1OVOA

Crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'LAAVSVDCSEYPKPACPKDYRPVCGSDNKTYSNKCNFCNAVVESNGTLTLNHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID THIRD DOMAIN
publication title Crystallographic refinement of Japanese quail ovomucoid, a Kazal-type inhibitor, and model building studies of complexes with serine proteases.
pubmed doi rcsb
source organism Coturnix japonica
molecule tags Proteinase inhibitor (kazal)
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1982-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ovoA00
1TBQR 2F3CI 2JXDA 1SGEI 3SEKC 1SGQI 2B0UC 1PCEA 2P6AC 1IW4A 1CGII 1HPTA 1CE3A 2SGQI 1KMAA 1PJUA 2ERWA 1MT1A 2KMPA 1BMOA 1AN1I 2V53A 5JHWC 1SGNI 1YU6C 2KMOA 2QQCA 5DAEA 3HH2C 1TGSI 2XRCA 3QTLD 1DS2I 1M8BA 1Y1CA 1LR9A 1SGRI 1UUCA 1IY6A 1M8CA 1H0ZA 2M5XA 1CT4I 2QQDA 2SGEI 1LR7A 1SGDI 2SGDI 1IY5A 1UVGA 2NU3I 3SGBI 1OVOA 1SGYI 2N52A 1Y1BA 4SGBI 1TBRR 2N71A 4GI3C 2ARPF 1PPFI 2KCXA 1FYBA 1OMUA 1TURA 1UVFA 1DS3I 3SGQI 2NU0I 2NU4I 2LEOA 2GKRI 2NU2I 2BUSA 1CGJI 1N13A 2SGPI 1CT0I 1TUSA 1TIHA 1SGPI 1R0RI 2WCYA 1Z7KB 2JYYA 2KMRA 1HJAI 2NU1I 1CHOI 2GKTI 3OVOA 3TJQA 4OVOA 2JZMA 3B4VC 2GKVA 1HDLA 2KMQA 1CSOI 1LR8A 1BUSA 1NUBA 4HGUA 1OYVI 2SGFI 2OVOA 1OMTA 2N17A 1YTPA 1CT2I
chains in the Genus database with same CATH superfamily
3UFFA 1TBQR 2F3CI 1ULNA 1WGCA 2ENZA 2JXDA 4MPIA 1SGEI 5CCMA 3SEKC 1SGQI 2B0UC 1PCEA 1XA6A 2N1AB 1NXUA 2P6AC 3E2IA 2ELIA 3MEKA 1FY7A 3OXLA 3OXFA 1IW4A 1CGII 1S20A 5FUYA 1KBFA 5CCLA 1HPTA 5EX0A 1CE3A 3OXGA 1W4RA 2J87A 1TBNA 2SGQI 4JCVE 1PJUA 2ERWA 2DB6A 2X3TA 3R5CA 1KMAA 1V1HA 1MT1A 1TOTA 1BMOA 1AN1I 1ULKA 2KMPA 2V53A 5JHWC 1VDDA 3R5AA 2RC4A 1WTJA 1SGNI 2OU2A 5J8CA 1FAQA 4A24A 4L9MA 2LB7A 1YU6C 2KMOA 2ORVA 2QQCA 2WGCA 3UGLA 3VDUA 2OD1A 5FUWA 3UGIA 5DAEA 2UVOA 3HH2C 2V1CA 4AMLA 1XBTA 1TGSI 2ODDA 1YTPA 2XRCA 3QTLD 2L7XA 3VE5A 2CWGA 7WGAA 4WP4A 1DS2I 1M8BA 3TOAA 3R5DA 3GOXA 1PTRA 1Y1CA 3BJIA 3OL0A 2LUYA 1PTQA 1LR9A 1MJBA 1SGRI 1UUCA 2CWHA 1ULMA 1IY6A 1M8CA 2X52A 1H0ZA 3UEYA 2M5XA 3UOEA 1CT4I 2QQDA 4UXIA 4B6DA 