1Q9BA

Crystal structure analysis of hev b 6.02 (hevein) at 1.5 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hevein
publication title Insights into a conformational epitope of Hev b 6.02 (hevein).
pubmed doi rcsb
molecule tags Allergen
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1q9bA00
4MPIA 1K7UA 1WGTA 1ULKA 2X3TA 1ULMA 1HEVA 2WGCA 2X52A 1UHAA 1Q9BA 1K7TA 4AMLA 1ULNA 1P9ZA 7WGAA 1WKXA 9WGAA 1K7VA 2LB7A 2UVOA 2CWGA 4WP4A 1P9GA 1WGCA 2DKVA
chains in the Genus database with same CATH superfamily
4MPIA 1K7UA 1LR8A 2B0UC 1MJBA 1ULKA 5J8FA 1RFHA 3OXGA 2GIVA 3OXLA 1ULMA 1X4SA 1CT4I 1SGPI 1HEVA 1TBNA 1SGNI 3SEKC 1Q9BA 2GKTI 2JZMA 2QQCA 3QTLD 1Z2IA 2B8TA 2GKVA 4UXIA 3OL0A 1NUBA 2ERWA 5E3QA 1XA6A 1FARA 1R0RI 1P9ZA 2N17A 2CJSC 1UUCA 2WCYA 2YQPA 1OYVI 5JHWC 1FAQA 2LUYA 2ORVA 3TOBA 1Y1CA 1UVFA 2CWFA 1K7VA 1CGII 2ENZA 2LEOA 2N52A 2Y0MA 5EX0A 3FSYA 1DS3I 4WP4A 2ODDA 1M8CA 1OMUA 5HI7A 2N71A 1LR7A 2CWHA 1BUSA 1Z7KB 1CSOI 2ENNA 2ELIA 4UXHA 2FNFX 3CXLA 3UGLA 1TGSI 5FUVA 1S20A 2DIPA 2OU2A 5CCMA 1CE3A 3GOXA 3TJQA 5J8CA 2QQ0A 3UEJA 1V1IA 2N1AB 3PDNA 2X52A 2V1CA 3E2IA 2ARPF 2JA1A 1CT0I 1HPTA 1K7TA 1OVOA 1AN1I 2KMOA 1CHOI 1KBEA 1M8BA 1TBQR 1LR9A 4SGBI 1WTJA 3FC3A 5E3RA 1Y8FA 1N13A 2YUUA 3RU0A 3E59A 5E3PA 2SGQI 1IY5A 3MEKA 5FUWA 4HGUA 4L9MA 4A24A 3UEYA 2KMRA 2UVOA 1PTRA 2KMQA 2V1CC 2CWGA 1HDLA 2OZUA 4UXJA 2SGDI 1P9GA 5FUYA 3UGIA 1W4RA 2RC4A 1IW4A 2NU0I 2XRCA 5EX3A 1V1HA 2V53A 1U5KA 1VDDA 2ORWA 3SGQI 1SGYI 2QQEA 4GI3C 1W3SA 2JXDA 3QWPA 1MJAA 2KCXA 1UHAA 1UVGA 2UZ3A 3KY9A 2OVOA 2WVJA 3TO6A 1OMTA 3QAHA 3R5BA 1NXUA 1YTPA 2GVIA 2NU3I 2QQDA 3OVOA 3TO7A 3UOEA 1KMAA 2VRWB 1Y1BA 1X74A 3TOAA 2QPOA 1ULNA 7WGAA 2P6AC 2M5XA 1CT2I 1WKXA 2SGFI 1SGRI 9WGAA 3B4VC 3VDUA 1XBTA 1SGEI 2GKRI 2J87A 2K9HA 2F3CI 2L8EA 2BUSA 1PTQA 2NU1I 3R5AA 1FYBA 2NU2I 1SGQI 2E73A 1TBOA 1TURA 2RIJA 1WGTA 3BJIA 1PJUA 5FUXA 4E1PA 2X3TA 2ROWA 1TOTA 1DS2I 2L7XA 4B6DA 2E5RA 1BMOA 2WGCA 4E1RA 2W0TA 1MT1A 1TBRR 1IY6A 2PQ8A 1YU6C 2SGEI 5DAEA 2J9RA 3OXFA 1KBFA 1TIHA 2KMPA 3VE5A 2A20A 4AMLA 3D00A 1HJAI 2JYYA 3SGBI 2SGPI 1TUSA 3R5CA 4JCVE 3UFFA 2JW6A 1H0ZA 2OD1A 1CGJI 2LB7A 2NU4I 3VDPA 3TO9A 1PPFI 3UGDA 5HQ8A 1R79A 4OVOA 2DB6A 1WGCA 3FSXA 4FKDA 1XX6A 5CCLA 2DKVA 1MJ9A 1PCEA 3R5DA 3HH2C 1FY7A 1SGDI 4DNCA
chains in the Genus database with same CATH topology
4MPIA 1K7UA 1WGTA 1ULKA 2X3TA 1ULMA 1HEVA 2WGCA 2X52A 1UHAA 1Q9BA 1K7TA 4AMLA 1ULNA 1P9ZA 7WGAA 1WKXA 9WGAA 1K7VA 2LB7A 2UVOA 2CWGA 4WP4A 1P9GA 1WGCA 2DKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPI A;  1K7U A;  1WGT A;  1ULK A;  2X3T A;  1ULM A;  1HEV A;  2WGC A;  2X52 A;  1UHA A;  1Q9B A;  1K7T A;  4AML A;  1ULN A;  1P9Z A;  7WGA A;  1WKX A;  9WGA A;  1K7V A;  2LB7 A;  2UVO A;  2CWG A;  4WP4 A;  1P9G A;  1WGC A;  2DKV A; 
#chains in the Genus database with same CATH topology
