2X52A

Crystal structure of wheat germ agglutinin isolectin 3 in complex with a synthetic divalent carbohydrate ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
b'ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ ISOLECTIN 3
publication title Structural Basis of Multivalent Binding to Wheat Germ Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2x52A01
1ULMA 1K7TA 1P9GA 1ULNA 4MPIA 2LB7A 2WGCA 4AMLA 1P9ZA 9WGAA 2DKVA 4WP4A 1WGTA 1UHAA 1WGCA 1K7VA 2CWGA 1WKXA 2X52A 1HEVA 1K7UA 2UVOA 1Q9BA 2X3TA 1ULKA 7WGAA
chains in the Genus database with same CATH superfamily
3RU0A 1HPTA 1MJ9A 1FARA 1BUSA 1MT1A 1P9GA 2DB6A 1PCEA 2QPOA 2JA1A 4UXIA 3UGIA 2WGCA 1XBTA 1SGQI 2QQ0A 2ORWA 3TOBA 2N52A 1Y8FA 5DAEA 2E73A 2ODDA 2GVIA 1U5KA 1TBNA 1Z7KB 2ERWA 5FUYA 3SGQI 1SGPI 3R5CA 1PTQA 4HGUA 2A20A 3OXLA 2GIVA 3VDPA 1K7VA 2E5RA 2QQCA 1PJUA 1PTRA 2PQ8A 3R5BA 2ELIA 1KBFA 3UFFA 2JYYA 3E59A 5JHWC 5J8CA 1W4RA 2VRWB 2ARPF 3OXGA 2Y0MA 1Q9BA 1DS2I 2OVOA 3E2IA 1V1IA 1TGSI 1TURA 2KMPA 2N1AB 1ULMA 2W0TA 2YUUA 1SGDI 1UUCA 1UVFA 1SGYI 2FNFX 3QWPA 3VDUA 2L8EA 4JCVE 1DS3I 1R79A 1TUSA 2J9RA 3QTLD 3UEJA 3VE5A 4FKDA 1LR7A 4UXJA 3KY9A 3TJQA 3TO9A 2JZMA 3R5AA 2WVJA 5FUWA 2JXDA 2P6AC 1NXUA 1M8CA 1VDDA 1LR9A 1R0RI 2NU2I 4WP4A 1X74A 5FUXA 1WGTA 2N71A 1UHAA 1IY6A 1FAQA 2CWGA 4OVOA 2V53A 3TO7A 1UVGA 1CGII 5CCLA 1SGEI 3OXFA 1YU6C 1CHOI 1LR8A 1IW4A 1WKXA 2SGFI 4GI3C 1X4SA 1SGNI 1TBQR 2NU1I 1CT2I 1K7UA 1Z2IA 1CSOI 3TOAA 2GKRI 1HDLA 2KMQA 2RC4A 2V1CA 2B8TA 2X3TA 5E3QA 3B4VC 2WCYA 1K7TA 5E3PA 2N17A 2M5XA 1M8BA 1TBOA 2LB7A 2K9HA 1P9ZA 2KMRA 3HH2C 1CT4I 2QQEA 3D00A 3PDNA 2ENZA 1SGRI 3SGBI 9WGAA 3FC3A 2OU2A 2KCXA 2NU3I 5E3RA 1OYVI 4SGBI 3OVOA 2DKVA 2XRCA 3GOXA 2B0UC 1MJAA 3CXLA 1WGCA 2BUSA 1TOTA 1CT0I 3R5DA 2NU4I 2SGPI 1CE3A 2QQDA 5EX0A 1MJBA 1AN1I 4DNCA 2V1CC 1KMAA 2NU0I 1HEVA 2SGDI 1PPFI 2ROWA 1BMOA 1WTJA 2SGEI 4L9MA 2OD1A 4A24A 2UZ3A 3MEKA 3FSYA 1Y1BA 7WGAA 1XA6A 1TBRR 4E1RA 2GKTI 2YQPA 1ULNA 2LUYA 5EX3A 1OMUA 4MPIA 3SEKC 4AMLA 2CWHA 1FY7A 2DIPA 2RIJA 1OMTA 2F3CI 3TO6A 1FYBA 1RFHA 5HQ8A 1N13A 2ORVA 2OZUA 1YTPA 2GKVA 1HJAI 2JW6A 3UGDA 3UGLA 5HI7A 1OVOA 3UEYA 1V1HA 4B6DA 1TIHA 2SGQI 1Y1CA 4E1PA 1CGJI 3BJIA 5FUVA 2LEOA 3FSXA 1NUBA 2KMOA 4UXHA 5J8FA 2L7XA 2CJSC 2X52A 1W3SA 1XX6A 3OL0A 2ENNA 3QAHA 1S20A 2UVOA 1H0ZA 5CCMA 2J87A 3UOEA 1KBEA 1IY5A 1ULKA 2CWFA
chains in the Genus database with same CATH topology
1ULMA 1K7TA 1P9GA 1ULNA 4MPIA 2LB7A 2WGCA 4AMLA 1P9ZA 9WGAA 2DKVA 4WP4A 1WGTA 1UHAA 1WGCA 1K7VA 2CWGA 1WKXA 2X52A 1HEVA 1K7UA 2UVOA 1Q9BA 2X3TA 1ULKA 7WGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULM A;  1K7T A;  1P9G A;  1ULN A;  4MPI A;  2LB7 A;  2WGC A;  4AML A;  1P9Z A;  9WGA A;  2DKV A;  4WP4 A;  1WGT A;  1UHA A;  1WGC A;  1K7V A;  2CWG A;  1WKX A;  2X52 A;  1HEV A;  1K7U A;  2UVO A;  1Q9B A;  2X3T A;  1ULK A;  7WGA A; 
#chains in the Genus database with same CATH topology
