2N17A

Nmr structure of a kazal-type serine protease inhibitor from the subterranean termite defense gland of coptotermes formosanus shiraki soldiers
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
CQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysozyme-Protease Inhibitor Protein
publication title A Kazal-Type Serine Protease Inhibitor from the Defense Gland Secretion of the Subterranean Termite Coptotermes formosanus Shiraki.
pubmed doi rcsb
source organism Coptotermes formosanus
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n17A00
1OYVI 1CT4I 2N17A 2KCXA 2F3CI 1H0ZA 1IY5A 3SEKC 1HDLA 1M8BA 1SGPI 1IW4A 1CGII 1YTPA 5JHWC 1Y1CA 1Y1BA 2XRCA 1CSOI 1PCEA 1SGEI 1LR8A 1TBQR 1UVGA 1TUSA 2JYYA 1TGSI 2NU0I 1OMTA 1SGYI 1MT1A 1TBRR 1FYBA 1BMOA 1SGRI 2V53A 1IY6A 4HGUA 1OMUA 1Z7KB 1PJUA 3B4VC 1DS3I 4GI3C 1CT2I 3OVOA 1HPTA 5DAEA 2GKVA 1TIHA 2QQCA 2SGQI 2SGPI 2NU2I 1OVOA 3SGQI 2KMOA 2GKTI 1CE3A 4SGBI 1NUBA 3QTLD 2GKRI 1R0RI 2NU3I 2NU1I 2SGFI 3TJQA 1DS2I 1CHOI 1SGDI 1HJAI 1SGNI 1AN1I 1M8CA 3HH2C 1CGJI 2NU4I 1KMAA 2QQDA 1UUCA 3SGBI 1PPFI 1CT0I 2ERWA 2OVOA 1LR7A 2M5XA 2SGEI 2JXDA 1SGQI 2WCYA 1TURA 2ARPF 2BUSA 1BUSA 4OVOA 2KMPA 2KMQA 1UVFA 2LEOA 2P6AC 2KMRA 2JZMA 1N13A 2N71A 2B0UC 2N52A 2SGDI 1LR9A 1YU6C
chains in the Genus database with same CATH superfamily
1K7VA 1OYVI 2N1AB 3TO9A 1CT4I 2GVIA 5E3PA 3UGDA 1NXUA 2N17A 2KCXA 2ELIA 5E3QA 2E5RA 2F3CI 2X52A 2WVJA 5FUWA 1H0ZA 1IY5A 2RC4A 3SEKC 4AMLA 1HDLA 1M8BA 1SGPI 3OL0A 3RU0A 1IW4A 1CGII 1YTPA 3E59A 5HQ8A 1Y1CA 5JHWC 5FUYA 1Y1BA 1TOTA 2XRCA 1ULKA 1CSOI 3QAHA 1PCEA 1X74A 1PTRA 1FY7A 1SGEI 3BJIA 5EX3A 2DIPA 1LR8A 1TBQR 3FC3A 1UVGA 3TO7A 2UZ3A 3FSXA 1MJBA 1K7UA 1TUSA 1TGSI 2JYYA 2NU0I 2ODDA 2YQPA 3VDPA 1OMTA 1S20A 1SGYI 1MT1A 3TOBA 1TBRR 1FYBA 2W0TA 2QPOA 4UXIA 1BMOA 1SGRI 3TOAA 1WGCA 2V53A 5HI7A 3VDUA 1IY6A 4JCVE 2K9HA 4HGUA 1OMUA 1Z7KB 1PJUA 1WTJA 2CWGA 2ENNA 5E3RA 3B4VC 1DS3I 4GI3C 2CJSC 2OU2A 3OXLA 1MJAA 1CT2I 2QQ0A 1HPTA 1Y8FA 2X3TA 2ROWA 3OVOA 3QWPA 5DAEA 1PTQA 2GKVA 1P9GA 3FSYA 2WGCA 5FUVA 3R5AA 1TIHA 