  2LMV A;  1BUS A;  1K8U A;  3LCP C;  1LR8 A;  3FS7 A;  1OMU A;  4L9M A;  2L4I A;  1WLZ A;  4DUQ A;  1BT6 A;  1A2X A;  3ICB A;  1K9U A;  3M0W A;  3I5H C;  5K89 A;  4NQG A;  1CMF A;  1J55 A;  1ODB A;  4MRY A;  2V53 A;  2IS9 A;  1KFX L;  1Y0V H;  2ZRT A;  1XFX O;  1B8C A;  2AUC A;  2BE4 A;  2K7D A;  1FYB A;  1CDL A;  4P2Y B;  5AXI A;  4HRH A;  2CNP A;  1UVG A;  2KI6 C;  1AP4 A;  4GGF A;  1B4C A;  4ORB B;  1CLM A;  3CLN A;  4ETO A;  2ZN9 A;  1CKK A;  1LIN A;  1XFW O;  3I5I C;  1VRK A;  2H2K A;  5D69 A;  3O6B A;  2LE9 B;  1XFZ O;  1B9A A;  1C7V A;  1SGR I;  1OQP A;  1JUO A;  2HQW A;  2MRD A;  3AAJ A;  3AKB A;  3DF0 B;  1NSH A;  2M7L A;  3GK1 A;  1NCX A;  3BYA A;  2M5X A;  1B47 A;  1NYA A;  1KWO C;  2Y1M A;  4ZCU A;  1N2D A;  3TS5 B;  3WXA A;  1LA0 A;  1QV1 A;  1QX5 B;  2WOS A;  2N52 A;  4DRW A;  1SR6 C;  5BPJ A;  2LVJ A;  1XFV O;  1AJ5 A;  4JWQ A;  2BE6 A;  2PAS A;  1YTP A;  4C0J A;  2JC2 A;  2KI4 C;  3O2P A;  4I5N B;  1MT1 A;  1M8B A;  2LEO A;  1NCY A;  2K8M B;  1R2U A;  5HLO A;  1J7P A;  2F2P A;  4E68 A;  5CSJ A;  2HQ8 A;  3EK7 A;  3BOW B;  5DKN A;  4YRU A;  1LR9 A;  2LAN A;  1BMO A;  3DF0 A;  1ZMZ A;  3PAL A;  2JXD A;  2NU3 I;  5I2L A;  1FBV A;  1DMO A;  1M46 A;  1BJF A;  1DGU A;  2NCO A;  1NX3 A;  3CGA A;  3TJQ A;  3PM8 A;  1IY6 A;  2KQ6 A;  4NDC A;  1LKJ A;  2JNF A;  1JBA A;  3BXK A;  2WCF A;  1YR5 A;  2CT9 A;  2ZKM X;  1ZUZ A;  4I5K A;  1SW8 A;  2BBN A;  4ICB A;  1J1D A;  3OB1 B;  2B1U A;  2B0U C;  5G08 A;  1PUL A;  2N17 A;  2JTZ A;  3EKJ A;  3PN7 C;  1IG5 A;  1SRA A;  3CR4 X;  3KF9 A;  2GGZ A;  5J3X A;  2LMT A;  3QTL D;  3CTN A;  3SG4 A;  1Y1X A;  1HQV A;  3BOW A;  4C0L A;  4PAL A;  1XVJ A;  4YBH B;  2SGQ I;  3OP0 A;  2PVB A;  5DKQ A;  3LK0 A;  3DVK A;  2EC6 B;  1GGW A;  1CE3 A;  1IRJ A;  2M9G A;  3CWG A;  5HKZ A;  1OYV I;  3OB2 B;  1S3P A;  3DVJ A;  3SG6 A;  1UHH A;  2QAC A;  4CID A;  1YUT A;  1LA3 A;  3OX6 A; 
#chains in the Genus database with same CATH topology
 3SJS A;  2K60 A;  1CSO I;  1PCE A;  3BJH A;  1IGV A;  4YGC B;  4SGB I;  1YRU B;  2E5R A;  2NU4 I;  1TRF A;  2L7X A;  3TZ1 A;  2CWG A;  1UVF A;  2L8E A;  3BUX B;  3SGB I;  1BG1 A;  2I94 A;  1QVI Y;  2ARP F;  1WTJ A;  1OMR A;  1WDC B;  2LLT A;  5E3P A;  1DJW A;  2YUU A;  1ULM A;  1SKT A;  3JTD B;  2NU2 I;  4N1F A;  4FQT A;  1DJY A;  2OS8 B;  1TBQ R;  3EVR A;  3EKH A;  5ER4 X;  2WCB A;  1WKX A;  5I2O A;  1F4Q A;  1Q9B A;  1S1E A;  1WGT A;  1TUS A;  3FWB A;  1JSA A;  1CNP A;  3MEK A;  3SEK C;  3ZWH A;  4GGF C;  1XYD A;  1KK7 Y;  3D78 A;  1RRO A;  3PDN A;  2KFH A;  2LM5 A;  3VRO A;  1B7T Z;  3BUO B;  3KPX A;  1EG4 A;  2BUS A;  4QJ4 B;  4QJ3 B;  4YGA A;  1SL7 A;  1XFR A;  2Y5I A;  2JWW A;  2M1K B;  1GGZ A;  3LLE A;  1RWY A;  1FI5 A;  2E30 A;  1FW4 A;  1AVS A;  1Z2I A;  2QPO A;  4FKD A;  1F55 A;  5I94 A;  1PPF I;  2LCP A;  4MN0 A;  2BCX A;  1DGV A;  5JJG A;  5EX0 A;  3UGI A;  4NDD A;  2GVI A;  1JC2 A;  1PSB A;  1TNX A;  1CLL A;  1K90 D;  1OOH A;  3F45 