2SGEI 1R79A 1U5KA 1K7UA 1LR7A 1Y8FA 2CJSC 2DIPA 1X74A 1IY5A 2SGDI 1UVGA 2NU3I 3FSXA 3TO7A 1P9GA 3UEJA 3SGBI 1OVOA 5E3PA 1SGYI 5E3QA 2N52A 1UHAA 1Y1BA 3KY9A 1X4SA 4SGBI 1TBRR 2N71A 4GI3C 1WKXA 2ARPF 3E59A 4E1PA 2JA1A 2K9HA 3QWPA 1FARA 1PPFI 2KCXA 3RU0A 1KBEA 1FYBA 1OMUA 3TO6A 1TURA 2YQPA 1UVFA 1DS3I 1Q9BA 2QQ0A 1MJ9A 3SGQI 5EX3A 2NU0I 2NU4I 3D00A 2LEOA 2GKRI 1WGTA 1RFHA 2NU2I 2BUSA 1CGJI 1N13A 2SGPI 1CT0I 2VRWB 2YUUA 1TBOA 2A20A 3QAHA 2WVJA 1TUSA 1V1IA 4UXJA 1TIHA 5FUXA 3UGDA 1K7TA 2FNFX 1SGPI 1R0RI 2W0TA 2WCYA 3FSYA 3VDPA 1Z7KB 2JYYA 2V1CC 2KMRA 4DNCA 1K7VA 1W3SA 5HQ8A 1MJAA 1HJAI 1XX6A 2NU1I 2ROWA 4E1RA 1CHOI 2GKTI 3OVOA 3TJQA 2J9RA 3CXLA 4OVOA 2JZMA 1Z2IA 2UZ3A 2PQ8A 3B4VC 2GVIA 2CWFA 2GKVA 1HDLA 2KMQA 3R5BA 1CSOI 2L8EA 1LR8A 3PDNA 3TOBA 5E3RA 1BUSA 2RIJA 1NUBA 1P9ZA 9WGAA 5J8FA 2ENNA 2GIVA 4HGUA 2ORWA 4UXHA 2E5RA 5HI7A 2JW6A 2QQEA 3FC3A 1OYVI 2OZUA 2SGFI 5FUVA 2OVOA 2DKVA 3TO9A 2QPOA 1OMTA 4FKDA 1HEVA 2E73A 2N17A 2B8TA 1SGDI 2Y0MA 1CT2I
chains in the Genus database with same CATH topology
3UFFA 1TBQR 2F3CI 2ENZA 2JXDA 1SGEI 5CCMA 3SEKC 1SGQI 2B0UC 1PCEA 1XA6A 2N1AB 2P6AC 3E2IA 3OXLA 2ELIA 3MEKA 1IW4A 3OXFA 1CGII 1KBFA 5FUYA 5CCLA 1HPTA 5EX0A 1CE3A 3OXGA 1W4RA 2J87A 1TBNA 2SGQI 4JCVE 1PJUA 2ERWA 2DB6A 1KMAA 1V1HA 1MT1A 1TOTA 1BMOA 1AN1I 2KMPA 2V53A 5JHWC 1VDDA 1SGNI 1FAQA 4A24A 4L9MA 2ORVA 1YU6C 2KMOA 2QQCA 3UGLA 3VDUA 2OD1A 5FUWA 3UGIA 5DAEA 3HH2C 2V1CA 1XBTA 1TGSI 2ODDA 2XRCA 3QTLD 2L7XA 3VE5A 3GOXA 1DS2I 1M8BA 1PTRA 1Y1CA 3BJIA 3OL0A 2LUYA 1PTQA 1LR9A 1SGRI 1UUCA 1IY6A 1M8CA 1H0ZA 3UEYA 2M5XA 1CT4I 2QQDA 4UXIA 4B6DA 2SGEI 1R79A 1U5KA 1LR7A 1Y8FA 2CJSC 2DIPA 1X74A 1SGDI 2SGDI 1IY5A 1UVGA 2NU3I 3UEJA 3SGBI 1OVOA 1SGYI 2N52A 1Y1BA 3KY9A 1X4SA 4SGBI 1TBRR 2N71A 4GI3C 2ARPF 3E59A 4E1PA 2JA1A 2K9HA 3QWPA 1FARA 1PPFI 2KCXA 3RU0A 1KBEA 1FYBA 1OMUA 1TURA 2YQPA 1UVFA 1DS3I 2QQ0A 3SGQI 5EX3A 2NU0I 2NU4I 3D00A 2LEOA 2GKRI 1RFHA 2NU2I 2BUSA 1CGJI 1N13A 2SGPI 1CT0I 2VRWB 2YUUA 1TBOA 2A20A 2WVJA 1TUSA 1V1IA 4UXJA 1TIHA 5FUXA 3UGDA 2FNFX 1SGPI 1R0RI 2W0TA 2WCYA 