2QQCA 3PDNA 1W3SA 1W4RA 1KBFA 1P9ZA 2SGQI 3UOEA 3R5BA 3OXGA 2SGPI 2UVOA 2NU2I 1OVOA 3SGQI 3UEYA 2GKTI 2KMOA 3KY9A 1Z2IA 1FAQA 4UXHA 3UEJA 1CE3A 1WKXA 1XBTA 4SGBI 1NUBA 4E1RA 1VDDA 2V1CC 5FUXA 3QTLD 4WP4A 2GKRI 2RIJA 1R79A 2ORVA 1V1IA 2CWFA 3MEKA 1R0RI 2JW6A 3CXLA 3UGLA 2Y0MA 2NU3I 4B6DA 2NU1I 3R5DA 1V1HA 2SGFI 3TJQA 1DS2I 1CHOI 2A20A 1K7TA 2DKVA 1RFHA 1Q9BA 1SGDI 1HJAI 5CCLA 1SGNI 1ULNA 1ULMA 1AN1I 2GIVA 2JA1A 2V1CA 2YUUA 3R5CA 2FNFX 4DNCA 1M8CA 3HH2C 2OD1A 1KBEA 2J87A 1CGJI 1XX6A 2DB6A 2NU4I 1TBNA 1KMAA 2QQDA 2PQ8A 1UUCA 5J8CA 5CCMA 3SGBI 2CWHA 2E73A 1TBOA 1PPFI 5EX0A 1HEVA 4A24A 1CT0I 9WGAA 2ERWA 2OVOA 1LR7A 2M5XA 2SGEI 2JXDA 2LUYA 1SGQI 2J9RA 2WCYA 1XA6A 1TURA 2ARPF 2BUSA 2ENZA 3TO6A 3GOXA 4OVOA 1BUSA 2OZUA 1WGTA 2KMPA 2KMQA 3D00A 2L7XA 2B8TA 1UVFA 2VRWB 2LEOA 3OXFA 4UXJA 2P6AC 3UFFA 2KMRA 1X4SA 2JZMA 1U5KA 1N13A 4L9MA 1MJ9A 2ORWA 1UHAA 2L8EA 2N71A 2B0UC 3E2IA 4E1PA 2N52A 1FARA 2LB7A 4FKDA 3UGIA 2SGDI 3VE5A 1LR9A 7WGAA 1YU6C 4MPIA 2QQEA 5J8FA
chains in the Genus database with same CATH topology
1OYVI 2N1AB 1CT4I 2GVIA 3UGDA 2N17A 2KCXA 2ELIA 2E5RA 2F3CI 2WVJA 5FUWA 1H0ZA 1IY5A 3SEKC 1HDLA 1M8BA 1SGPI 3OL0A 3RU0A 1IW4A 1CGII 1YTPA 3E59A 5HQ8A 1Y1CA 5JHWC 5FUYA 1Y1BA 1TOTA 2XRCA 1CSOI 1PCEA 1X74A 1PTRA 5EX3A 1SGEI 3BJIA 2DIPA 1LR8A 1TBQR 3FC3A 1UVGA 2UZ3A 1TUSA 2JYYA 1TGSI 2NU0I 2ODDA 2YQPA 3VDPA 1OMTA 1SGYI 1MT1A 1TBRR 1FYBA 2W0TA 2QPOA 4UXIA 1BMOA 1SGRI 2V53A 5HI7A 3VDUA 1IY6A 4JCVE 2K9HA 4HGUA 1OMUA 1Z7KB 1PJUA 2ENNA 3B4VC 1DS3I 4GI3C 2CJSC 3OXLA 1CT2I 2QQ0A 1HPTA 1Y8FA 3OVOA 2ROWA 3QWPA 5DAEA 1PTQA 2GKVA 5FUVA 1KBFA 1TIHA 2QQCA 3PDNA 1W4RA 1W3SA 2SGQI 3OXGA 2SGPI 2NU2I 1OVOA 3SGQI 3UEYA 2GKTI 2KMOA 3KY9A 1FAQA 4UXHA 3UEJA 1CE3A 1XBTA 4SGBI 1NUBA 4E1RA 1VDDA 2V1CC 5FUXA 3QTLD 2GKRI 1R79A 2ORVA 1V1IA 3MEKA 1R0RI 2JW6A 3CXLA 3UGLA 2NU3I 4B6DA 2NU1I 1V1HA 2SGFI 3TJQA 1DS2I 1CHOI 2A20A 1RFHA 1SGDI 1HJAI 5CCLA 1SGNI 2JA1A 2YUUA 1AN1I 2V1CA 2FNFX 1M8CA 3HH2C 2OD1A 1KBEA 2J87A 1CGJI 1XX6A 2DB6A 2NU4I 1TBNA 1KMAA 2QQDA 1UUCA 5CCMA 3SGBI 2E73A 1TBOA 1PPFI 5EX0A 