A;  2NLN A;  1UHN A;  1S6I A;  2PRU A;  3EVU A;  3N7H A;  1VDD A;  1WRL A;  2KPH A;  1U5K A;  3CZ2 A;  3GOX A;  1ORG A;  3SIB A;  2NU0 I;  2GKR I;  2ISD A;  1OMD A;  1HT9 A;  2L51 A;  2KCX A;  2KMQ A;  1B8R A;  5I2Q A;  1G8I A;  4M2Q A;  4GPL B;  1QX7 A;  1UUR A;  3FE8 A;  5D7F A;  2PYQ A;  4FTG A;  3NXA A;  2BCB A;  1IJ6 A;  2LLU A;  3SS5 A;  1SYM A;  2MBX A;  1NIW A;  4MBE A;  2KSP A;  2MA2 A;  3TDI A;  1XA5 A;  1MXL C;  2KI4 B;  2F33 A;  1XA6 A;  1EH2 A;  3E2I A;  1N65 A;  1XO5 A;  4CFQ A;  3UOE A;  2ZRS A;  3NSK A;  3LL8 B;  1M31 A;  1SGY I;  4YGE B;  5KSZ A;  1MXE A;  1ZFS A;  3D75 A;  1PTR A;  3R1P A;  1C07 A;  3BFA A;  2JPT A;  1Q80 A;  1KSM A;  1SCV A;  4MZL A;  1TOP A;  1DJH A;  4PE1 A;  1KK8 C;  2P6A C;  2FCD A;  2K7B A;  1CGI I;  3D0Y A;  1L2O C;  5HKW A;  1FPW A;  3IQO A;  1CTR A;  2K2A A;  1KQM C;  2ZFD A;  1F70 A;  1TGS I;  3CS1 A;  1DT7 B;  2FJY A;  2JT8 A;  1YU6 C;  1KFU L;  4PCW A;  4UXJ A;  2A4J A;  1SK6 D;  4JQ0 D;  5CSI A;  2J87 A;  2SGD I;  1D1O A;  1WRZ A;  4JKT A;  4MSP A;  1K96 A;  2KI6 D;  3JVT B;  1ZAC A;  4USL A;  3EG5 B;  4GBA A;  2FNF X;  1IKU A;  3PLF B;  3WNX B;  1DJX A;  2MJW B;  1BU3 A;  1RJV A;  1JFK A;  2N71 A;  1BOC A;  1ZOT B;  4GAO A;  5TNC A;  1CDN A;  2BKI B;  3FE9 A;  1ULN A;  2KMO A;  4PDZ A;  1SCM B;  1K8U A;  3LCP C;  4UXH A;  3CDN A;  1Y8F A;  2L4I A;  4B6D A;  1OW4 A;  2V1C A;  4DUQ A;  1BT6 A;  1K9U A;  3I5H C;  4NQG A;  2LUY A;  1J55 A;  3BFH A;  2AUC A;  3OXF A;  2CNP A;  4ORB B;  2GTE A;  3CLN A;  1CKK A;  2H2K A;  3O6B A;  1SGR I;  3D77 A;  1NCX A;  3RZS A;  3TS5 B;  1KBF A;  1LA0 A;  2WOS A;  2LVJ A;  4I5N B;  3EK7 A;  1LR9 A;  5DIC A;  1BMO A;  3DYE A;  2UVO A;  2KLE A;  2WVJ A;  2JXD A;  3CAB A;  1M46 A;  1S20 A;  1ZUZ A;  4I5K A;  3R72 A;  1FAQ A;  4A24 A;  5J3X A;  2GGZ A;  3CTN A;  4C0L A;  4PAL A;  1XVJ A;  2EC6 B;  1GGW A;  1UHA A;  1OYV I;  5HL1 A;  3QRX A;  4YI9 A;  1CGJ I;  1CDP A;  2P6B B;  2CJS C;  3CR5 X;  2LP3 A;  2G2B A;  1U5I B;  3TOA A;  2I2R E;  3Q8I A;  1QS7 A;  1S5G Y;  3AKA A;  4WP4 A;  1H8B A;  2L5X B;  3DD4 A;  1A75 A;  1YUU A;  1OSA A;  1NXU A;  1WY9 A;  1M8C A;  1AJ4 A;  2F2O A;  4PHK A;  1YTZ C;  3FWC A;  1BF5 A;  3B88 A;  1MJ9 A;  4INX A;  1BOD A;  5J8C A;  1TTX A;  2BL0 C;  2COL B;  2V1C C;  2JW6 A;  3R5D A;  2WGC A;  3SGQ I;  3B7A A;  1JFJ A;  3BUN B;  1H4B A;  2SGF I;  1PAL A;  1N0Y A;  3D00 A;  4MZK A;  2JT0 A;  4CLN A;  4Q04 A;  2WCY A;  5CSF A;  1XK4 C;  2F3Z A;  1Y1B A;  1QVI Z;  2DOQ A;  3HCM A;  3NHT A;  1OOI X;  4JD9 A;  1OOG A;  2N1A B;  5IBW A;  1CFP A;  4BY5 A;  1WRK A;  1PSR A;  3OGN A;  2H61 A;  3TO6 A;  1DS2 I;  3A8R A;  1MJA A;  5FUV A;  4OKH A;  1UUS A;  2FOT A;  1DJI A;  3GK2 A;  3EVV A;  2LUC A;  3KO0 A;  1DF0 B;  3O4X A;  2WCK A;  1DTL A;  1AN1 I;  1G4Y R;  2ENZ A;  2L4H A;  2KHN A;  3FIA A;  3SG5 A;  5AFP A;  2Q4U A;  1XFY O;  3CXL A;  2F3C I;  1QLK A;  4MEW A;  4YBH B;  3CZ0 A;  2A20 A;  2FCE A;  3H4S E;  1QXP