 3RU0 A;  1HPT A;  1MJ9 A;  1FAR A;  1BUS A;  1MT1 A;  1P9G A;  2DB6 A;  1PCE A;  2QPO A;  2JA1 A;  4UXI A;  3UGI A;  2WGC A;  1XBT A;  1SGQ I;  2QQ0 A;  2ORW A;  3TOB A;  2N52 A;  1Y8F A;  5DAE A;  2E73 A;  2ODD A;  2GVI A;  1U5K A;  1TBN A;  1Z7K B;  2ERW A;  5FUY A;  3SGQ I;  1SGP I;  3R5C A;  1PTQ A;  4HGU A;  2A20 A;  3OXL A;  2GIV A;  3VDP A;  1K7V A;  2E5R A;  2QQC A;  1PJU A;  1PTR A;  2PQ8 A;  3R5B A;  2ELI A;  1KBF A;  3UFF A;  2JYY A;  3E59 A;  5JHW C;  5J8C A;  1W4R A;  2VRW B;  2ARP F;  3OXG A;  2Y0M A;  1Q9B A;  1DS2 I;  2OVO A;  3E2I A;  1V1I A;  1TGS I;  1TUR A;  2KMP A;  2N1A B;  1ULM A;  2W0T A;  2YUU A;  1SGD I;  1UUC A;  1UVF A;  1SGY I;  2FNF X;  3QWP A;  3VDU A;  2L8E A;  4JCV E;  1DS3 I;  1R79 A;  1TUS A;  2J9R A;  3QTL D;  3UEJ A;  3VE5 A;  4FKD A;  1LR7 A;  4UXJ A;  3KY9 A;  3TJQ A;  3TO9 A;  2JZM A;  3R5A A;  2WVJ A;  5FUW A;  2JXD A;  2P6A C;  1NXU A;  1M8C A;  1VDD A;  1LR9 A;  1R0R I;  2NU2 I;  4WP4 A;  1X74 A;  5FUX A;  1WGT A;  2N71 A;  1UHA A;  1IY6 A;  1FAQ A;  2CWG A;  4OVO A;  2V53 A;  3TO7 A;  1UVG A;  1CGI I;  5CCL A;  1SGE I;  3OXF A;  1YU6 C;  1CHO I;  1LR8 A;  1IW4 A;  1WKX A;  2SGF I;  4GI3 C;  1X4S A;  1SGN I;  1TBQ R;  2NU1 I;  1CT2 I;  1K7U A;  1Z2I A;  1CSO I;  3TOA A;  2GKR I;  1HDL A;  2KMQ A;  2RC4 A;  2V1C A;  2B8T A;  2X3T A;  5E3Q A;  3B4V C;  2WCY A;  1K7T A;  5E3P A;  2N17 A;  2M5X A;  1M8B A;  1TBO A;  2LB7 A;  2K9H A;  1P9Z A;  2KMR A;  3HH2 C;  1CT4 I;  2QQE A;  3D00 A;  3PDN A;  2ENZ A;  1SGR I;  3SGB I;  9WGA A;  3FC3 A;  2OU2 A;  2KCX A;  2NU3 I;  5E3R A;  1OYV I;  4SGB I;  3OVO A;  2DKV A;  2XRC A;  3GOX A;  2B0U C;  1MJA A;  3CXL A;  1WGC A;  2BUS A;  1TOT A;  1CT0 I;  3R5D A;  2NU4 I;  2SGP I;  1CE3 A;  2QQD A;  5EX0 A;  1MJB A;  1AN1 I;  4DNC A;  2V1C C;  1KMA A;  2NU0 I;  1HEV A;  2SGD I;  1PPF I;  2ROW A;  1BMO A;  1WTJ A;  2SGE I;  4L9M A;  2OD1 A;  4A24 A;  2UZ3 A;  3MEK A;  3FSY A;  1Y1B A;  7WGA A;  1XA6 A;  1TBR R;  4E1R A;  2GKT I;  2YQP A;  1ULN A;  2LUY A;  5EX3 A;  1OMU A;  4MPI A;  3SEK C;  4AML A;  2CWH A;  1FY7 A;  2DIP A;  2RIJ A;  1OMT A;  2F3C I;  3TO6 A;  1FYB A;  1RFH A;  5HQ8 A;  1N13 A;  2ORV A;  2OZU A;  1YTP A;  2GKV A;  1HJA I;  2JW6 A;  3UGD A;  3UGL A;  5HI7 A;  1OVO A;  3UEY A;  1V1H A;  4B6D A;  1TIH A;  2SGQ I;  1Y1C A;  4E1P A;  1CGJ I;  3BJI A;  5FUV A;  2LEO A;  3FSX A;  1NUB A;  2KMO A;  4UXH A;  5J8F A;  2L7X A;  2CJS C;  2X52 A;  1W3S A;  1XX6 A;  3OL0 A;  2ENN A;  3QAH A;  1S20 A;  2UVO A;  1H0Z A;  5CCM A;  2J87 A;  3UOE A;  1KBE A;  1IY5 A;  1ULK A;  2CWF A; 
#chains in the Genus database with same CATH homology
 1ULM A;  1K7T A;  1P9G A;  1ULN A;  4MPI A;  2LB7 A;  2WGC A;  4AML A;  1P9Z A;  9WGA A;  2DKV A;  4WP4 A;  1WGT A;  1UHA A;  1WGC A;  1K7V A;  2CWG A;  1WKX A;  2X52 A;  1HEV A;  1K7U A;  2UVO A;  1Q9B A;  2X3T A;  1ULK A;  7WGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...