2X52A

Crystal structure of wheat germ agglutinin isolectin 3 in complex with a synthetic divalent carbohydrate ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ ISOLECTIN 3
publication title Structural Basis of Multivalent Binding to Wheat Germ Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A01
4MPIA 4AMLA 1HEVA 1UHAA 2CWGA 1Q9BA 2WGCA 1ULKA 7WGAA 2DKVA 1P9GA 1K7UA 2UVOA 2X52A 9WGAA 2X3TA 4WP4A 1WGTA 1K7VA 1WKXA 2LB7A 1K7TA 1ULNA 1ULMA 1P9ZA 1WGCA
chains in the Genus database with same CATH superfamily
5CCLA 4SGBI 5CCMA 2LUYA 2LEOA 1BMOA 1XA6A 4MPIA 1HEVA 1OYVI 3FSXA 4FKDA 1CT2I 5E3RA 1HJAI 1UUCA 2ROWA 3UGDA 2UZ3A 4DNCA 1XBTA 3R5CA 3VDPA 1Z7KB 2ARPF 1Y1BA 1TBRR 1HPTA 2L8EA 3OXFA 5FUWA 2KMQA 1TURA 5E3QA 1X74A 1NUBA 2QQCA 2QQEA 4A24A 3GOXA 1K7UA 1S20A 1DS2I 1SGEI 2N71A 2NU2I 2B8TA 2UVOA 2GKTI 9WGAA 2JA1A 2OVOA 5JHWC 1YTPA 1N13A 2GVIA 1SGNI 1WGTA 2GKVA 1LR8A 2WVJA 1OMTA 1KMAA 2DB6A 4UXIA 3PDNA 1WKXA 2SGPI 4JCVE 4L9MA 3UFFA 1MJAA 2JYYA 1ULNA 2SGFI 2ENNA 2KMPA 3B4VC 1TBQR 3QTLD 4E1PA 2XRCA 3FSYA 5EX0A 5E3PA 2ELIA 3SGBI 1CT0I 2J9RA 2RIJA 1CGII 1KBEA 3SGQI 4AMLA 1W3SA 1HDLA 1XX6A 1Q9BA 1M8CA 2ODDA 1M8BA 1TGSI 2WGCA 5DAEA 1SGPI 1DS3I 5HI7A 2NU4I 1OVOA 1X4SA 2DKVA 3HH2C 3OXLA 4E1RA 1KBFA 1P9GA 2QQDA 3E2IA 1H0ZA 2CJSC 3BJIA 3TO7A 2JXDA 2NU3I 2V1CA 2ORWA 3QAHA 2VRWB 5FUXA 4WP4A 3TOBA 1TUSA 1NXUA 1PPFI 2ERWA 4OVOA 3UGLA 1FYBA 1FY7A 1YU6C 2E73A 2QPOA 2YUUA 3D00A 3VDUA 3TO6A 2A20A 3E59A 1IY6A 1WTJA 1V1HA 4GI3C 1IY5A 2ENZA 2SGDI 1R79A 3RU0A 2CWGA 2QQ0A 2KCXA 3OL0A 1SGYI 1OMUA 3SEKC 1Z2IA 1ULKA 3R5AA 2B0UC 3OVOA 1SGDI 3R5BA 1PTRA 2GIVA 2YQPA 5FUYA 1FARA 1PJUA 1TOTA 1VDDA 1AN1I 2N17A 1Y8FA 2SGEI 1UVFA 2W0TA 2CWFA 2P6AC 2J87A 2E5RA 2L7XA 3TO9A 5HQ8A 1LR7A 2ORVA 2PQ8A 1FAQA 2V1CC 2N52A 1K7VA 1CT4I 2OD1A 1BUSA 2JZMA 3OXGA 1UVGA 2WCYA 5J8CA 1TBNA 1RFHA 1K7TA 1LR9A 2KMOA 1ULMA 1P9ZA 1W4RA 1WGCA 2NU0I 3MEKA 3R5DA 2F3CI 1PTQA 2M5XA 2JW6A 3VE5A 3TJQA 2GKRI 2V53A 1UHAA 3UEJA 1MJBA 1TIHA 1IW4A 5FUVA 2CWHA 2FNFX 1U5KA 2Y0MA 1SGRI 1TBOA 2OU2A 7WGAA 1V1IA 4B6DA 5EX3A 3UGIA 4HGUA 3UOEA 3FC3A 3KY9A 3TOAA 2KMRA 1CE3A 2NU1I 2BUSA 1MT1A 1PCEA 2DIPA 4UXHA 2SGQI 2X52A 4UXJA 1CSOI 1MJ9A 2RC4A 1Y1CA 2N1AB 2X3TA 1CHOI 2OZUA 3CXLA 1CGJI 3UEYA 5J8FA 3QWPA 2LB7A 2K9HA 1R0RI 1SGQI
chains in the Genus database with same CATH topology
4MPIA 4AMLA 1HEVA 1UHAA 2CWGA 1Q9BA 2WGCA 1ULKA 7WGAA 2DKVA 1P9GA 1K7UA 2UVOA 2X52A 9WGAA 2X3TA 4WP4A 1WGTA 1K7VA 1WKXA 2LB7A 1K7TA 1ULNA 1ULMA 1P9ZA 1WGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPI A;  4AML A;  1HEV A;  1UHA A;  2CWG A;  1Q9B A;  2WGC A;  1ULK A;  7WGA A;  2DKV A;  1P9G A;  1K7U A;  2UVO A;  2X52 A;  9WGA A;  2X3T A;  4WP4 A;  1WGT A;  1K7V A;  1WKX A;  2LB7 A;  1K7T A;  1ULN A;  1ULM A;  1P9Z A;  1WGC A; 
#chains in the Genus database with same CATH topology
