2X52A

Crystal structure of wheat germ agglutinin isolectin 3 in complex with a synthetic divalent carbohydrate ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords AGGLUTININ ISOLECTIN 3
publication title Structural Basis of Multivalent Binding to Wheat Germ Agglutinin.
pubmed doi rcsb
total genus 50
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A01
1K7TA 1UHAA 2CWGA 2LB7A 1K7UA 4MPIA 1ULKA 4WP4A 2X3TA 9WGAA 1HEVA 1WGCA 2UVOA 4AMLA 1WGTA 1P9GA 1Q9BA 2X52A 7WGAA 2WGCA 2DKVA 1WKXA 1K7VA 1ULNA 1ULMA 1P9ZA
chains in the Genus database with same CATH superfamily
1TGSI 1CT4I 2SGQI 2V1CC 5E3RA 1SGEI 1WTJA 1TOTA 4FKDA 3FSYA 1YU6C 2LB7A 3E59A 3UFFA 3R5AA 2L8EA 5EX0A 1UUCA 1SGNI 1K7UA 2W0TA 3TOAA 1UVFA 2ORVA 2FNFX 1HEVA 3FSXA 3VE5A 1CSOI 2NU1I 2B8TA 3D00A 1P9GA 1Q9BA 2QQ0A 1CGJI 1XBTA 3UGDA 2N52A 1Y8FA 4JCVE 1OYVI 2L7XA 1CGII 2YUUA 1HJAI 2CJSC 2QQCA 1V1HA 3FC3A 2OD1A 1LR7A 1UVGA 1PTRA 1YTPA 3R5BA 3RU0A 1BUSA 1DS2I 2P6AC 2GKTI 4HGUA 1OVOA 1RFHA 3GOXA 5CCLA 1IY5A 1K7TA 1SGQI 1Z7KB 2GIVA 2CWGA 1KBFA 1LR9A 3R5DA 1MJAA 5JHWC 4UXJA 1ULKA 2DIPA 2X3TA 2ERWA 2B0UC 2JZMA 2QQEA 2WVJA 1KMAA 1TBNA 2UVOA 2NU2I 4AMLA 1WGTA 1CT2I 1NUBA 1M8BA 2LUYA 5E3QA 1IW4A 2WCYA 1TBQR 2GKRI 1OMUA 2QPOA 2SGDI 2SGFI 3PDNA 1XA6A 4UXIA 2LEOA 2RIJA 2KMPA 5HI7A 2KMRA 2DB6A 4UXHA 1TURA 2SGPI 2J9RA 1DS3I 2V1CA 3UGIA 1WKXA 2ENNA 1FAQA 2ELIA 3TOBA 2ROWA 2A20A 3HH2C 3QAHA 5DAEA 1MJ9A 5CCMA 4B6DA 1AN1I 1S20A 3R5CA 3TO7A 1HDLA 1SGYI 2PQ8A 5FUYA 3BJIA 3CXLA 1TIHA 4MPIA 5E3PA 4WP4A 3OVOA 2VRWB 1XX6A 3OXGA 9WGAA 2CWHA 1W3SA 1TUSA 1Y1BA 2N1AB 3KY9A 1PJUA 1X4SA 2ARPF 2UZ3A 1FY7A 3UEJA 3QWPA 3UGLA 2NU4I 2X52A 1CE3A 5J8CA 1VDDA 3OXLA 4E1RA 1R79A 2N17A 3SGQI 2QQDA 1PTQA 2F3CI 2OZUA 2ORWA 1Y1CA 1SGDI 1PCEA 4GI3C 1LR8A 1M8CA 1TBOA 2NU3I 5EX3A 2XRCA 3SGBI 4E1PA 2KCXA 3VDPA 1N13A 1MT1A 1V1IA 3TJQA 1ULNA 1ULMA 1P9ZA 2BUSA 2K9HA 3B4VC 1KBEA 2JXDA 5FUWA 3TO6A 2RC4A 1UHAA 2JA1A 2ODDA 5J8FA 1CHOI 4SGBI 1IY6A 2OU2A 2GKVA 1FARA 1BMOA 3MEKA 2Y0MA 1X74A 2N71A 3UOEA 1WGCA 4DNCA 1Z2IA 2J87A 5HQ8A 1TBRR 1CT0I 1HPTA 1H0ZA 3VDUA 1R0RI 5FUVA 1OMTA 2CWFA 7WGAA 3UEYA 2V53A 2KMOA 5FUXA 2WGCA 2GVIA 1SGPI 2E73A 4OVOA 3OL0A 2M5XA 3TO9A 1U5KA 1W4RA 1PPFI 2DKVA 1SGRI 2KMQA 2E5RA 2ENZA 2JYYA 2YQPA 1FYBA 2NU0I 3E2IA 2JW6A 3OXFA 1K7VA 2OVOA 2SGEI 3QTLD 1MJBA 3SEKC 4A24A 1NXUA 4L9MA
chains in the Genus database with same CATH topology
1K7TA 1UHAA 2CWGA 2LB7A 1K7UA 4MPIA 1ULKA 4WP4A 2X3TA 9WGAA 1HEVA 1WGCA 2UVOA 4AMLA 1WGTA 1P9GA 1Q9BA 2X52A 7WGAA 2WGCA 2DKVA 1WKXA 1K7VA 1ULNA 1ULMA 1P9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7T A;  1UHA A;  2CWG A;  2LB7 A;  1K7U A;  4MPI A;  1ULK A;  4WP4 A;  2X3T A;  9WGA A;  1HEV A;  1WGC A;  2UVO A;  4AML A;  1WGT A;  1P9G A;  1Q9B A;  2X52 A;  7WGA A;  2WGC A;  2DKV A;  1WKX A;  1K7V A;  1ULN A;  1ULM A;  1P9Z A; 
#chains in the Genus database with same CATH topology