3VDPA 1Z7KB 2JYYA 2V1CC 2KMRA 1W3SA 5HQ8A 1HJAI 1XX6A 2NU1I 2ROWA 4E1RA 1CHOI 2GKTI 3OVOA 3TJQA 2J9RA 3CXLA 4OVOA 2JZMA 2UZ3A 3B4VC 2GVIA 2GKVA 1HDLA 2KMQA 1CSOI 2L8EA 1LR8A 3PDNA 1BUSA 1NUBA 2ENNA 4HGUA 2ORWA 4UXHA 2E5RA 5HI7A 2JW6A 2QQEA 3FC3A 1OYVI 2SGFI 5FUVA 2OVOA 2QPOA 1OMTA 4FKDA 2E73A 2N17A 2B8TA 1YTPA 1CT2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBQ R;  2F3C I;  2JXD A;  1SGE I;  3SEK C;  1SGQ I;  2B0U C;  1PCE A;  2P6A C;  1IW4 A;  1CGI I;  1HPT A;  1CE3 A;  2SGQ I;  1KMA A;  1PJU A;  2ERW A;  1MT1 A;  2KMP A;  1BMO A;  1AN1 I;  2V53 A;  5JHW C;  1SGN I;  1YU6 C;  2KMO A;  2QQC A;  5DAE A;  3HH2 C;  1TGS I;  2XRC A;  3QTL D;  1DS2 I;  1M8B A;  1Y1C A;  1LR9 A;  1SGR I;  1UUC A;  1IY6 A;  1M8C A;  1H0Z A;  2M5X A;  1CT4 I;  2QQD A;  2SGE I;  1LR7 A;  1SGD I;  2SGD I;  1IY5 A;  1UVG A;  2NU3 I;  3SGB I;  1OVO A;  1SGY I;  2N52 A;  1Y1B A;  4SGB I;  1TBR R;  2N71 A;  4GI3 C;  2ARP F;  1PPF I;  2KCX A;  1FYB A;  1OMU A;  1TUR A;  1UVF A;  1DS3 I;  3SGQ I;  2NU0 I;  2NU4 I;  2LEO A;  2GKR I;  2NU2 I;  2BUS A;  1CGJ I;  1N13 A;  2SGP I;  1CT0 I;  1TUS A;  1TIH A;  1SGP I;  1R0R I;  2WCY A;  1Z7K B;  2JYY A;  2KMR A;  1HJA I;  2NU1 I;  1CHO I;  2GKT I;  3OVO A;  3TJQ A;  4OVO A;  2JZM A;  3B4V C;  2GKV A;  1HDL A;  2KMQ A;  1CSO I;  1LR8 A;  1BUS A;  1NUB A;  4HGU A;  1OYV I;  2SGF I;  2OVO A;  1OMT A;  2N17 A;  1YTP A;  1CT2 I; 
#chains in the Genus database with same CATH topology
 3UFF A;  1TBQ R;  2F3C I;  1ULN A;  1WGC A;  2ENZ A;  2JXD A;  4MPI A;  1SGE I;  5CCM A;  3SEK C;  1SGQ I;  2B0U C;  1PCE A;  1XA6 A;  2N1A B;  1NXU A;  2P6A C;  3E2I A;  2ELI A;  3MEK A;  1FY7 A;  3OXL A;  3OXF A;  1IW4 A;  1CGI I;  1S20 A;  5FUY A;  1KBF A;  5CCL A;  1HPT A;  5EX0 A;  1CE3 A;  3OXG A;  1W4R A;  2J87 A;  1TBN A;  2SGQ I;  4JCV E;  1PJU A;  2ERW A;  2DB6 A;  2X3T A;  3R5C A;  1KMA A;  1V1H A;  1MT1 A;  1TOT A;  1BMO A;  1AN1 I;  1ULK A;  2KMP A;  2V53 A;  5JHW C;  1VDD A;  3R5A A;  2RC4 A;  1WTJ A;  1SGN I;  2OU2 A;  5J8C A;  1FAQ A;  4A24 A;  4L9M