4A24A 1CT0I 2ERWA 2OVOA 1LR7A 2M5XA 2SGEI 2JXDA 2LUYA 1SGQI 2J9RA 2WCYA 1XA6A 1TURA 2ARPF 2BUSA 2ENZA 3GOXA 1BUSA 4OVOA 2KMPA 3D00A 2KMQA 2L7XA 2B8TA 1UVFA 2VRWB 2LEOA 3OXFA 4UXJA 2P6AC 3UFFA 2KMRA 1X4SA 2JZMA 1U5KA 1N13A 4L9MA 2ORWA 2L8EA 2N71A 2B0UC 3E2IA 4E1PA 2N52A 1FARA 4FKDA 3UGIA 3VE5A 2SGDI 1LR9A 1YU6C 2QQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYV I;  1CT4 I;  2N17 A;  2KCX A;  2F3C I;  1H0Z A;  1IY5 A;  3SEK C;  1HDL A;  1M8B A;  1SGP I;  1IW4 A;  1CGI I;  1YTP A;  5JHW C;  1Y1C A;  1Y1B A;  2XRC A;  1CSO I;  1PCE A;  1SGE I;  1LR8 A;  1TBQ R;  1UVG A;  1TUS A;  2JYY A;  1TGS I;  2NU0 I;  1OMT A;  1SGY I;  1MT1 A;  1TBR R;  1FYB A;  1BMO A;  1SGR I;  2V53 A;  1IY6 A;  4HGU A;  1OMU A;  1Z7K B;  1PJU A;  3B4V C;  1DS3 I;  4GI3 C;  1CT2 I;  3OVO A;  1HPT A;  5DAE A;  2GKV A;  1TIH A;  2QQC A;  2SGQ I;  2SGP I;  2NU2 I;  1OVO A;  3SGQ I;  2KMO A;  2GKT I;  1CE3 A;  4SGB I;  1NUB A;  3QTL D;  2GKR I;  1R0R I;  2NU3 I;  2NU1 I;  2SGF I;  3TJQ A;  1DS2 I;  1CHO I;  1SGD I;  1HJA I;  1SGN I;  1AN1 I;  1M8C A;  3HH2 C;  1CGJ I;  2NU4 I;  1KMA A;  2QQD A;  1UUC A;  3SGB I;  1PPF I;  1CT0 I;  2ERW A;  2OVO A;  1LR7 A;  2M5X A;  2SGE I;  2JXD A;  1SGQ I;  2WCY A;  1TUR A;  2ARP F;  2BUS A;  1BUS A;  4OVO A;  2KMP A;  2KMQ A;  1UVF A;  2LEO A;  2P6A C;  2KMR A;  2JZM A;  1N13 A;  2N71 A;  2B0U C;  2N52 A;  2SGD I;  1LR9 A;  1YU6 C; 
#chains in the Genus database with same CATH topology
 1K7V A;  1OYV I;  2N1A B;  3TO9 A;  1CT4 I;  2GVI A;  5E3P A;  3UGD A;  1NXU A;  2N17 A;  2KCX A;  2ELI A;  5E3Q A;  2E5R A;  2F3C I;  2X52 A;  2WVJ A;  5FUW A;  1H0Z A;  1IY5 A;  2RC4 A;  3SEK C;  4AML A;  1HDL A;  1M8B A;  1SGP I;  3OL0 A;  3RU0 A;  1IW4 A;  1CGI I;  1YTP A;  3E59 A;  5HQ8 A;  1Y1C A;  5JHW C;  5FUY A;  1Y1B A;  1TOT A;  2XRC A;  1ULK A;  1CSO I;  3QAH A;  1PCE A;  1X74 A;  1PTR A;  1FY7 A;  1SGE I;  3BJI A;  5EX3 A;  2DIP A;  1LR8 A;  1TBQ R;  3FC3 A;  1UVG A;  3TO7 A;  2UZ3 A;  3FSX A;  1MJB A;  1K7U A;  1TUS A;  1TGS I;  2JYY A;  2NU0 I;  2ODD