1Q9BA

Crystal structure analysis of hev b 6.02 (hevein) at 1.5 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
b'EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hevein
publication title Insights into a conformational epitope of Hev b 6.02 (hevein).
pubmed doi rcsb
molecule tags Allergen
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1q9bA00
1UHAA 1ULNA 1WGCA 2CWGA 1ULMA 2X3TA 2WGCA 1P9ZA 2LB7A 1P9GA 1K7VA 7WGAA 4WP4A 4MPIA 2X52A 2UVOA 1WGTA 1ULKA 1WKXA 4AMLA 2DKVA 1K7TA 1HEVA 1Q9BA 1K7UA 9WGAA
chains in the Genus database with same CATH superfamily
2QQ0A 1WGCA 2L8EA 3UOEA 2K9HA 1S20A 4DNCA 3TJQA 2X3TA 2J9RA 2KMRA 2M5XA 3QTLD 5E3PA 1RFHA 1SGYI 1NXUA 1TBRR 2GIVA 1CHOI 2NU0I 1CGII 2ENZA 2SGEI 4FKDA 4UXHA 1DS3I 4E1RA 1Y1BA 2J87A 1OMUA 3UFFA 2RC4A 5FUWA 1BUSA 1KBFA 1V1IA 5HQ8A 1PPFI 3R5AA 1FY7A 1CSOI 2Y0MA 1N13A 4MPIA 2NU3I 4GI3C 2BUSA 2W0TA 1TGSI 2B0UC 1WKXA 2DIPA 1FAQA 1LR7A 2ELIA 1V1HA 2RIJA 1PTQA 5EX3A 2DKVA 1NUBA 3UEJA 1PTRA 2KMPA 3FSYA 1TUSA 1Y8FA 1TBQR 1K7UA 2F3CI 2ROWA 3OXLA 1U5KA 1OMTA 9WGAA 1ULNA 3GOXA 1TBOA 2CWGA 1W4RA 2JZMA 3R5CA 3FC3A 1PCEA 3VDPA 2ENNA 2OZUA 2V53A 2QQEA 1X74A 1SGNI 2L7XA 1SGDI 2SGDI 3SEKC 1AN1I 1LR9A 1SGQI 1X4SA 2VRWB 2B8TA 3TO6A 3UGDA 7WGAA 1FARA 2JA1A 3RU0A 5J8CA 3HH2C 5FUYA 1HDLA 1R79A 1BMOA 2ORWA 4HGUA 3SGQI 1OVOA 4L9MA 5E3RA 1CT0I 1Z2IA 1Y1CA 5EX0A 2NU1I 3TOAA 1XX6A 2N52A 3R5BA 2QPOA 2KMQA 2LEOA 1CT2I 5HI7A 5CCMA 2A20A 3TO7A 1SGRI 2GKTI 1KMAA 2GKVA 4B6DA 2V1CA 2GVIA 2N17A 3VDUA 3E2IA 2PQ8A 1VDDA 1DS2I 2JXDA 1IY5A 2OU2A 2FNFX 1OYVI 2NU2I 4SGBI 3UGIA 5FUXA 4OVOA 4UXJA 5CCLA 2CJSC 1K7VA 1YU6C 4WP4A 1PJUA 2CWHA 2JW6A 1XBTA 3TOBA 2YQPA 3OXGA 2V1CC 5E3QA 3TO9A 1IY6A 2SGFI 2X52A 2YUUA 2KCXA 1SGEI 2UVOA 3SGBI 4UXIA 2SGPI 2XRCA 4AMLA 5J8FA 4A24A 4JCVE 5DAEA 2JYYA 3OVOA 3B4VC 1Q9BA 3MEKA 1HJAI 1MJBA 1KBEA 1TURA 2LUYA 2N71A 3OXFA 1FYBA 1M8CA 1CGJI 1MT1A 1MJAA 1XA6A 2ORVA 1UHAA 2N1AB 2ERWA 3E59A 3D00A 1ULMA 3UGLA 2CWFA 2WVJA 2WGCA 1P9ZA 2ARPF 1R0RI 2QQCA 2WCYA 1UUCA 1TBNA 2KMOA 2LB7A 1P9GA 3UEYA 2SGQI 3QAHA 2QQDA 1W3SA 1TIHA 1UVGA 2P6AC 1YTPA 2E5RA 3KY9A 2GKRI 1IW4A 3OL0A 1Z7KB 2NU4I 1SGPI 3FSXA 1TOTA 3BJIA 1CT4I 1WGTA 1ULKA 3PDNA 3R5DA 5JHWC 4E1PA 1H0ZA 1CE3A 1M8BA 2DB6A 1LR8A 2UZ3A 2OVOA 3CXLA 1WTJA 1HPTA 1K7TA 1HEVA 5FUVA 2OD1A 2E73A 1MJ9A 2ODDA 3VE5A 3QWPA 1UVFA
chains in the Genus database with same CATH topology
1UHAA 1ULNA 1WGCA 2CWGA 1ULMA 2X3TA 2WGCA 1P9ZA 2LB7A 1P9GA 1K7VA 7WGAA 4WP4A 4MPIA 2X52A 2UVOA 1WGTA 1ULKA 1WKXA 4AMLA 2DKVA 1K7TA 1HEVA 1Q9BA 1K7UA 9WGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHA A;  1ULN A;  1WGC A;  2CWG A;  1ULM A;  2X3T A;  2WGC A;  1P9Z A;  2LB7 A;  1P9G A;  1K7V A;  7WGA A;  4WP4 A;  4MPI A;  2X52 A;  2UVO A;  1WGT A;  1ULK A;  1WKX A;  4AML A;  2DKV A;  1K7T A;  1HEV A;  1Q9B A;  1K7U A;  9WGA A; 
#chains in the Genus database with same CATH topology