A;  2LB7 A;  1YU6 C;  2KMO A;  2ORV A;  2QQC A;  2WGC A;  3UGL A;  3VDU A;  2OD1 A;  5FUW A;  3UGI A;  5DAE A;  2UVO A;  3HH2 C;  2V1C A;  4AML A;  1XBT A;  1TGS I;  2ODD A;  1YTP A;  2XRC A;  3QTL D;  2L7X A;  3VE5 A;  2CWG A;  7WGA A;  4WP4 A;  1DS2 I;  1M8B A;  3TOA A;  3R5D A;  3GOX A;  1PTR A;  1Y1C A;  3BJI A;  3OL0 A;  2LUY A;  1PTQ A;  1LR9 A;  1MJB A;  1SGR I;  1UUC A;  2CWH A;  1ULM A;  1IY6 A;  1M8C A;  2X52 A;  1H0Z A;  3UEY A;  2M5X A;  3UOE A;  1CT4 I;  2QQD A;  4UXI A;  4B6D A;  2SGE I;  1R79 A;  1U5K A;  1K7U A;  1LR7 A;  1Y8F A;  2CJS C;  2DIP A;  1X74 A;  1IY5 A;  2SGD I;  1UVG A;  2NU3 I;  3FSX A;  3TO7 A;  1P9G A;  3UEJ A;  3SGB I;  1OVO A;  5E3P A;  1SGY I;  5E3Q A;  2N52 A;  1UHA A;  1Y1B A;  3KY9 A;  1X4S A;  4SGB I;  1TBR R;  2N71 A;  4GI3 C;  1WKX A;  2ARP F;  3E59 A;  4E1P A;  2JA1 A;  2K9H A;  3QWP A;  1FAR A;  1PPF I;  2KCX A;  3RU0 A;  1KBE A;  1FYB A;  1OMU A;  3TO6 A;  1TUR A;  2YQP A;  1UVF A;  1DS3 I;  1Q9B A;  2QQ0 A;  1MJ9 A;  3SGQ I;  5EX3 A;  2NU0 I;  2NU4 I;  3D00 A;  2LEO A;  2GKR I;  1WGT A;  1RFH A;  2NU2 I;  2BUS A;  1CGJ I;  1N13 A;  2SGP I;  1CT0 I;  2VRW B;  2YUU A;  1TBO A;  2A20 A;  3QAH A;  2WVJ A;  1TUS A;  1V1I A;  4UXJ A;  1TIH A;  5FUX A;  3UGD A;  1K7T A;  2FNF X;  1SGP I;  1R0R I;  2W0T A;  2WCY A;  3FSY A;  3VDP A;  1Z7K B;  2JYY A;  2V1C C;  2KMR A;  4DNC A;  1K7V A;  1W3S A;  5HQ8 A;  1MJA A;  1HJA I;  1XX6 A;  2NU1 I;  2ROW A;  4E1R A;  1CHO I;  2GKT I;  3OVO A;  3TJQ A;  2J9R A;  3CXL A;  4OVO A;  2JZM A;  1Z2I A;  2UZ3 A;  2PQ8 A;  3B4V C;  2GVI A;  2CWF A;  2GKV A;  1HDL A;  2KMQ A;  3R5B A;  1CSO I;  2L8E A;  1LR8 A;  3PDN A;  3TOB A;  5E3R A;  1BUS A;  2RIJ A;  1NUB A;  1P9Z A;  9WGA A;  5J8F A;  2ENN A;  2GIV A;  4HGU A;  2ORW A;  4UXH A;  2E5R A;  5HI7 A;  2JW6 A;  2QQE A;  3FC3 A;  1OYV I;  2OZU A;  2SGF I;  5FUV A;  2OVO A;  2DKV A;  3TO9 A;  2QPO A;  1OMT A;  4FKD A;  1HEV A;  2E73 A;  2N17 A;  2B8T A;  1SGD I;  2Y0M A;  1CT2 I; 
#chains in the Genus database with same CATH homology