 1TGS I;  1CT4 I;  2SGQ I;  2V1C C;  5E3R A;  1SGE I;  1WTJ A;  1TOT A;  4FKD A;  3FSY A;  1YU6 C;  2LB7 A;  3E59 A;  3UFF A;  3R5A A;  2L8E A;  5EX0 A;  1UUC A;  1SGN I;  1K7U A;  2W0T A;  3TOA A;  1UVF A;  2ORV A;  2FNF X;  1HEV A;  3FSX A;  3VE5 A;  1CSO I;  2NU1 I;  2B8T A;  3D00 A;  1P9G A;  1Q9B A;  2QQ0 A;  1CGJ I;  1XBT A;  3UGD A;  2N52 A;  1Y8F A;  4JCV E;  1OYV I;  2L7X A;  1CGI I;  2YUU A;  1HJA I;  2CJS C;  2QQC A;  1V1H A;  3FC3 A;  2OD1 A;  1LR7 A;  1UVG A;  1PTR A;  1YTP A;  3R5B A;  3RU0 A;  1BUS A;  1DS2 I;  2P6A C;  2GKT I;  4HGU A;  1OVO A;  1RFH A;  3GOX A;  5CCL A;  1IY5 A;  1K7T A;  1SGQ I;  1Z7K B;  2GIV A;  2CWG A;  1KBF A;  1LR9 A;  3R5D A;  1MJA A;  5JHW C;  4UXJ A;  1ULK A;  2DIP A;  2X3T A;  2ERW A;  2B0U C;  2JZM A;  2QQE A;  2WVJ A;  1KMA A;  1TBN A;  2UVO A;  2NU2 I;  4AML A;  1WGT A;  1CT2 I;  1NUB A;  1M8B A;  2LUY A;  5E3Q A;  1IW4 A;  2WCY A;  1TBQ R;  2GKR I;  1OMU A;  2QPO A;  2SGD I;  2SGF I;  3PDN A;  1XA6 A;  4UXI A;  2LEO A;  2RIJ A;  2KMP A;  5HI7 A;  2KMR A;  2DB6 A;  4UXH A;  1TUR A;  2SGP I;  2J9R A;  1DS3 I;  2V1C A;  3UGI A;  1WKX A;  2ENN A;  1FAQ A;  2ELI A;  3TOB A;  2ROW A;  2A20 A;  3HH2 C;  3QAH A;  5DAE A;  1MJ9 A;  5CCM A;  4B6D A;  1AN1 I;  1S20 A;  3R5C A;  3TO7 A;  1HDL A;  1SGY I;  2PQ8 A;  5FUY A;  3BJI A;  3CXL A;  1TIH A;  4MPI A;  5E3P A;  4WP4 A;  3OVO A;  2VRW B;  1XX6 A;  3OXG A;  9WGA A;  2CWH A;  1W3S A;  1TUS A;  1Y1B A;  2N1A B;  3KY9 A;  1PJU A;  1X4S A;  2ARP F;  2UZ3 A;  1FY7 A;  3UEJ A;  3QWP A;  3UGL A;  2NU4 I;  2X52 A;  1CE3 A;  5J8C A;  1VDD A;  3OXL A;  4E1R A;  1R79 A;  2N17 A;  3SGQ I;  2QQD A;  1PTQ A;  2F3C I;  2OZU A;  2ORW A;  1Y1C A;  1SGD I;  1PCE A;  4GI3 C;  1LR8 A;  1M8C A;  1TBO A;  2NU3 I;  5EX3 A;  2XRC A;  3SGB I;  4E1P A;  2KCX A;  3VDP A;  1N13 A;  1MT1 A;  1V1I A;  3TJQ A;  1ULN A;  1ULM A;  1P9Z A;  2BUS A;  2K9H A;  3B4V C;  1KBE A;  2JXD A;  5FUW A;  3TO6 A;  2RC4 A;  1UHA A;  2JA1 A;  2ODD A;  5J8F A;  1CHO I;  4SGB I;  1IY6 A;  2OU2 A;  2GKV A;  1FAR A;  1BMO A;  3MEK A;  2Y0M A;  1X74 A;  2N71 A;  3UOE A;  1WGC A;  4DNC A;  1Z2I A;  2J87 A;  5HQ8 A;  1TBR R;  1CT0 I;  1HPT A;  1H0Z A;  3VDU A;  1R0R I;  5FUV A;  1OMT A;  2CWF A;  7WGA A;  3UEY A;  2V53 A;  2KMO A;  5FUX A;  2WGC A;  2GVI A;  1SGP I;  2E73 A;  4OVO A;  3OL0 A;  2M5X A;  3TO9 A;  1U5K A;  1W4R A;  1PPF I;  2DKV A;  1SGR I;  2KMQ A;  2E5R A;  2ENZ A;  2JYY A;  2YQP A;  1FYB A;  2NU0 I;  3E2I A;  2JW6 A;  3OXF A;  1K7V A;  2OVO A;  2SGE I;  3QTL D;  1MJB A;  3SEK C;  4A24 A;  1NXU A;  4L9M A; 
#chains in the Genus database with same CATH homology
 1K7T A;  1UHA A;  2CWG A;  2LB7 A;  1K7U A;  4MPI A;  1ULK A;  4WP4 A;  2X3T A;  9WGA A;  1HEV A;  1WGC A;  2UVO A;  4AML A;  1WGT A;  1P9G A;  1Q9B A;  2X52 A;  7WGA A;  2WGC A;  2DKV A;  1WKX A;  1K7V A;  1ULN A;  1ULM A;  1P9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...