A;  1T14 A;  2OZU A;  2LVV A;  3L47 A;  4AOM A;  2RIJ A;  4AQI A;  3DZT A;  4AQJ A;  1Z2C B;  2JNX A;  1SPY A;  1UHJ A;  3DY9 A;  2SGP I;  1F71 A;  1UP5 A;  2LVI A;  1MUX A;  1R6P A;  2QQ0 A;  1TWO A;  2QEV A;  3KY9 A;  2KMP A;  1B8L A;  2MLE C;  3SG7 A;  1CB1 A;  1QTX A;  1KFU S;  3MSE B;  3R1V A;  3TUY C;  3WHU B;  1FF1 A;  1TUJ A;  2QPT A;  5KTY A;  1TCO B;  2OTG C;  4MRX A;  2O5G A;  1R0R I;  3R1O A;  1YRT B;  4OR9 B;  3NSO A;  2JA1 A;  1SGP I;  2ZNE A;  1NX1 A;  1IWQ A;  2JT3 A;  3DXL A;  2ELI A;  3CZ1 A;  2HPS A;  1MR8 A;  3BFB A;  2H61 C;  2KYC A;  3CR2 A;  2E6W A;  1RK9 A;  1A4P A;  1QAT A;  2KDH A;  1ALV A;  1LVC D;  4HSZ A;  1HPT A;  1SY9 A;  2HET A;  2YQP A;  2R2I A;  3I5F C;  1S6C A;  2K7O A;  1P9G A;  2ZN8 A;  1OZO A;  2WCM A;  5GQQ C;  2BEC A;  2KOT A;  2PAL A;  1J7R A;  1IQ3 A;  2Y4Q A;  4WQ3 A;  2BKH B;  4GI3 C;  1CFC A;  2KAY A;  1B7T Y;  3IF7 A;  1U5I A;  3VE5 A;  1SNL A;  2K9H A;  2CBL A;  4XJK A;  3S0F A;  3UFF A;  4L9M A;  2WCL A;  1A2X A;  3ICB A;  5K89 A;  2X52 A;  3SS3 A;  1P28 A;  3UEJ A;  4MRY A;  3TO7 A;  1Y0V H;  2ZRT A;  1XFX O;  2KLD A;  1PTQ A;  1FYB A;  1CDL A;  2KI6 C;  1AP4 A;  1KBE A;  3I5I C;  5EX3 A;  1B9A A;  1C7V A;  1OQP A;  1JUO A;  2MRD A;  3AAJ A;  3DF0 B;  2M7L A;  3BYA A;  3FSX A;  1NYA A;  1KWO C;  2Y1M A;  1QX5 B;  4DRW A;  1SR6 C;  5BPJ A;  1AJ5 A;  3VB1 A;  2LEO A;  1NCY A;  1J7P A;  5CSJ A;  5I2L A;  1FBV A;  1DMO A;  1BJF A;  2NCO A;  1NX3 A;  2UZ3 A;  3BXK A;  2WCF A;  2CT9 A;  2ZKM X;  2B0U C;  2B1U A;  5G08 A;  3EKJ A;  3PN7 C;  2QEO A;  2BNX A;  1Y1X A;  3BOW A;  3OP0 A;  5DKQ A;  4CID A;  3OX6 A;  2KGB C;  3PSR A;  1DJZ A;  4MVF A;  3GK4 X;  1K7T A;  5CCM A;  2KQY A;  3BQ3 A;  1OMT A;  1HDL A;  3S0E A;  4INW A;  2ORV A;  1YX7 A;  2K7C A;  3S0D A;  2LHL A;  3OXG A;  4DNC A;  1DC1 A;  4DS7 A;  2ROW A;  1K9K A;  5EL2 A;  3DVM A;  2KGR A;  4UXI A;  1J1E A;  1MF8 B;  4OV2 A;  3I5G C;  4JPZ B;  2Y1N A;  5FI7 A;  1Z7K B;  2WC6 A;  3SG2 A;  5PAL A;  1HEV A;  4MLW A;  4AML A;  3FE6 A;  4P5O E;  1TUZ A;  4XYN A;  1NPQ A;  4CFR A;  4ORA B;  1E8A A;  3OL0 A;  2OPO A;  2Q91 A;  3R5A A;  4YI8 A;  2EGD A;  2NZ0 A;  1GQM A;  2L98 A;  1V1F A;  4ORC B;  4ZCV A;  5HI7 A;  2FJU B;  1S5G Z;  2PMY A;  7WGA A;  1KK8 B;  1S26 D;  2RGI A;  2E73 A;  1PVB A;  1K9P A;  4DIR A;  4PHJ A;  2WC8 A;  4PE7 A;  1L2O B;  2LHI A;  4HGU A;  1KQM B;  5AER A;  2ZND A;  1K94 A;  2LB7 A;  1IY5 A;  3NGV A;  1V1H A;  5DAE A;  2CTN A;  2L2C A;  2DKV A;  1MQ1 A;  1PRW A;  2CWF A;  4R1E A;  1CM1 A;  3OBV A;  3E3R A;  3L4L A;  1OOJ A;  2LMU A;  2WC5 A;  3K1E A;  1IIO A;  1WGC A;  2X3T A;  1XFU O;  1NX0 A;  1AHR A;  3SS4 A;  3RU0 A;  3UGD A;  1DEL A;  1G33 A;  2KMR A;  2QQD A;  3NSL A;  1SGD I;  1PK0 D;  2KBI A;  3IVT A;  2JOJ A;  5HLV A;  4F0Z B;  4C0K A;  1SGN I;  2JZM A;  3OXL A;  2WCH A;  4TNC A;  2L2E A;  1M39 A;  2M29 A;  2D8N A;  3KEV A;  2LV7 A;  2I7A A;  1X02 A;  2QQE A;  1W7J B;  3I5H B;  1TNQ A;  3VDP A;  4MPI A;  3RLZ A;  2LNK A;  1M45 A;  2LP2 A;  2NXQ A;  2O60 A;  2KAV A;  3VDU A;  4YGB B;  1IQ5 A;  3UNW A;  1Y1A A;  3VRQ A;  1CT0 I;  1DJG A;  3S0G A;  1QIW A;  3A4U B;  1WDC C;  2VRG A;  3UO9 A;  1KQV A;  4OCI A;  1SL9 A;  2M0R A;  2QQC A;  3VRP A;  3JTD C;  1EXR A;  3GOF A;  4U8D A;  3OVO A;  1CFD A;  2OS8 C;  2WCJ A;  5FUY A;  4F7F A;  4E1P A;  2L50 A;  2CXJ A;  1ALW A;  1Y1C A;  1CLB A;  4I5L B;  3LK1 A;  1SSE B;  1Y6W A;  1ULK A;  4GFT A;  3AAK A;  3B86 A;  1EL4 A;  1SMG A;  4PHN A;  4M2O A;  1K95 A;  2SCP A;  4HRE E;  3D0Y B;  5DKR A;  1BR1 B;  5FUW A;  1Z4H A;  5F6T A;  2KFG A;  4HRG A;  2GIV A;  1OMV A;  2GGM A;  2PSR A;  2QEH A;  5HYD A;  1SL8 A;  2LUX A;  1TUR A;  1TNP A;  1QAS A;  1N13 A;  2NCP A;  3B87 A;  4IL1 A;  1W9Z A;  1KK7 Z;  1PJU A;  1F54 A;  1YUR A;  1IJ5 A;  2OU2 A;  3BUW B;  1CHO I;  2KAX A;  1W3S A;  2RC4 A;  4QJ5 B;  2L0P A;  1F4O A;  1PVA A;  2M1U A;  2K61 A;  2W0T A;  1K7U A;  4NDB A;  1X74 A;  1A03 A;  4WQ2 A;  2BL0 B;  1DS3 I;  3D10 A;  1AUI B;  1M63 B;  2JUL A;  3K21 A;  1CFF A;  5E3R A;  4GGN A;  1XBT A;  1V1I A;  1CT4 I;  2KBM A;  1LR8 A;  3FS7 A;  3M0W A;  3UGL A;  2V53 A;  1KFX L;  1B8C A;  5AXI A;  1UVG A;  4ETO A;  2ZN9 A;  1LIN A;  1XFW O;  1VRK A;  1XFZ O;  2HQW A;  5FUX A;  3AKB A;  1NSH A;  3GK1 A;  2M5X A;  1B47 A;  4ZCU A;  1FAR A;  2PQL A;  1XFV O;  2BE6 A;  1YTP A;  4C0J A;  2JC2 A;  2KI4 C;  1M8B A;  3S0B A;  4YRU A;  5DKN A;  3PJI A;  1ZMZ A;  3PAL A;  1DGU A;  3CGA A;  1IY6 A;  4NDC A;  1C3Y A;  2JNF A;  5HQ8 A;  1YR5 A;  5CCL A;  2BBN A;  2L5Y A;  1J1D A;  2N17 A;  1SRA A;  2VRW B;  3KF9 A;  3QTL D;  3SG4 A;  1HQV A;  2PVB A;  1P9Z A;  1IRJ A;  3BJI A;  3CWG A;  5HKZ A;  3OB2 B;  3DVJ A;  1UHH A;  1YUT A;  3EK4 A;  1LA3 A;  3TOB A;  1B1G A;  1A75 B;  2KYF A;  3KHE A;  3HH2 C;  1YVH A;  1RTP 1;  2WOR A;  2WCE A;  4UPG A;  2TN4 A;  2WND A;  1OE9 B;  2ORW A;  3TO9 A;  3OHM B;  1SGQ I;  2M7N A;  1HJA I;  2LVK A;  3O78 A;  3VGO A;  4DCK A;  1KMA A;  4KYN A;  2JRF A;  1R79 A;  1GM0 A;  2AAO A;  2MHH A;  1QLS A;  1UUC A;  1YVL A;  3UEY A;  1WLM A;  1YUS A;  3R5B A;  2M49 B;  1QV0 A;  4N1G A;  1CT2 I;  3TUY B;  1J7O A;  2BAP A;  1OOF A;  3JVT C;  1QJT A;  2OTG B;  4GUK A;  2QEB A;  1W4R A;  1OZS A;  2I18 A;  3TDU A;  1SBJ A;  5JOL A;  5HKY A;  1NUB A;  5JHW C;  4A4C A;  2M97 A;  1UWO A;  2BBM A;  2G9B A;  1TIZ A;  2YGU A;  1SCM C;  5CSN A;  3HX4 A;  1CMG A;  3R5C A;  1NP8 A;  3RM1 A;  4MZJ A;  1K7V A;  5FI2 A;  1EG3 A;  4M2P A;  4OZD A;  4IJ7 A;  2M3W A;  1CM4 A;  2P70 A;  4JCV E;  3NSI A;  2EHB A;  3CZT X;  1TBO A;  2F8P A;  5B8I B;  1LR7 A;  2M8U A;  1NWD A;  4OVO A;  3I5F B;  3TS5 C;  4FQO A;  2K2F A;  1QIV A;  1S36 A;  1AK8 A;  4PE4 A;  1TCF A;  1K2H A;  5AAN A;  3SG3 A;  2BCA A;  1RFJ A;  5FYX A;  2JZI A;  5FI6 A;  1F8H A;  3BUM B;  1IW4 A;  3SIA A;  1UHK A;  3ZNI A;  3PAT A;  2ERB A;  4OVN F;  1QX2 A;  3FC3 A;  1NCZ A;  2HF5 A;  2DIP A;  1DVI A;  1LXF