 2QQ0 A;  1WGC A;  2L8E A;  3UOE A;  2K9H A;  1S20 A;  4DNC A;  3TJQ A;  2X3T A;  2J9R A;  2KMR A;  2M5X A;  3QTL D;  5E3P A;  1RFH A;  1SGY I;  1NXU A;  1TBR R;  2GIV A;  1CHO I;  2NU0 I;  1CGI I;  2ENZ A;  2SGE I;  4FKD A;  4UXH A;  1DS3 I;  4E1R A;  1Y1B A;  2J87 A;  1OMU A;  3UFF A;  2RC4 A;  5FUW A;  1BUS A;  1KBF A;  1V1I A;  5HQ8 A;  1PPF I;  3R5A A;  1FY7 A;  1CSO I;  2Y0M A;  1N13 A;  4MPI A;  2NU3 I;  4GI3 C;  2BUS A;  2W0T A;  1TGS I;  2B0U C;  1WKX A;  2DIP A;  1FAQ A;  1LR7 A;  2ELI A;  1V1H A;  2RIJ A;  1PTQ A;  5EX3 A;  2DKV A;  1NUB A;  3UEJ A;  1PTR A;  2KMP A;  3FSY A;  1TUS A;  1Y8F A;  1TBQ R;  1K7U A;  2F3C I;  2ROW A;  3OXL A;  1U5K A;  1OMT A;  9WGA A;  1ULN A;  3GOX A;  1TBO A;  2CWG A;  1W4R A;  2JZM A;  3R5C A;  3FC3 A;  1PCE A;  3VDP A;  2ENN A;  2OZU A;  2V53 A;  2QQE A;  1X74 A;  1SGN I;  2L7X A;  1SGD I;  2SGD I;  3SEK C;  1AN1 I;  1LR9 A;  1SGQ I;  1X4S A;  2VRW B;  2B8T A;  3TO6 A;  3UGD A;  7WGA A;  1FAR A;  2JA1 A;  3RU0 A;  5J8C A;  3HH2 C;  5FUY A;  1HDL A;  1R79 A;  1BMO A;  2ORW A;  4HGU A;  3SGQ I;  1OVO A;  4L9M A;  5E3R A;  1CT0 I;  1Z2I A;  1Y1C A;  5EX0 A;  2NU1 I;  3TOA A;  1XX6 A;  2N52 A;  3R5B A;  2QPO A;  2KMQ A;  2LEO A;  1CT2 I;  5HI7 A;  5CCM A;  2A20 A;  3TO7 A;  1SGR I;  2GKT I;  1KMA A;  2GKV A;  4B6D A;  2V1C A;  2GVI A;  2N17 A;  3VDU A;  3E2I A;  2PQ8 A;  1VDD A;  1DS2 I;  2JXD A;  1IY5 A;  2OU2 A;  2FNF X;  1OYV I;  2NU2 I;  4SGB I;  3UGI A;  5FUX A;  4OVO A;  4UXJ A;  5CCL A;  2CJS C;  1K7V A;  1YU6 C;  4WP4 A;  1PJU A;  2CWH A;  2JW6 A;  1XBT A;  3TOB A;  2YQP A;  3OXG A;  2V1C C;  5E3Q A;  3TO9 A;  1IY6 A;  2SGF I;  2X52 A;  2YUU A;  2KCX A;  1SGE I;  2UVO A;  3SGB I;  4UXI A;  2SGP I;  2XRC A;  4AML A;  5J8F A;  4A24 A;  4JCV E;  5DAE A;  2JYY A;  3OVO A;  3B4V C;  1Q9B A;  3MEK A;  1HJA I;  1MJB A;  1KBE A;  1TUR A;  2LUY A;  2N71 A;  3OXF A;  1FYB A;  1M8C A;  1CGJ I;  1MT1 A;  1MJA A;  1XA6 A;  2ORV A;  1UHA A;  2N1A B;  2ERW A;  3E59 A;  3D00 A;  1ULM A;  3UGL A;  2CWF A;  2WVJ A;  2WGC A;  1P9Z A;  2ARP F;  1R0R I;  2QQC A;  2WCY A;  1UUC A;  1TBN A;  2KMO A;  2LB7 A;  1P9G A;  3UEY A;  2SGQ I;  3QAH A;  2QQD A;  1W3S A;  1TIH A;  1UVG A;  2P6A C;  1YTP A;  2E5R A;  3KY9 A;  2GKR I;  1IW4 A;  3OL0 A;  1Z7K B;  2NU4 I;  1SGP I;  3FSX A;  1TOT A;  3BJI A;  1CT4 I;  1WGT A;  1ULK A;  3PDN A;  3R5D A;  5JHW C;  4E1P A;  1H0Z A;  1CE3 A;  1M8B A;  2DB6 A;  1LR8 A;  2UZ3 A;  2OVO A;  3CXL A;  1WTJ A;  1HPT A;  1K7T A;  1HEV A;  5FUV A;  2OD1 A;  2E73 A;  1MJ9 A;  2ODD A;  3VE5 A;  3QWP A;  1UVF A; 
#chains in the Genus database with same CATH homology
 1UHA A;  1ULN A;  1WGC A;  2CWG A;  1ULM A;  2X3T A;  2WGC A;  1P9Z A;  2LB7 A;  1P9G A;  1K7V A;  7WGA A;  4WP4 A;  4MPI A;  2X52 A;  2UVO A;  1WGT A;  1ULK A;  1WKX A;  4AML A;  2DKV A;  1K7T A;  1HEV A;  1Q9B A;  1K7U A;  9WGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...