2N17A

Nmr structure of a kazal-type serine protease inhibitor from the subterranean termite defense gland of coptotermes formosanus shiraki soldiers
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
CQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme-Protease Inhibitor Protein
publication title A Kazal-Type Serine Protease Inhibitor from the Defense Gland Secretion of the Subterranean Termite Coptotermes formosanus Shiraki.
pubmed doi rcsb
source organism Coptotermes formosanus
molecule tags Hydrolase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n17A00
1LR9A 2NU0I 1AN1I 2N71A 1N13A 2M5XA 1OMUA 1UUCA 2N17A 1CT4I 2JZMA 1SGQI 2NU1I 1PCEA 4SGBI 1YTPA 4GI3C 3SGBI 1CT0I 1KMAA 1NUBA 1CGJI 2N52A 1LR8A 2QQCA 2GKTI 1M8BA 1IW4A 1SGEI 2OVOA 1DS3I 1DS2I 1SGPI 1Z7KB 1CHOI 2V53A 1R0RI 5JHWC 1IY5A 2SGDI 1BMOA 3TJQA 1HPTA 2ARPF 1M8CA 2KMQA 1TIHA 1TUSA 1LR7A 1CGII 1TBRR 1TBQR 2KMRA 2P6AC 1OYVI 1MT1A 2SGEI 1BUSA 2F3CI 2XRCA 1TURA 2ERWA 2GKVA 1CSOI 3SEKC 2GKRI 3B4VC 1H0ZA 1UVGA 1YU6C 1CT2I 1HDLA 2SGPI 3OVOA 1HJAI 3HH2C 2B0UC 1PPFI 2SGQI 2NU2I 2JYYA 2SGFI 1Y1CA 1SGNI 1SGYI 5DAEA 1OMTA 1UVFA 2BUSA 1PJUA 2JXDA 1CE3A 2KMPA 2NU3I 1OVOA 1FYBA 2QQDA 1TGSI 1SGRI 3QTLD 3SGQI 2KCXA 1SGDI 2LEOA 2WCYA 4OVOA 2NU4I 1Y1BA 4HGUA 1IY6A 2KMOA
chains in the Genus database with same CATH superfamily
1MJBA 3FSYA 1LR9A 2NU0I 2L8EA 1AN1I 2YUUA 1K7UA 3UOEA 5CCLA 2N71A 1N13A 1X4SA 2M5XA 2V1CA 1WTJA 1OMUA 1UUCA 2N17A 1CT4I 2JZMA 1SGQI 4B6DA 1MJ9A 1W3SA 1X74A 5CCMA 2NU1I 2OU2A 1PCEA 1KBFA 4SGBI 2L7XA 1VDDA 2UZ3A 1YTPA 3VDUA 1R79A 3KY9A 1Z2IA 4GI3C 3QAHA 1CT0I 3SGBI 3MEKA 1XBTA 1NUBA 2QPOA 2YQPA 9WGAA 1KMAA 2QQEA 2WGCA 1TBNA 1HEVA 1KBEA 1RFHA 1CGJI 2V1CC 2GIVA 2N52A 3E59A 5J8FA 1LR8A 3R5CA 2ELIA 1PTQA 2ORVA 2QQCA 2GKTI 2RC4A 1Y8FA 1M8BA 2DIPA 2UVOA 1IW4A 1SGEI 2OVOA 5FUYA 1DS3I 1U5KA 5FUXA 2QQ0A 1DS2I 1SGPI 1TBOA 3R5BA 3TO7A 2DB6A 2LUYA 1Z7KB 1CHOI 1XX6A 2V53A 2B8TA 1TOTA 2E73A 5EX0A 1WKXA 4E1RA 5HI7A 3E2IA 1R0RI 1FARA 1P9ZA 4DNCA 5JHWC 3FSXA 5DAEA 1IY5A 2X3TA 2SGDI 1BMOA 2J9RA 3TJQA 3TOAA 