C;  1DF0 A;  2EC6 C;  4PHM A;  2KNE A;  1TN4 A;  2XRC A;  2J9R A;  1REC A;  1L7Z A;  1JWD A;  1DEK A;  2LC5 A;  1JF0 A;  2JQ6 A;  1H0Z A;  1GJY A;  5AEQ A;  2JYY A;  9WGA A;  3I5I B;  1C7W A;  3PFV A;  4A4B A;  4CPV A;  3QME A;  2ERW A;  3E59 A;  4E1R A;  2MLF C;  3VRR A;  1KWO B;  2MAZ A;  1IH0 A;  3EK8 A;  1SR6 B;  5CPV A;  1K93 D;  2NU1 I;  1TIH A;  2ODD A;  1KSO A;  2Y0M A;  2OVO A;  3CYZ A;  1Y1U A;  1OVO A;  2GKV A;  2GV5 A;  1FY7 A;  2DB6 A;  2SGE I;  2KFF A;  2P71 A;  1XK4 A;  2LLS A;  3V2L A;  3DVE A;  2F3Y A;  1RFH A;  1TOT A;  3PN7 B;  1EJ3 A;  1KCY A;  2QDI A;  4WRI A;  3O4Y A;  4N5X A;  2AMI A;  1NX2 A;  1W7I B;  2CCM A;  4GNK B;  3QAH A;  1YX8 A;  2GKT I;  3QWP A;  3OX5 A;  3B4V C;  1C3Z A;  3NHI A;  4I5J A;  2JXC A;  3VRN A;  3IQQ A;  1S6J A;  5I8N A;  1KFX S;  1QWV A;  1V1G A;  1TBR R;  3D74 A;  4BY4 A;  3D76 A;  2SAS A;  1MWN A;  2K0J A;  2LAP A;  4D1E A;  1CDM A;  5KU1 A;  3C1V A;  2JTT A;  5ER5 A;  3TDZ A;  2H8V A;  2CWH A;  1J7Q A;  3I5G B;  2JU0 A;  1JF2 A;  1BR4 B;  1UHI A;  1BLQ A;  2JXL A;  1TNW A;  1XX6 A;  5J8F A;  4XJK B;  4PE0 A;  4YGD B;  1A29 A;  5D3O A;  1SGE I;  3WHT B;  1TBN A;  3PM2 A;  1MHO A;  1FI6 A;  2LMV A;  1BUS A;  1OMU A;  1WLZ A;  2B8T A;  1CMF A;  1MJB A;  5E3Q A;  1ODB A;  2IS9 A;  2BE4 A;  2K7D A;  4P2Y B;  4HRH A;  2OD1 A;  4GGF A;  1LS8 A;  1B4C A;  1CLM A;  1X4S A;  5D69 A;  2LE9 B;  2JPO A;  1DQE A;  1N2D A;  3WXA A;  1QV1 A;  2N52 A;  4JWQ A;  2PAS A;  3FSY A;  1MT1 A;  3O2P A;  2K8M B;  1R2U A;  5HLO A;  2F2P A;  4E68 A;  2HQ8 A;  3BOW B;  2LAN A;  3DF0 A;  4PT1 A;  3S0A A;  2NU3 I;  3TJQ A;  3PM8 A;  2KQ6 A;  1LKJ A;  1JBA A;  1SW8 A;  4ICB A;  3OB1 B;  2PQ8 A;  1PUL A;  2JTZ A;  1IG5 A;  3L4A A;  3CR4 X;  2LMT A;  2SGQ I;  3LK0 A;  3DVK A;  1CE3 A;  2ENN A;  2M9G A;  3B6X A;  3D73 A;  1S3P A;  3SG6 A;  2QAC A; 
#chains in the Genus database with same CATH homology
 1CGJ I;  1CDP A;  2KGB C;  3PSR A;  2P6B B;  1B1G A;  3SJS A;  1DJZ A;  2CJS C;  1A75 B;  3CR5 X;  1CSO I;  1PCE A;  2LP3 A;  2KYF A;  3KHE A;  2G2B A;  4MVF A;  1YVH A;  3HH2 C;  1IGV A;  4YGC B;  1U5I B;  3GK4 X;  1YRU B;  2I2R E;  4SGB I;  1RTP 1;  5CCM A;  2WOR A;  2KQY A;  3BQ3 A;  1OMT A;  2E5R A;  1HDL A;  2WCE A;  2NU4 I;  1TRF A;  2L7X A;  4UPG A;  2TN4 A;  2WND A;  3TZ1 A;  1UVF A;  1OE9 B;  2L8E A;  2ORW A;  3BUX B;  1QS7 A;  1YX7 A;  2ORV A;  3SGB I;  2K7C A;  1S5G Y;  3OHM B;  3AKA A;  1SGQ I;  1BG1 A;  2M7N A;  2LHL A;  3OXG A;  2XRC A;  1HJA I;  1H8B A;  2L5X B;  3DD4 A;  1A75 A;  2I94 A;  2LVK A;  1QVI Y;  1YUU A;  3O78 A;  3VGO A;  4DCK A;  4DS7 A;  2ARP F;  1OSA A;  1OMR A;  1WY9 A;  1M8C A;  1AJ4 A;  1WDC B;  2JRF A;  1R79 A;  2ROW A;  1K9K A;  1KMA A;  2LLT A;  1DJW A;  3DVM A;  2KGR A;  4UXI A;  2YUU A;  2AAO A;  2MHH A;  1J1E A;  1QLS A;  1MF8 B;  2NU0 I;  1UUC A;  1SKT A;  3JTD B;  4OV2 A;  3I5G C;  2F2O A;  4JPZ B;  1YVL A;  4PHK A;  2NU2 I;  3UEY A;  1WLM A;  1YUS A;  4N1F