 3UFF A;  1TBQ R;  2F3C I;  2ENZ A;  2JXD A;  1SGE I;  5CCM A;  3SEK C;  1SGQ I;  2B0U C;  1PCE A;  1XA6 A;  2N1A B;  2P6A C;  3E2I A;  3OXL A;  2ELI A;  3MEK A;  1IW4 A;  3OXF A;  1CGI I;  1KBF A;  5FUY A;  5CCL A;  1HPT A;  5EX0 A;  1CE3 A;  3OXG A;  1W4R A;  2J87 A;  1TBN A;  2SGQ I;  4JCV E;  1PJU A;  2ERW A;  2DB6 A;  1KMA A;  1V1H A;  1MT1 A;  1TOT A;  1BMO A;  1AN1 I;  2KMP A;  2V53 A;  5JHW C;  1VDD A;  1SGN I;  1FAQ A;  4A24 A;  4L9M A;  2ORV A;  1YU6 C;  2KMO A;  2QQC A;  3UGL A;  3VDU A;  2OD1 A;  5FUW A;  3UGI A;  5DAE A;  3HH2 C;  2V1C A;  1XBT A;  1TGS I;  2ODD A;  2XRC A;  3QTL D;  2L7X A;  3VE5 A;  3GOX A;  1DS2 I;  1M8B A;  1PTR A;  1Y1C A;  3BJI A;  3OL0 A;  2LUY A;  1PTQ A;  1LR9 A;  1SGR I;  1UUC A;  1IY6 A;  1M8C A;  1H0Z A;  3UEY A;  2M5X A;  1CT4 I;  2QQD A;  4UXI A;  4B6D A;  2SGE I;  1R79 A;  1U5K A;  1LR7 A;  1Y8F A;  2CJS C;  2DIP A;  1X74 A;  1SGD I;  2SGD I;  1IY5 A;  1UVG A;  2NU3 I;  3UEJ A;  3SGB I;  1OVO A;  1SGY I;  2N52 A;  1Y1B A;  3KY9 A;  1X4S A;  4SGB I;  1TBR R;  2N71 A;  4GI3 C;  2ARP F;  3E59 A;  4E1P A;  2JA1 A;  2K9H A;  3QWP A;  1FAR A;  1PPF I;  2KCX A;  3RU0 A;  1KBE A;  1FYB A;  1OMU A;  1TUR A;  2YQP A;  1UVF A;  1DS3 I;  2QQ0 A;  3SGQ I;  5EX3 A;  2NU0 I;  2NU4 I;  3D00 A;  2LEO A;  2GKR I;  1RFH A;  2NU2 I;  2BUS A;  1CGJ I;  1N13 A;  2SGP I;  1CT0 I;  2VRW B;  2YUU A;  1TBO A;  2A20 A;  2WVJ A;  1TUS A;  1V1I A;  4UXJ A;  1TIH A;  5FUX A;  3UGD A;  2FNF X;  1SGP I;  1R0R I;  2W0T A;  2WCY A;  3VDP A;  1Z7K B;  2JYY A;  2V1C C;  2KMR A;  1W3S A;  5HQ8 A;  1HJA I;  1XX6 A;  2NU1 I;  2ROW A;  4E1R A;  1CHO I;  2GKT I;  3OVO A;  3TJQ A;  2J9R A;  3CXL A;  4OVO A;  2JZM A;  2UZ3 A;  3B4V C;  2GVI A;  2GKV A;  1HDL A;  2KMQ A;  1CSO I;  2L8E A;  1LR8 A;  3PDN A;  1BUS A;  1NUB A;  2ENN A;  4HGU A;  2ORW A;  4UXH A;  2E5R A;  5HI7 A;  2JW6 A;  2QQE A;  3FC3 A;  1OYV I;  2SGF I;  5FUV A;  2OVO A;  2QPO A;  1OMT A;  4FKD A;  2E73 A;  2N17 A;  2B8T A;  1YTP A;  1CT2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...