1ULMA 1HPTA 4E1PA 2ARPF 3QWPA 1M8CA 2KMQA 5E3PA 3FC3A 5E3RA 2JW6A 1TIHA 1W4RA 1TUSA 1ULKA 2ENZA 5EX3A 3GOXA 1FAQA 3R5DA 3UEJA 1LR7A 2CWGA 1CGII 4L9MA 1TBRR 1V1IA 3RU0A 1TBQR 2KMRA 2LB7A 2P6AC 2PQ8A 2ROWA 5FUVA 1OYVI 2CWFA 1FY7A 1MT1A 2N1AB 3R5AA 3TO6A 2SGEI 1BUSA 3OXLA 1PTRA 2F3CI 2OZUA 2E5RA 1TURA 2XRCA 3CXLA 4UXHA 1S20A 5E3QA 4AMLA 3OXGA 2ERWA 2A20A 3TOBA 2W0TA 1K7TA 3VDPA 2GKVA 3UGLA 4A24A 3BJIA 1CSOI 3SEKC 2GKRI 3B4VC 4FKDA 3UGIA 1H0ZA 1P9GA 1WGTA 1UVGA 2DKVA 1YU6C 3TO9A 1CT2I 2ORWA 5J8CA 2FNFX 2OD1A 4UXJA 2J87A 7WGAA 4MPIA 2SGPI 1HDLA 2K9HA 3OVOA 3OL0A 1HJAI 3HH2C 3VE5A 2B0UC 1PPFI 2SGQI 3OXFA 3UEYA 2ODDA 2NU2I 1MJAA 1NXUA 2JYYA 2SGFI 4JCVE 1Y1CA 3UGDA 2GVIA 1SGNI 5HQ8A 1SGYI 2RIJA 1OMTA 1UVFA 1V1HA 1UHAA 1K7VA 2BUSA 2ENNA 2WVJA 3D00A 1PJUA 4WP4A 2JXDA 2JA1A 2X52A 1CE3A 1WGCA 2KMPA 2NU3I 1OVOA 1FYBA 2QQDA 1TGSI 1SGRI 5FUWA 3QTLD 3SGQI 2KCXA 3UFFA 1SGDI 2LEOA 2WCYA 3PDNA 4OVOA 1XA6A 4UXIA 1ULNA 2NU4I 1Y1BA 2VRWB 2Y0MA 4HGUA 1Q9BA 2CWHA 1IY6A 2KMOA 2CJSC
chains in the Genus database with same CATH topology
1LR9A 2NU0I 2L8EA 1AN1I 2YUUA 5CCLA 2N71A 1N13A 1X4SA 2M5XA 2V1CA 1OMUA 1UUCA 2N17A 1CT4I 2JZMA 1SGQI 4B6DA 1W3SA 1X74A 2NU1I 1PCEA 1KBFA 4SGBI 2L7XA 1VDDA 2UZ3A 1YTPA 3VDUA 1R79A 3KY9A 4GI3C 3SGBI 1CT0I 1KMAA 3MEKA 1XBTA 1NUBA 2QPOA 2YQPA 2QQEA 1TBNA 1KBEA 1RFHA 1CGJI 2V1CC 2N52A 3E59A 1LR8A 2ELIA 1PTQA 2ORVA 2QQCA 2GKTI 1Y8FA 1M8BA 2DIPA 1IW4A 1SGEI 2OVOA 5FUYA 1DS3I 1U5KA 5FUXA 2QQ0A 1DS2I 1SGPI 1TBOA 2DB6A 2LUYA 1Z7KB 1CHOI 1XX6A 2V53A 2B8TA 1TOTA 2E73A 5EX0A 4E1RA 5HI7A 3E2IA 1R0RI 1FARA 5JHWC 1IY5A 2SGDI 1BMOA 2J9RA 3TJQA 4E1PA 1HPTA 2ARPF 3QWPA 1M8CA 2KMQA 3FC3A 2JW6A 1TIHA 1W4RA 1TUSA 2ENZA 5EX3A 3GOXA 1FAQA 3UEJA 1LR7A 1CGII 4L9MA 1TBRR 1V1IA 3RU0A 1TBQR 2KMRA 2P6AC 2ROWA 5FUVA 1OYVI 2N1AB 1MT1A 2SGEI 1BUSA 3OXLA 1PTRA 2F3CI 2E5RA 1TURA 2XRCA 3CXLA 4UXHA 3OXGA 2ERWA 2A20A 2W0TA 3VDPA 2GKVA 3UGLA 4A24A 3BJIA 1CSOI 3SEKC 2GKRI 3B4VC 4FKDA 3UGIA 1H0ZA 1UVGA 1YU6C 1CT2I 2ORWA 2FNFX 2OD1A 4UXJA 2J87A 1HDLA 2SGPI 2K9HA 3OVOA 3OL0A 1HJAI 3HH2C 3VE5A 