1Q9BA

Crystal structure analysis of hev b 6.02 (hevein) at 1.5 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hevein
publication title Insights into a conformational epitope of Hev b 6.02 (hevein).
pubmed doi rcsb
molecule tags Allergen
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1q9bA00
1WKXA 4MPIA 1WGCA 2X3TA 1ULKA 1K7VA 1ULMA 7WGAA 2LB7A 1Q9BA 2DKVA 1K7UA 2CWGA 1K7TA 2UVOA 4AMLA 2X52A 1P9GA 9WGAA 1ULNA 1UHAA 1WGTA 4WP4A 2WGCA 1P9ZA 1HEVA
chains in the Genus database with same CATH superfamily
1S20A 1Z7KB 3UEYA 1UUCA 4DNCA 1WKXA 1PCEA 2SGEI 2K9HA 3PDNA 5EX0A 2BUSA 2NU1I 2ORVA 2QQDA 4A24A 2XRCA 1X74A 1K7VA 2RC4A 2SGDI 1W3SA 1LR7A 1R0RI 2J87A 7WGAA 2CWHA 3MEKA 1Q9BA 2DKVA 2NU0I 1V1IA 2L8EA 2QPOA 1K7UA 5EX3A 1SGEI 1Z2IA 3UGIA 1NUBA 5CCLA 2GKRI 2JW6A 4AMLA 2P6AC 2X52A 2GKTI 1CE3A 4UXIA 3FSXA 1TURA 1P9GA 2CWFA 1PJUA 2W0TA 4JCVE 1W4RA 1TOTA 2F3CI 2LUYA 9WGAA 2N17A 1IW4A 1YU6C 5E3PA 1CGII 1CT2I 2M5XA 3HH2C 5FUYA 2KMPA 2J9RA 2ORWA 1HPTA 1Y8FA 1BMOA 3FC3A 1SGNI 4OVOA 5E3QA 1NXUA 2JYYA 1XBTA 1TIHA 3UFFA 5CCMA 1IY5A 3QAHA 1CHOI 2ENZA 2JA1A 2N1AB 1XA6A 2KCXA 2WVJA 1U5KA 4E1PA 3TOBA 2N71A 2NU4I 5E3RA 2ENNA 1LR8A 2B0UC 1K7TA 5HI7A 3KY9A 2QQEA 4UXHA 1DS2I 1RFHA 3R5DA 3SGBI 1HDLA 1TBOA 2DIPA 3OXGA 1M8BA 2B8TA 4UXJA 1MT1A 3R5BA 3UEJA 2LEOA 2UZ3A 3OXLA 3D00A 3RU0A 2V53A 1UVFA 1FAQA 1WGTA 1X4SA 3TOAA 1CGJI 3VE5A 1SGQI 1P9ZA 2OZUA 1OMTA 1Y1CA 3B4VC 4MPIA 3TO9A 1WGCA 2RIJA 5FUXA 2X3TA 5HQ8A 2OVOA 1UVGA 3OXFA 2JXDA 1CSOI 2YQPA 3BJIA 3QWPA 1HJAI 2SGQI 1ULMA 1PTQA 1CT4I 3TO7A 1DS3I 1SGYI 4GI3C 3E2IA 1M8CA 1TBQR 2N52A 3SGQI 1MJ9A 2WCYA 5J8CA 1KMAA 2ELIA 2UVOA 1N13A 1Y1BA 2L7XA 2NU3I 3VDUA 5FUVA 2KMQA 1PPFI 2E73A 2GIVA 2QQCA 5DAEA 1SGDI 2PQ8A 2SGPI 5J8FA 1TBNA 1TBRR 1FARA 2OU2A 1ULNA 2QQ0A 2VRWB 3CXLA 1FY7A 2V1CC 3UGDA 3E59A 1YTPA 2DB6A 1UHAA 2ERWA 4WP4A 1TUSA 1OYVI 3UOEA 1HEVA 1VDDA 1V1HA 4L9MA 2JZMA 4HGUA 1R79A 2V1CA 4E1RA 3UGLA 1MJAA 1OVOA 1AN1I 5JHWC 2SGFI 1ULKA 3FSYA 4B6DA 5FUWA 2FNFX 1SGRI 1TGSI 4SGBI 1OMUA 1WTJA 1SGPI 2ARPF 2LB7A 2YUUA 3GOXA 2A20A 2CWGA 2GVIA 1KBFA 3OL0A 1XX6A 2ODDA 1KBEA 2CJSC 1PTRA 2Y0MA 4FKDA 3R5CA 2NU2I 1LR9A 3SEKC 1BUSA 1FYBA 1MJBA 1CT0I 3VDPA 2GKVA 3OVOA 3QTLD 3R5AA 3TJQA 1IY6A 1H0ZA 2KMRA 2KMOA 2ROWA 2WGCA 3TO6A 2OD1A 2E5RA
chains in the Genus database with same CATH topology
1WKXA 4MPIA 1WGCA 2X3TA 1ULKA 1K7VA 1ULMA 7WGAA 2LB7A 1Q9BA 2DKVA 1K7UA 2CWGA 1K7TA 2UVOA 4AMLA 2X52A 1P9GA 9WGAA 1ULNA 1UHAA 1WGTA 4WP4A 2WGCA 1P9ZA 1HEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKX A;  4MPI A;  1WGC A;  2X3T A;  1ULK A;  1K7V A;  1ULM A;  7WGA A;  2LB7 A;  1Q9B A;  2DKV A;  1K7U A;  2CWG A;  1K7T A;  2UVO A;  4AML A;  2X52 A;  1P9G A;  9WGA A;  1ULN A;  1UHA A;  1WGT A;  4WP4 A;  2WGC A;  1P9Z A;  1HEV A; 
#chains in the Genus database with same CATH topology