A;  2YQP A;  3VDP A;  1OMT A;  1S20 A;  1SGY I;  1MT1 A;  3TOB A;  1TBR R;  1FYB A;  2W0T A;  2QPO A;  4UXI A;  1BMO A;  1SGR I;  3TOA A;  1WGC A;  2V53 A;  5HI7 A;  3VDU A;  1IY6 A;  4JCV E;  2K9H A;  4HGU A;  1OMU A;  1Z7K B;  1PJU A;  1WTJ A;  2CWG A;  2ENN A;  5E3R A;  3B4V C;  1DS3 I;  4GI3 C;  2CJS C;  2OU2 A;  3OXL A;  1MJA A;  1CT2 I;  2QQ0 A;  1HPT A;  1Y8F A;  2X3T A;  2ROW A;  3OVO A;  3QWP A;  5DAE A;  1PTQ A;  2GKV A;  1P9G A;  3FSY A;  2WGC A;  5FUV A;  3R5A A;  1TIH A;  2QQC A;  3PDN A;  1W3S A;  1W4R A;  1KBF A;  1P9Z A;  2SGQ I;  3UOE A;  3R5B A;  3OXG A;  2SGP I;  2UVO A;  2NU2 I;  1OVO A;  3SGQ I;  3UEY A;  2GKT I;  2KMO A;  3KY9 A;  1Z2I A;  1FAQ A;  4UXH A;  3UEJ A;  1CE3 A;  1WKX A;  1XBT A;  4SGB I;  1NUB A;  4E1R A;  1VDD A;  2V1C C;  5FUX A;  3QTL D;  4WP4 A;  2GKR I;  2RIJ A;  1R79 A;  2ORV A;  1V1I A;  2CWF A;  3MEK A;  1R0R I;  2JW6 A;  3CXL A;  3UGL A;  2Y0M A;  2NU3 I;  4B6D A;  2NU1 I;  3R5D A;  1V1H A;  2SGF I;  3TJQ A;  1DS2 I;  1CHO I;  2A20 A;  1K7T A;  2DKV A;  1RFH A;  1Q9B A;  1SGD I;  1HJA I;  5CCL A;  1SGN I;  1ULN A;  1ULM A;  1AN1 I;  2GIV A;  2JA1 A;  2V1C A;  2YUU A;  3R5C A;  2FNF X;  4DNC A;  1M8C A;  3HH2 C;  2OD1 A;  1KBE A;  2J87 A;  1CGJ I;  1XX6 A;  2DB6 A;  2NU4 I;  1TBN A;  1KMA A;  2QQD A;  2PQ8 A;  1UUC A;  5J8C A;  5CCM A;  3SGB I;  2CWH A;  2E73 A;  1TBO A;  1PPF I;  5EX0 A;  1HEV A;  4A24 A;  1CT0 I;  9WGA A;  2ERW A;  2OVO A;  1LR7 A;  2M5X A;  2SGE I;  2JXD A;  2LUY A;  1SGQ I;  2J9R A;  2WCY A;  1XA6 A;  1TUR A;  2ARP F;  2BUS A;  2ENZ A;  3TO6 A;  3GOX A;  4OVO A;  1BUS A;  2OZU A;  1WGT A;  2KMP A;  2KMQ A;  3D00 A;  2L7X A;  2B8T A;  1UVF A;  2VRW B;  2LEO A;  3OXF A;  4UXJ A;  2P6A C;  3UFF A;  2KMR A;  1X4S A;  2JZM A;  1U5K A;  1N13 A;  4L9M A;  1MJ9 A;  2ORW A;  1UHA A;  2L8E A;  2N71 A;  2B0U C;  3E2I A;  4E1P A;  2N52 A;  1FAR A;  2LB7 A;  4FKD A;  3UGI A;  2SGD I;  3VE5 A;  1LR9 A;  7WGA A;  1YU6 C;  4MPI A;  2QQE A;  5J8F A; 
#chains in the Genus database with same CATH homology