2B0UC 1PPFI 2SGQI 3OXFA 3UEYA 2ODDA 2NU2I 2JYYA 2SGFI 4JCVE 1Y1CA 3UGDA 2GVIA 1SGNI 5HQ8A 1SGYI 3D00A 1OMTA 1UVFA 1V1HA 2BUSA 2WVJA 2ENNA 5DAEA 1PJUA 2JXDA 2JA1A 1CE3A 2KMPA 2NU3I 1OVOA 1FYBA 2QQDA 1TGSI 1SGRI 5FUWA 3QTLD 3SGQI 2KCXA 3UFFA 1SGDI 2LEOA 2WCYA 3PDNA 4OVOA 1XA6A 4UXIA 2NU4I 1Y1BA 2VRWB 4HGUA 5CCMA 1IY6A 2KMOA 2CJSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LR9 A;  2NU0 I;  1AN1 I;  2N71 A;  1N13 A;  2M5X A;  1OMU A;  1UUC A;  2N17 A;  1CT4 I;  2JZM A;  1SGQ I;  2NU1 I;  1PCE A;  4SGB I;  1YTP A;  4GI3 C;  3SGB I;  1CT0 I;  1KMA A;  1NUB A;  1CGJ I;  2N52 A;  1LR8 A;  2QQC A;  2GKT I;  1M8B A;  1IW4 A;  1SGE I;  2OVO A;  1DS3 I;  1DS2 I;  1SGP I;  1Z7K B;  1CHO I;  2V53 A;  1R0R I;  5JHW C;  1IY5 A;  2SGD I;  1BMO A;  3TJQ A;  1HPT A;  2ARP F;  1M8C A;  2KMQ A;  1TIH A;  1TUS A;  1LR7 A;  1CGI I;  1TBR R;  1TBQ R;  2KMR A;  2P6A C;  1OYV I;  1MT1 A;  2SGE I;  1BUS A;  2F3C I;  2XRC A;  1TUR A;  2ERW A;  2GKV A;  1CSO I;  3SEK C;  2GKR I;  3B4V C;  1H0Z A;  1UVG A;  1YU6 C;  1CT2 I;  1HDL A;  2SGP I;  3OVO A;  1HJA I;  3HH2 C;  2B0U C;  1PPF I;  2SGQ I;  2NU2 I;  2JYY A;  2SGF I;  1Y1C A;  1SGN I;  1SGY I;  5DAE A;  1OMT A;  1UVF A;  2BUS A;  1PJU A;  2JXD A;  1CE3 A;  2KMP A;  2NU3 I;  1OVO A;  1FYB A;  2QQD A;  1TGS I;  1SGR I;  3QTL D;  3SGQ I;  2KCX A;  1SGD I;  2LEO A;  2WCY A;  4OVO A;  2NU4 I;  1Y1B A;  4HGU A;  1IY6 A;  2KMO A; 
#chains in the Genus database with same CATH topology
 1MJB A;  3FSY A;  1LR9 A;  2NU0 I;  2L8E A;  1AN1 I;  2YUU A;  1K7U A;  3UOE A;  5CCL A;  2N71 A;  1N13 A;  1X4S A;  2M5X A;  2V1C A;  1WTJ A;  1OMU A;  1UUC A;  2N17 A;  1CT4 I;  2JZM A;  1SGQ I;  4B6D A;  1MJ9 A;  1W3S A;  1X74 A;  5CCM A;  2NU1 I;  2OU2 A;  1PCE A;  1KBF A;  4SGB I;  2L7X A;  1VDD A;  2UZ3 A;  1YTP A;  3VDU A;  1R79 A;  3KY9 A;  1Z2I A;  4GI3 C;  3QAH A;  1CT0 I;  3SGB I;  3MEK A;  1XBT A;  1NUB A;  2QPO A;  2YQP A;  9WGA A;  1KMA A;  2QQE A;  2WGC A;  1TBN A;  1HEV A;  1KBE A;  1RFH A;  1CGJ I;  2V1C C;  2GIV A;  2N52 A;  3E59 A;  5J8F