 1S20 A;  1Z7K B;  3UEY A;  1UUC A;  4DNC A;  1WKX A;  1PCE A;  2SGE I;  2K9H A;  3PDN A;  5EX0 A;  2BUS A;  2NU1 I;  2ORV A;  2QQD A;  4A24 A;  2XRC A;  1X74 A;  1K7V A;  2RC4 A;  2SGD I;  1W3S A;  1LR7 A;  1R0R I;  2J87 A;  7WGA A;  2CWH A;  3MEK A;  1Q9B A;  2DKV A;  2NU0 I;  1V1I A;  2L8E A;  2QPO A;  1K7U A;  5EX3 A;  1SGE I;  1Z2I A;  3UGI A;  1NUB A;  5CCL A;  2GKR I;  2JW6 A;  4AML A;  2P6A C;  2X52 A;  2GKT I;  1CE3 A;  4UXI A;  3FSX A;  1TUR A;  1P9G A;  2CWF A;  1PJU A;  2W0T A;  4JCV E;  1W4R A;  1TOT A;  2F3C I;  2LUY A;  9WGA A;  2N17 A;  1IW4 A;  1YU6 C;  5E3P A;  1CGI I;  1CT2 I;  2M5X A;  3HH2 C;  5FUY A;  2KMP A;  2J9R A;  2ORW A;  1HPT A;  1Y8F A;  1BMO A;  3FC3 A;  1SGN I;  4OVO A;  5E3Q A;  1NXU A;  2JYY A;  1XBT A;  1TIH A;  3UFF A;  5CCM A;  1IY5 A;  3QAH A;  1CHO I;  2ENZ A;  2JA1 A;  2N1A B;  1XA6 A;  2KCX A;  2WVJ A;  1U5K A;  4E1P A;  3TOB A;  2N71 A;  2NU4 I;  5E3R A;  2ENN A;  1LR8 A;  2B0U C;  1K7T A;  5HI7 A;  3KY9 A;  2QQE A;  4UXH A;  1DS2 I;  1RFH A;  3R5D A;  3SGB I;  1HDL A;  1TBO A;  2DIP A;  3OXG A;  1M8B A;  2B8T A;  4UXJ A;  1MT1 A;  3R5B A;  3UEJ A;  2LEO A;  2UZ3 A;  3OXL A;  3D00 A;  3RU0 A;  2V53 A;  1UVF A;  1FAQ A;  1WGT A;  1X4S A;  3TOA A;  1CGJ I;  3VE5 A;  1SGQ I;  1P9Z A;  2OZU A;  1OMT A;  1Y1C A;  3B4V C;  4MPI A;  3TO9 A;  1WGC A;  2RIJ A;  5FUX A;  2X3T A;  5HQ8 A;  2OVO A;  1UVG A;  3OXF A;  2JXD A;  1CSO I;  2YQP A;  3BJI A;  3QWP A;  1HJA I;  2SGQ I;  1ULM A;  1PTQ A;  1CT4 I;  3TO7 A;  1DS3 I;  1SGY I;  4GI3 C;  3E2I A;  1M8C A;  1TBQ R;  2N52 A;  3SGQ I;  1MJ9 A;  2WCY A;  5J8C A;  1KMA A;  2ELI A;  2UVO A;  1N13 A;  1Y1B A;  2L7X A;  2NU3 I;  3VDU A;  5FUV A;  2KMQ A;  1PPF I;  2E73 A;  2GIV A;  2QQC A;  5DAE A;  1SGD I;  2PQ8 A;  2SGP I;  5J8F A;  1TBN A;  1TBR R;  1FAR A;  2OU2 A;  1ULN A;  2QQ0 A;  2VRW B;  3CXL A;  1FY7 A;  2V1C C;  3UGD A;  3E59 A;  1YTP A;  2DB6 A;  1UHA A;  2ERW A;  4WP4 A;  1TUS A;  1OYV I;  3UOE A;  1HEV A;  1VDD A;  1V1H A;  4L9M A;  2JZM A;  4HGU A;  1R79 A;  2V1C A;  4E1R A;  3UGL A;  1MJA A;  1OVO A;  1AN1 I;  5JHW C;  2SGF I;  1ULK A;  3FSY A;  4B6D A;  5FUW A;  2FNF X;  1SGR I;  1TGS I;  4SGB I;  1OMU A;  1WTJ A;  1SGP I;  2ARP F;  2LB7 A;  2YUU A;  3GOX A;  2A20 A;  2CWG A;  2GVI A;  1KBF A;  3OL0 A;  1XX6 A;  2ODD A;  1KBE A;  2CJS C;  1PTR A;  2Y0M A;  4FKD A;  3R5C A;  2NU2 I;  1LR9 A;  3SEK C;  1BUS A;  1FYB A;  1MJB A;  1CT0 I;  3VDP A;  2GKV A;  3OVO A;  3QTL D;  3R5A A;  3TJQ A;  1IY6 A;  1H0Z A;  2KMR A;  2KMO A;  2ROW A;  2WGC A;  3TO6 A;  2OD1 A;  2E5R A; 
#chains in the Genus database with same CATH homology
 1WKX A;  4MPI A;  1WGC A;  2X3T A;  1ULK A;  1K7V A;  1ULM A;  7WGA A;  2LB7 A;  1Q9B A;  2DKV A;  1K7U A;  2CWG A;  1K7T A;  2UVO A;  4AML A;  2X52 A;  1P9G A;  9WGA A;  1ULN A;  1UHA A;  1WGT A;  4WP4 A;  2WGC A;  1P9Z A;  1HEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...