 4MPI A;  1K7U A;  1LR8 A;  2B0U C;  1MJB A;  1ULK A;  5J8F A;  1RFH A;  3OXG A;  2GIV A;  3OXL A;  1ULM A;  1X4S A;  1CT4 I;  1SGP I;  1HEV A;  1TBN A;  1SGN I;  3SEK C;  1Q9B A;  2GKT I;  2JZM A;  2QQC A;  3QTL D;  1Z2I A;  2B8T A;  2GKV A;  4UXI A;  3OL0 A;  1NUB A;  2ERW A;  5E3Q A;  1XA6 A;  1FAR A;  1R0R I;  1P9Z A;  2N17 A;  2CJS C;  1UUC A;  2WCY A;  2YQP A;  1OYV I;  5JHW C;  1FAQ A;  2LUY A;  2ORV A;  3TOB A;  1Y1C A;  1UVF A;  2CWF A;  1K7V A;  1CGI I;  2ENZ A;  2LEO A;  2N52 A;  2Y0M A;  5EX0 A;  3FSY A;  1DS3 I;  4WP4 A;  2ODD A;  1M8C A;  1OMU A;  5HI7 A;  2N71 A;  1LR7 A;  2CWH A;  1BUS A;  1Z7K B;  1CSO I;  2ENN A;  2ELI A;  4UXH A;  2FNF X;  3CXL A;  3UGL A;  1TGS I;  5FUV A;  1S20 A;  2DIP A;  2OU2 A;  5CCM A;  1CE3 A;  3GOX A;  3TJQ A;  5J8C A;  2QQ0 A;  3UEJ A;  1V1I A;  2N1A B;  3PDN A;  2X52 A;  2V1C A;  3E2I A;  2ARP F;  2JA1 A;  1CT0 I;  1HPT A;  1K7T A;  1OVO A;  1AN1 I;  2KMO A;  1CHO I;  1KBE A;  1M8B A;  1TBQ R;  1LR9 A;  4SGB I;  1WTJ A;  3FC3 A;  5E3R A;  1Y8F A;  1N13 A;  2YUU A;  3RU0 A;  3E59 A;  5E3P A;  2SGQ I;  1IY5 A;  3MEK A;  5FUW A;  4HGU A;  4L9M A;  4A24 A;  3UEY A;  2KMR A;  2UVO A;  1PTR A;  2KMQ A;  2V1C C;  2CWG A;  1HDL A;  2OZU A;  4UXJ A;  2SGD I;  1P9G A;  5FUY A;  3UGI A;  1W4R A;  2RC4 A;  1IW4 A;  2NU0 I;  2XRC A;  5EX3 A;  1V1H A;  2V53 A;  1U5K A;  1VDD A;  2ORW A;  3SGQ I;  1SGY I;  2QQE A;  4GI3 C;  1W3S A;  2JXD A;  3QWP A;  1MJA A;  2KCX A;  1UHA A;  1UVG A;  2UZ3 A;  3KY9 A;  2OVO A;  2WVJ A;  3TO6 A;  1OMT A;  3QAH A;  3R5B A;  1NXU A;  1YTP A;  2GVI A;  2NU3 I;  2QQD A;  3OVO A;  3TO7 A;  3UOE A;  1KMA A;  2VRW B;  1Y1B A;  1X74 A;  3TOA A;  2QPO A;  1ULN A;  7WGA A;  2P6A C;  2M5X A;  1CT2 I;  1WKX A;  2SGF I;  1SGR I;  9WGA A;  3B4V C;  3VDU A;  1XBT A;  1SGE I;  2GKR I;  2J87 A;  2K9H A;  2F3C I;  2L8E A;  2BUS A;  1PTQ A;  2NU1 I;  3R5A A;  1FYB A;  2NU2 I;  1SGQ I;  2E73 A;  1TBO A;  1TUR A;  2RIJ A;  1WGT A;  3BJI A;  1PJU A;  5FUX A;  4E1P A;  2X3T A;  2ROW A;  1TOT A;  1DS2 I;  2L7X A;  4B6D A;  2E5R A;  1BMO A;  2WGC A;  4E1R A;  2W0T A;  1MT1 A;  1TBR R;  1IY6 A;  2PQ8 A;  1YU6 C;  2SGE I;  5DAE A;  2J9R A;  3OXF A;  1KBF A;  1TIH A;  2KMP A;  3VE5 A;  2A20 A;  4AML A;  3D00 A;  1HJA I;  2JYY A;  3SGB I;  2SGP I;  1TUS A;  3R5C A;  4JCV E;  3UFF A;  2JW6 A;  1H0Z A;  2OD1 A;  1CGJ I;  2LB7 A;  2NU4 I;  3VDP A;  3TO9 A;  1PPF I;  3UGD A;  5HQ8 A;  1R79 A;  4OVO A;  2DB6 A;  1WGC A;  3FSX A;  4FKD A;  1XX6 A;  5CCL A;  2DKV A;  1MJ9 A;  1PCE A;  3R5D A;  3HH2 C;  1FY7 A;  1SGD I;  4DNC A; 
#chains in the Genus database with same CATH homology
 4MPI A;  1K7U A;  1WGT A;  1ULK A;  2X3T A;  1ULM A;  1HEV A;  2WGC A;  2X52 A;  1UHA A;  1Q9B A;  1K7T A;  4AML A;  1ULN A;  1P9Z A;  7WGA A;  1WKX A;  9WGA A;  1K7V A;  2LB7 A;  2UVO A;  2CWG A;  4WP4 A;  1P9G A;  1WGC A;  2DKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...