A;  2Y1N A;  2M49 B;  1QV0 A;  1Z7K B;  1YTZ C;  3SG2 A;  1DJY A;  3FWC A;  1BF5 A;  2OS8 B;  5PAL A;  4N1G A;  1TBQ R;  1CT2 I;  3TUY B;  3EVR A;  3EKH A;  1BOD A;  1J7O A;  4MLW A;  5ER4 X;  2WCB A;  3JVT C;  1TTX A;  4P5O E;  2BL0 C;  5I2O A;  2COL B;  1QJT A;  2V1C C;  4XYN A;  1NPQ A;  4CFR A;  1F4Q A;  2JW6 A;  2OTG B;  4ORA B;  4GUK A;  1E8A A;  1W4R A;  1OZS A;  3OL0 A;  1S1E A;  1TUS A;  2I18 A;  3FWB A;  2OPO A;  2Q91 A;  3TDU A;  1SBJ A;  5JOL A;  5HKY A;  1NUB A;  1JSA A;  4YI8 A;  1CNP A;  1JFJ A;  3MEK A;  3SEK C;  3SGQ I;  5JHW C;  3BUN B;  1H4B A;  3ZWH A;  2SGF I;  4A4C A;  2M97 A;  2EGD A;  1UWO A;  2NZ0 A;  1GQM A;  2BBM A;  1PAL A;  2G9B A;  1TIZ A;  4GGF C;  2L98 A;  1SCM C;  1XYD A;  5CSN A;  1V1F A;  3HX4 A;  4ORC B;  1CMG A;  1KK7 Y;  1N0Y A;  1NP8 A;  3D00 A;  4ZCV A;  4MZK A;  5HI7 A;  2FJU B;  2JT0 A;  3RM1 A;  1RRO A;  4MZJ A;  1S5G Z;  4CLN A;  4Q04 A;  3PDN A;  2WCY A;  2PMY A;  2KFH A;  2LM5 A;  1EG3 A;  4M2P A;  5CSF A;  1XK4 C;  1KK8 B;  1S26 D;  3VRO A;  2F3Z A;  2RGI A;  1Y1B A;  2M3W A;  1CM4 A;  1QVI Z;  2E73 A;  1B7T Z;  2DOQ A;  4JCV E;  3HCM A;  1PVB A;  1K9P A;  3BUO B;  3KPX A;  4DIR A;  1EG4 A;  2WC8 A;  4PHJ A;  4PE7 A;  2BUS A;  4QJ4 B;  3NSI A;  1L2O B;  2EHB A;  2LHI A;  4QJ3 B;  3CZT X;  4HGU A;  4YGA A;  2N1A B;  1SL7 A;  5IBW A;  1TBO A;  1KQM B;  5AER A;  2Y5I A;  2JWW A;  1CFP A;  2M1K B;  1GGZ A;  2ZND A;  3LLE A;  1K94 A;  2F8P A;  4BY5 A;  1WRK A;  1PSR A;  1RWY A;  2H61 A;  1FI5 A;  1DS2 I;  2E30 A;  5B8I B;  1LR7 A;  1IY5 A;  1FW4 A;  1AVS A;  2M8U A;  1V1H A;  3A8R A;  5DAE A;  2CTN A;  1NWD A;  4OVO A;  5FUV A;  2QPO A;  3I5F B;  4OKH A;  1MQ1 A;  3TS5 C;  1PRW A;  1UUS A;  4FQO A;  2K2F A;  4FKD A;  4R1E A;  1QIV A;  2FOT A;  1DJI A;  1S36 A;  1AK8 A;  4PE4 A;  3GK2 A;  3EVV A;  1TCF A;  1CM1 A;  2LUC A;  1F55 A;  3E3R A;  3KO0 A;  1K2H A;  1PPF I;  1DF0 B;  1OOJ A;  2SGE I;  1DTL A;  2LMU A;  5AAN A;  2LCP A;  4MN0 A;  3SG3 A;  1G4Y R;  1AN1 I;  2ENZ A;  2BCX A;  1DGV A;  2L4H A;  5JJG A;  2BCA A;  1RFJ A;  5FYX A;  2JZI A;  2KHN A;  5EX0 A;  4NDD A;  1F8H A;  3FIA A;  2GVI A;  3BUM B;  3EK4 A;  1XFU O;  1JC2 A;  3UGI A;  1IW4 A;  3SIA A;  1PSB A;  1UHK A;  1NX0 A;  1TNX A;  1AHR A;  3SG5 A;  3RU0 A;  5AFP A;  1CLL A;  3UGD A;  1K90 D;  1XFY O;  2Q4U A;  3F45 A;  1G33 A;  3CXL A;  2F3C I;  1QLK A;  2NLN A;  3PAT A;  4MEW A;  3ZNI A;  2KMR A;  3NSL A;  4OVN F;  2QQD A;  1QX2 A;  1SGD I;  3FC3 A;  1NCZ A;  1PK0 D;  1UHN A;  1DVI A;  1LXF C;  1S6I A;  2HF5 A;  2KBI A;  1DF0 A;  2PRU A;  3EVU A;  1VDD A;  2JOJ A;  5HLV A;  4F0Z B;  4C0K A;  1SGN I;  2A20 A;  2JZM A;  2FCE A;  2EC6 C;  3OXL A;  1WRL A;  3H4S E;  4PHM A;  1U5K A;  3GOX A;  2KNE A;  1QXP A;  4TNC A;  1TN4 A;  2L2E A;  1M39 A;  2M29 A;  2D8N A;  2LVV A;  3KEV A;  3QRX A;  1REC A;  1L7Z A;  2LV7 A;  3SIB A;  2GKR I;  2I7A A;  2ISD A;  1OMD A;  4AOM A;  1HT9 A;  2L51 A;  1X02 A;  1JWD A;  2QQE