A;  1LR8 A;  3R5C A;  2ELI A;  1PTQ A;  2ORV A;  2QQC A;  2GKT I;  2RC4 A;  1Y8F A;  1M8B A;  2DIP A;  2UVO A;  1IW4 A;  1SGE I;  2OVO A;  5FUY A;  1DS3 I;  1U5K A;  5FUX A;  2QQ0 A;  1DS2 I;  1SGP I;  1TBO A;  3R5B A;  3TO7 A;  2DB6 A;  2LUY A;  1Z7K B;  1CHO I;  1XX6 A;  2V53 A;  2B8T A;  1TOT A;  2E73 A;  5EX0 A;  1WKX A;  4E1R A;  5HI7 A;  3E2I A;  1R0R I;  1FAR A;  1P9Z A;  4DNC A;  5JHW C;  3FSX A;  5DAE A;  1IY5 A;  2X3T A;  2SGD I;  1BMO A;  2J9R A;  3TJQ A;  3TOA A;  1ULM A;  1HPT A;  4E1P A;  2ARP F;  3QWP A;  1M8C A;  2KMQ A;  5E3P A;  3FC3 A;  5E3R A;  2JW6 A;  1TIH A;  1W4R A;  1TUS A;  1ULK A;  2ENZ A;  5EX3 A;  3GOX A;  1FAQ A;  3R5D A;  3UEJ A;  1LR7 A;  2CWG A;  1CGI I;  4L9M A;  1TBR R;  1V1I A;  3RU0 A;  1TBQ R;  2KMR A;  2LB7 A;  2P6A C;  2PQ8 A;  2ROW A;  5FUV A;  1OYV I;  2CWF A;  1FY7 A;  1MT1 A;  2N1A B;  3R5A A;  3TO6 A;  2SGE I;  1BUS A;  3OXL A;  1PTR A;  2F3C I;  2OZU A;  2E5R A;  1TUR A;  2XRC A;  3CXL A;  4UXH A;  1S20 A;  5E3Q A;  4AML A;  3OXG A;  2ERW A;  2A20 A;  3TOB A;  2W0T A;  1K7T A;  3VDP A;  2GKV A;  3UGL A;  4A24 A;  3BJI A;  1CSO I;  3SEK C;  2GKR I;  3B4V C;  4FKD A;  3UGI A;  1H0Z A;  1P9G A;  1WGT A;  1UVG A;  2DKV A;  1YU6 C;  3TO9 A;  1CT2 I;  2ORW A;  5J8C A;  2FNF X;  2OD1 A;  4UXJ A;  2J87 A;  7WGA A;  4MPI A;  2SGP I;  1HDL A;  2K9H A;  3OVO A;  3OL0 A;  1HJA I;  3HH2 C;  3VE5 A;  2B0U C;  1PPF I;  2SGQ I;  3OXF A;  3UEY A;  2ODD A;  2NU2 I;  1MJA A;  1NXU A;  2JYY A;  2SGF I;  4JCV E;  1Y1C A;  3UGD A;  2GVI A;  1SGN I;  5HQ8 A;  1SGY I;  2RIJ A;  1OMT A;  1UVF A;  1V1H A;  1UHA A;  1K7V A;  2BUS A;  2ENN A;  2WVJ A;  3D00 A;  1PJU A;  4WP4 A;  2JXD A;  2JA1 A;  2X52 A;  1CE3 A;  1WGC A;  2KMP A;  2NU3 I;  1OVO A;  1FYB A;  2QQD A;  1TGS I;  1SGR I;  5FUW A;  3QTL D;  3SGQ I;  2KCX A;  3UFF A;  1SGD I;  2LEO A;  2WCY A;  3PDN A;  4OVO A;  1XA6 A;  4UXI A;  1ULN A;  2NU4 I;  1Y1B A;  2VRW B;  2Y0M A;  4HGU A;  1Q9B A;  2CWH A;  1IY6 A;  2KMO A;  2CJS C; 
#chains in the Genus database with same CATH homology