 1OYV I;  2N1A B;  1CT4 I;  2GVI A;  3UGD A;  2N17 A;  2KCX A;  2ELI A;  2E5R A;  2F3C I;  2WVJ A;  5FUW A;  1H0Z A;  1IY5 A;  3SEK C;  1HDL A;  1M8B A;  1SGP I;  3OL0 A;  3RU0 A;  1IW4 A;  1CGI I;  1YTP A;  3E59 A;  5HQ8 A;  1Y1C A;  5JHW C;  5FUY A;  1Y1B A;  1TOT A;  2XRC A;  1CSO I;  1PCE A;  1X74 A;  1PTR A;  5EX3 A;  1SGE I;  3BJI A;  2DIP A;  1LR8 A;  1TBQ R;  3FC3 A;  1UVG A;  2UZ3 A;  1TUS A;  2JYY A;  1TGS I;  2NU0 I;  2ODD A;  2YQP A;  3VDP A;  1OMT A;  1SGY I;  1MT1 A;  1TBR R;  1FYB A;  2W0T A;  2QPO A;  4UXI A;  1BMO A;  1SGR I;  2V53 A;  5HI7 A;  3VDU A;  1IY6 A;  4JCV E;  2K9H A;  4HGU A;  1OMU A;  1Z7K B;  1PJU A;  2ENN A;  3B4V C;  1DS3 I;  4GI3 C;  2CJS C;  3OXL A;  1CT2 I;  2QQ0 A;  1HPT A;  1Y8F A;  3OVO A;  2ROW A;  3QWP A;  5DAE A;  1PTQ A;  2GKV A;  5FUV A;  1KBF A;  1TIH A;  2QQC A;  3PDN A;  1W4R A;  1W3S A;  2SGQ I;  3OXG A;  2SGP I;  2NU2 I;  1OVO A;  3SGQ I;  3UEY A;  2GKT I;  2KMO A;  3KY9 A;  1FAQ A;  4UXH A;  3UEJ A;  1CE3 A;  1XBT A;  4SGB I;  1NUB A;  4E1R A;  1VDD A;  2V1C C;  5FUX A;  3QTL D;  2GKR I;  1R79 A;  2ORV A;  1V1I A;  3MEK A;  1R0R I;  2JW6 A;  3CXL A;  3UGL A;  2NU3 I;  4B6D A;  2NU1 I;  1V1H A;  2SGF I;  3TJQ A;  1DS2 I;  1CHO I;  2A20 A;  1RFH A;  1SGD I;  1HJA I;  5CCL A;  1SGN I;  2JA1 A;  2YUU A;  1AN1 I;  2V1C A;  2FNF X;  1M8C A;  3HH2 C;  2OD1 A;  1KBE A;  2J87 A;  1CGJ I;  1XX6 A;  2DB6 A;  2NU4 I;  1TBN A;  1KMA A;  2QQD A;  1UUC A;  5CCM A;  3SGB I;  2E73 A;  1TBO A;  1PPF I;  5EX0 A;  4A24 A;  1CT0 I;  2ERW A;  2OVO A;  1LR7 A;  2M5X A;  2SGE I;  2JXD A;  2LUY A;  1SGQ I;  2J9R A;  2WCY A;  1XA6 A;  1TUR A;  2ARP F;  2BUS A;  2ENZ A;  3GOX A;  1BUS A;  4OVO A;  2KMP A;  3D00 A;  2KMQ A;  2L7X A;  2B8T A;  1UVF A;  2VRW B;  2LEO A;  3OXF A;  4UXJ A;  2P6A C;  3UFF A;  2KMR A;  1X4S A;  2JZM A;  1U5K A;  1N13 A;  4L9M A;  2ORW A;  2L8E A;  2N71 A;  2B0U C;  3E2I A;  4E1P A;  2N52 A;  1FAR A;  4FKD A;  3UGI A;  3VE5 A;  2SGD I;  1LR9 A;  1YU6 C;  2QQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...