A;  1W7J B;  3I5H B;  2KCX A;  4AQI A;  4AQJ A;  2LC5 A;  1TNQ A;  2JNX A;  1B8R A;  1SPY A;  2KMQ A;  3VDP A;  1UHJ A;  5I2Q A;  1JF0 A;  3RLZ A;  1G8I A;  4M2Q A;  2SGP I;  2JQ6 A;  1H0Z A;  1GJY A;  4GPL B;  5AEQ A;  1F71 A;  2LNK A;  2JYY A;  1UP5 A;  1QX7 A;  1UUR A;  2LVI A;  5D7F A;  1M45 A;  1MUX A;  1R6P A;  2LP2 A;  3I5I B;  2NXQ A;  2O60 A;  2KAV A;  3VDU A;  4YGB B;  1C7W A;  3PFV A;  4A4B A;  4CPV A;  4FTG A;  2QQ0 A;  1IQ5 A;  3NXA A;  2BCB A;  1IJ6 A;  2ERW A;  3KY9 A;  2KMP A;  1Y1A A;  3VRQ A;  1CT0 I;  1B8L A;  1DJG A;  1QIW A;  3E59 A;  4E1R A;  2LLU A;  3A4U B;  2MLF C;  1WDC C;  3VRR A;  2VRG A;  1KWO B;  1SYM A;  2MBX A;  1NIW A;  1KQV A;  2MLE C;  2MAZ A;  4MBE A;  4OCI A;  1IH0 A;  1SL9 A;  2M0R A;  3EK8 A;  2QQC A;  2KSP A;  3SG7 A;  3VRP A;  1CB1 A;  1QTX A;  1SR6 B;  1KFU S;  1XA5 A;  2MA2 A;  3JTD C;  5CPV A;  3TDI A;  1EXR A;  3GOF A;  1MXL C;  2KI4 B;  2F33 A;  1K93 D;  1XA6 A;  4U8D A;  2NU1 I;  3OVO A;  1EH2 A;  1CFD A;  1TIH A;  1KSO A;  2ODD A;  3E2I A;  3MSE B;  2OS8 C;  2OVO A;  1Y1U A;  3TUY C;  5FUY A;  1N65 A;  1OVO A;  1XO5 A;  4YI9 A;  4E1P A;  4CFQ A;  3WHU B;  2L50 A;  1FF1 A;  2GKV A;  2CXJ A;  2QPT A;  1ALW A;  5KTY A;  1Y1C A;  1CLB A;  2ZRS A;  2GV5 A;  1TCO B;  2OTG C;  4I5L B;  2KFF A;  3LK1 A;  3LL8 B;  2O5G A;  3NSK A;  4MRX A;  1M31 A;  1R0R I;  1Y6W A;  1XK4 A;  2LLS A;  1SGY I;  4GFT A;  3AAK A;  4YGE B;  3DVE A;  5KSZ A;  2F3Y A;  1RFH A;  1MXE A;  1TOT A;  1ZFS A;  1YRT B;  4OR9 B;  3PN7 B;  1PTR A;  1EL4 A;  3NSO A;  1SMG A;  1EJ3 A;  4PHN A;  4M2O A;  1C07 A;  2DB6 A;  1K95 A;  2JA1 A;  2SCP A;  1KCY A;  1SGP I;  4HRE E;  3D0Y B;  5DKR A;  4WRI A;  2JPT A;  2ZNE A;  1BR1 B;  1NX1 A;  3O4Y A;  1Q80 A;  4N5X A;  1KSM A;  5FUW A;  1IWQ A;  1SCV A;  2JT3 A;  2ELI A;  5F6T A;  2AMI A;  2HPS A;  1NX2 A;  1W7I B;  2KFG A;  2CCM A;  4GNK B;  4MZL A;  1TOP A;  1MR8 A;  1YX8 A;  4HRG A;  2GKT I;  1OMV A;  1DJH A;  4PE1 A;  2GGM A;  1KK8 C;  2PSR A;  3OX5 A;  3QWP A;  2P6A C;  3B4V C;  2H61 C;  5HYD A;  2KYC A;  1SL8 A;  2LUX A;  2FCD A;  2K7B A;  1TUR A;  1TNP A;  1CGI I;  3D0Y A;  4I5J A;  2JXC A;  1L2O C;  3VRN A;  1QAS A;  3IQQ A;  1S6J A;  2E6W A;  3CR2 A;  5HKW A;  1RK9 A;  5I8N A;  1KFX S;  1FPW A;  1A4P A;  1QAT A;  1V1G A;  2NCP A;  1N13 A;  2KDH A;  3IQO A;  4IL1 A;  1CTR A;  1TBR R;  4BY4 A;  2K2A A;  1KQM C;  2ZFD A;  1KK7 Z;  1PJU A;  1F70 A;  1F54 A;  1ALV A;  1YUR A;  1TGS I;  3CS1 A;  1IJ5 A;  1LVC D;  2SAS A;  1DT7 B;  3BUW B;  2JT8 A;  1CHO I;  1MWN A;  2KAX A;  2K0J A;  1YU6 C;  4HSZ A;  1W3S A;  1HPT A;  1SY9 A;  2HET A;  2LAP A;  4D1E A;  2R2I A;  2YQP A;  4QJ5 B;  1KFU L;  1CDM A;  2L0P A;  1S6C A;  3I5F C;  2K7O A;  4PCW A;  4UXJ A;  1F4O A;  5KU1 A;  3C1V A;  1PVA A;  2JTT A;  5ER5 A;  3TDZ A;  2ZN8 A;  1OZO A;  2A4J A;  1J7Q A;  3I5G B;  1SK6 D;  2JU0 A;  2M1U A;  1JF2 A;  1BR4 B;  1UHI A;  4JQ0 D;  1BLQ A;  5CSI A;  2K61 A;  2W0T A;  2J87 