 5CCL A;  4SGB I;  5CCM A;  2LUY A;  2LEO A;  1BMO A;  1XA6 A;  4MPI A;  1HEV A;  1OYV I;  3FSX A;  4FKD A;  1CT2 I;  5E3R A;  1HJA I;  1UUC A;  2ROW A;  3UGD A;  2UZ3 A;  4DNC A;  1XBT A;  3R5C A;  3VDP A;  1Z7K B;  2ARP F;  1Y1B A;  1TBR R;  1HPT A;  2L8E A;  3OXF A;  5FUW A;  2KMQ A;  1TUR A;  5E3Q A;  1X74 A;  1NUB A;  2QQC A;  2QQE A;  4A24 A;  3GOX A;  1K7U A;  1S20 A;  1DS2 I;  1SGE I;  2N71 A;  2NU2 I;  2B8T A;  2UVO A;  2GKT I;  9WGA A;  2JA1 A;  2OVO A;  5JHW C;  1YTP A;  1N13 A;  2GVI A;  1SGN I;  1WGT A;  2GKV A;  1LR8 A;  2WVJ A;  1OMT A;  1KMA A;  2DB6 A;  4UXI A;  3PDN A;  1WKX A;  2SGP I;  4JCV E;  4L9M A;  3UFF A;  1MJA A;  2JYY A;  1ULN A;  2SGF I;  2ENN A;  2KMP A;  3B4V C;  1TBQ R;  3QTL D;  4E1P A;  2XRC A;  3FSY A;  5EX0 A;  5E3P A;  2ELI A;  3SGB I;  1CT0 I;  2J9R A;  2RIJ A;  1CGI I;  1KBE A;  3SGQ I;  4AML A;  1W3S A;  1HDL A;  1XX6 A;  1Q9B A;  1M8C A;  2ODD A;  1M8B A;  1TGS I;  2WGC A;  5DAE A;  1SGP I;  1DS3 I;  5HI7 A;  2NU4 I;  1OVO A;  1X4S A;  2DKV A;  3HH2 C;  3OXL A;  4E1R A;  1KBF A;  1P9G A;  2QQD A;  3E2I A;  1H0Z A;  2CJS C;  3BJI A;  3TO7 A;  2JXD A;  2NU3 I;  2V1C A;  2ORW A;  3QAH A;  2VRW B;  5FUX A;  4WP4 A;  3TOB A;  1TUS A;  1NXU A;  1PPF I;  2ERW A;  4OVO A;  3UGL A;  1FYB A;  1FY7 A;  1YU6 C;  2E73 A;  2QPO A;  2YUU A;  3D00 A;  3VDU A;  3TO6 A;  2A20 A;  3E59 A;  1IY6 A;  1WTJ A;  1V1H A;  4GI3 C;  1IY5 A;  2ENZ A;  2SGD I;  1R79 A;  3RU0 A;  2CWG A;  2QQ0 A;  2KCX A;  3OL0 A;  1SGY I;  1OMU A;  3SEK C;  1Z2I A;  1ULK A;  3R5A A;  2B0U C;  3OVO A;  1SGD I;  3R5B A;  1PTR A;  2GIV A;  2YQP A;  5FUY A;  1FAR A;  1PJU A;  1TOT A;  1VDD A;  1AN1 I;  2N17 A;  1Y8F A;  2SGE I;  1UVF A;  2W0T A;  2CWF A;  2P6A C;  2J87 A;  2E5R A;  2L7X A;  3TO9 A;  5HQ8 A;  1LR7 A;  2ORV A;  2PQ8 A;  1FAQ A;  2V1C C;  2N52 A;  1K7V A;  1CT4 I;  2OD1 A;  1BUS A;  2JZM A;  3OXG A;  1UVG A;  2WCY A;  5J8C A;  1TBN A;  1RFH A;  1K7T A;  1LR9 A;  2KMO A;  1ULM A;  1P9Z A;  1W4R A;  1WGC A;  2NU0 I;  3MEK A;  3R5D A;  2F3C I;  1PTQ A;  2M5X A;  2JW6 A;  3VE5 A;  3TJQ A;  2GKR I;  2V53 A;  1UHA A;  3UEJ A;  1MJB A;  1TIH A;  1IW4 A;  5FUV A;  2CWH A;  2FNF X;  1U5K A;  2Y0M A;  1SGR I;  1TBO A;  2OU2 A;  7WGA A;  1V1I A;  4B6D A;  5EX3 A;  3UGI A;  4HGU A;  3UOE A;  3FC3 A;  3KY9 A;  3TOA A;  2KMR A;  1CE3 A;  2NU1 I;  2BUS A;  1MT1 A;  1PCE A;  2DIP A;  4UXH A;  2SGQ I;  2X52 A;  4UXJ A;  1CSO I;  1MJ9 A;  2RC4 A;  1Y1C A;  2N1A B;  2X3T A;  1CHO I;  2OZU A;  3CXL A;  1CGJ I;  3UEY A;  5J8F A;  3QWP A;  2LB7 A;  2K9H A;  1R0R I;  1SGQ I; 
#chains in the Genus database with same CATH homology
 4MPI A;  4AML A;  1HEV A;  1UHA A;  2CWG A;  1Q9B A;  2WGC A;  1ULK A;  7WGA A;  2DKV A;  1P9G A;  1K7U A;  2UVO A;  2X52 A;  9WGA A;  2X3T A;  4WP4 A;  1WGT A;  1K7V A;  1WKX A;  2LB7 A;  1K7T A;  1ULN A;  1ULM A;  1P9Z A;  1WGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...