 1LR9 A;  2NU0 I;  2L8E A;  1AN1 I;  2YUU A;  5CCL A;  2N71 A;  1N13 A;  1X4S A;  2M5X A;  2V1C A;  1OMU A;  1UUC A;  2N17 A;  1CT4 I;  2JZM A;  1SGQ I;  4B6D A;  1W3S A;  1X74 A;  2NU1 I;  1PCE A;  1KBF A;  4SGB I;  2L7X A;  1VDD A;  2UZ3 A;  1YTP A;  3VDU A;  1R79 A;  3KY9 A;  4GI3 C;  3SGB I;  1CT0 I;  1KMA A;  3MEK A;  1XBT A;  1NUB A;  2QPO A;  2YQP A;  2QQE A;  1TBN A;  1KBE A;  1RFH A;  1CGJ I;  2V1C C;  2N52 A;  3E59 A;  1LR8 A;  2ELI A;  1PTQ A;  2ORV A;  2QQC A;  2GKT I;  1Y8F A;  1M8B A;  2DIP A;  1IW4 A;  1SGE I;  2OVO A;  5FUY A;  1DS3 I;  1U5K A;  5FUX A;  2QQ0 A;  1DS2 I;  1SGP I;  1TBO A;  2DB6 A;  2LUY A;  1Z7K B;  1CHO I;  1XX6 A;  2V53 A;  2B8T A;  1TOT A;  2E73 A;  5EX0 A;  4E1R A;  5HI7 A;  3E2I A;  1R0R I;  1FAR A;  5JHW C;  1IY5 A;  2SGD I;  1BMO A;  2J9R A;  3TJQ A;  4E1P A;  1HPT A;  2ARP F;  3QWP A;  1M8C A;  2KMQ A;  3FC3 A;  2JW6 A;  1TIH A;  1W4R A;  1TUS A;  2ENZ A;  5EX3 A;  3GOX A;  1FAQ A;  3UEJ A;  1LR7 A;  1CGI I;  4L9M A;  1TBR R;  1V1I A;  3RU0 A;  1TBQ R;  2KMR A;  2P6A C;  2ROW A;  5FUV A;  1OYV I;  2N1A B;  1MT1 A;  2SGE I;  1BUS A;  3OXL A;  1PTR A;  2F3C I;  2E5R A;  1TUR A;  2XRC A;  3CXL A;  4UXH A;  3OXG A;  2ERW A;  2A20 A;  2W0T A;  3VDP A;  2GKV A;  3UGL A;  4A24 A;  3BJI A;  1CSO I;  3SEK C;  2GKR I;  3B4V C;  4FKD A;  3UGI A;  1H0Z A;  1UVG A;  1YU6 C;  1CT2 I;  2ORW A;  2FNF X;  2OD1 A;  4UXJ A;  2J87 A;  1HDL A;  2SGP I;  2K9H A;  3OVO A;  3OL0 A;  1HJA I;  3HH2 C;  3VE5 A;  2B0U C;  1PPF I;  2SGQ I;  3OXF A;  3UEY A;  2ODD A;  2NU2 I;  2JYY A;  2SGF I;  4JCV E;  1Y1C A;  3UGD A;  2GVI A;  1SGN I;  5HQ8 A;  1SGY I;  3D00 A;  1OMT A;  1UVF A;  1V1H A;  2BUS A;  2WVJ A;  2ENN A;  5DAE A;  1PJU A;  2JXD A;  2JA1 A;  1CE3 A;  2KMP A;  2NU3 I;  1OVO A;  1FYB A;  2QQD A;  1TGS I;  1SGR I;  5FUW A;  3QTL D;  3SGQ I;  2KCX A;  3UFF A;  1SGD I;  2LEO A;  2WCY A;  3PDN A;  4OVO A;  1XA6 A;  4UXI A;  2NU4 I;  1Y1B A;  2VRW B;  4HGU A;  5CCM A;  1IY6 A;  2KMO A;  2CJS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...