A;  2JXL A;  1D1O A;  2SGD I;  1WRZ A;  5GQQ C;  2BEC A;  1TNW A;  2KOT A;  2PAL A;  1J7R A;  4MSP A;  4NDB A;  2Y4Q A;  4XJK B;  1IQ3 A;  1X74 A;  4WQ3 A;  1XX6 A;  1A03 A;  1K96 A;  2KI6 D;  2BKH B;  3JVT B;  4WQ2 A;  4PE0 A;  1ZAC A;  2BL0 B;  1DS3 I;  3D10 A;  1AUI B;  4USL A;  1M63 B;  1A29 A;  4YGD B;  4GI3 C;  2JUL A;  3K21 A;  1CFF A;  4GBA A;  2FNF X;  1IKU A;  3PLF B;  4GGN A;  1CFC A;  3WNX B;  1DJX A;  2MJW B;  1SGE I;  1XBT A;  3WHT B;  1BU3 A;  2KAY A;  1RJV A;  1TBN A;  1B7T Y;  1V1I A;  1JFK A;  3IF7 A;  2N71 A;  1U5I A;  1BOC A;  1ZOT B;  1SNL A;  3VE5 A;  4GAO A;  5TNC A;  1CDN A;  1MHO A;  2K9H A;  2BKI B;  1CT4 I;  2CBL A;  4XJK A;  2KMO A;  4PDZ A;  2KBM A;  1SCM B;  1FI6 A;  2LMV A;  1BUS A;  1K8U A;  3LCP C;  1LR8 A;  3FS7 A;  3UFF A;  2DIP A;  4UXH A;  1OMU A;  4L9M A;  2L4I A;  1Y8F A;  4B6D A;  2V1C A;  1WLZ A;  2B8T A;  4DUQ A;  1BT6 A;  1A2X A;  3ICB A;  1K9U A;  3M0W A;  3I5H C;  5K89 A;  4NQG A;  1CMF A;  2LUY A;  1J55 A;  3UEJ A;  3UGL A;  1ODB A;  4MRY A;  2V53 A;  2IS9 A;  1KFX L;  1Y0V H;  2ZRT A;  1XFX O;  1B8C A;  2AUC A;  2BE4 A;  2K7D A;  1PTQ A;  1CDL A;  4P2Y B;  3OXF A;  1FYB A;  5AXI A;  4HRH A;  2OD1 A;  2CNP A;  1UVG A;  2KI6 C;  1AP4 A;  4GGF A;  1B4C A;  4ORB B;  1KBE A;  1CLM A;  3CLN A;  4ETO A;  1X4S A;  2ZN9 A;  1CKK A;  1LIN A;  1XFW O;  3I5I C;  1VRK A;  2H2K A;  5D69 A;  5EX3 A;  3O6B A;  2LE9 B;  1XFZ O;  1B9A A;  1C7V A;  1SGR I;  1OQP A;  1JUO A;  2HQW A;  2MRD A;  3AAJ A;  5FUX A;  3AKB A;  3DF0 B;  1NSH A;  2M7L A;  3GK1 A;  1NCX A;  3BYA A;  2M5X A;  1B47 A;  1NYA A;  1KWO C;  2Y1M A;  4ZCU A;  1N2D A;  3TS5 B;  3WXA A;  1KBF A;  1LA0 A;  1QV1 A;  1FAR A;  1QX5 B;  2WOS A;  2N52 A;  4DRW A;  1SR6 C;  5BPJ A;  2LVJ A;  1XFV O;  1AJ5 A;  4JWQ A;  2BE6 A;  2PAS A;  1YTP A;  4C0J A;  2JC2 A;  2KI4 C;  3O2P A;  4I5N B;  1MT1 A;  1M8B A;  2LEO A;  1NCY A;  2K8M B;  1R2U A;  5HLO A;  1J7P A;  2F2P A;  4E68 A;  5CSJ A;  2HQ8 A;  3EK7 A;  3BOW B;  5DKN A;  4YRU A;  1LR9 A;  2LAN A;  1BMO A;  3DF0 A;  1ZMZ A;  3PAL A;  2WVJ A;  2JXD A;  2NU3 I;  5I2L A;  1FBV A;  1DMO A;  1M46 A;  1BJF A;  1DGU A;  2NCO A;  1NX3 A;  3CGA A;  3TJQ A;  3PM8 A;  2J9R A;  2KQ6 A;  4NDC A;  1LKJ A;  1IY6 A;  2JNF A;  1JBA A;  3BXK A;  2WCF A;  2UZ3 A;  5HQ8 A;  1YR5 A;  5CCL A;  2CT9 A;  2ZKM X;  1ZUZ A;  4I5K A;  1SW8 A;  2BBN A;  4ICB A;  1J1D A;  3OB1 B;  2B1U A;  2B0U C;  5G08 A;  1PUL A;  2N17 A;  2JTZ A;  1FAQ A;  3EKJ A;  3PN7 C;  1IG5 A;  1SRA A;  3CR4 X;  4A24 A;  2VRW B;  3KF9 A;  2GGZ A;  5J3X A;  2LMT A;  3QTL D;  3CTN A;  3SG4 A;  1Y1X A;  1HQV A;  3BOW A;  4C0L A;  4PAL A;  1XVJ A;  4YBH B;  2SGQ I;  3OP0 A;  2PVB A;  5DKQ A;  3LK0 A;  3DVK A;  2EC6 B;  1GGW A;  1CE3 A;  1IRJ A;  2ENN A;  2M9G A;  3CWG A;  3BJI A;  5HKZ A;  1OYV I;  3OB2 B;  1S3P A;  3DVJ A;  3SG6 A;  1UHH A;  2QAC A;  4CID A;  1YUT A;  1LA3 A;  3OX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...