2N17A

Nmr structure of a kazal-type serine protease inhibitor from the subterranean termite defense gland of coptotermes formosanus shiraki soldiers
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
CQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme-Protease Inhibitor Protein
publication title A Kazal-Type Serine Protease Inhibitor from the Defense Gland Secretion of the Subterranean Termite Coptotermes formosanus Shiraki.
pubmed doi rcsb
source organism Coptotermes formosanus
molecule tags Hydrolase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n17A00
2NU2I 2KCXA 1MT1A 2QQCA 1M8BA 1CT2I 2GKTI 1BMOA 1SGRI 1OYVI 4OVOA 2WCYA 1OMUA 2B0UC 1TBQR 2NU1I 1YU6C 2NU0I 1IY6A 1N13A 2SGQI 1NUBA 1DS3I 1SGPI 2XRCA 2N71A 2OVOA 1CT0I 1PJUA 2KMOA 3HH2C 1TUSA 5DAEA 2JZMA 1TURA 2LEOA 3SEKC 2F3CI 2SGPI 1UVFA 1LR9A 1BUSA 1Z7KB 2ARPF 1Y1BA 2QQDA 1SGYI 1OMTA 1CE3A 1SGQI 2NU3I 1PCEA 1CT4I 1H0ZA 1R0RI 1Y1CA 1TGSI 1M8CA 1TBRR 3SGBI 1HDLA 1KMAA 1SGNI 1IY5A 2ERWA 2KMPA 3SGQI 1YTPA 3OVOA 2M5XA 2N52A 2SGDI 2V53A 2KMRA 3QTLD 1HPTA 2BUSA 2SGFI 1HJAI 2KMQA 1OVOA 1LR8A 4SGBI 2GKVA 1UVGA 1SGDI 1FYBA 1AN1I 2N17A 2JXDA 2P6AC 1DS2I 1CHOI 1CSOI 2JYYA 2GKRI 5JHWC 1SGEI 3B4VC 1CGII 1PPFI 1LR7A 3TJQA 1UUCA 2SGEI 1IW4A 2NU4I 4HGUA 1CGJI 1TIHA 4GI3C
chains in the Genus database with same CATH superfamily
2W0TA 3OXFA 2NU2I 2KCXA 1MT1A 2LB7A 1WGCA 2QQCA 2UZ3A 5CCMA 1XX6A 1NXUA 4UXIA 4B6DA 1M8BA 2E73A 3TO7A 1CT2I 1FARA 2UVOA 2GKTI 2ELIA 1Z2IA 2GIVA 2E5RA 1BMOA 1SGRI 2V1CA 2ORWA 1W4RA 1OYVI 3E2IA 4OVOA 3UEYA 2QQ0A 2WCYA 2V1CC 5E3PA 1FY7A 1OMUA 2B0UC 3RU0A 1TBQR 2NU1I 1WKXA 2LUYA 1K7VA 1R79A 1YU6C 1WGTA 2NU0I 3FSXA 4DNCA 1IY6A 1N13A 3VDUA 3TO6A 1X74A 5FUXA 1KBEA 1ULNA 2DB6A 2SGQI 1PTQA 1NUBA 1DS3I 4MPIA 5E3QA 1RFHA 1SGPI 2CWHA 1S20A 1XA6A 2N1AB 2XRCA 4FKDA 2ROWA 2N71A 2OVOA 1VDDA 1CT0I 1PJUA 2ENZA 2KMOA 3HH2C 1TUSA 5DAEA 2OU2A 3UOEA 1HEVA 2JZMA 4E1PA 3TO9A 1TURA 2K9HA 2LEOA 3E59A 3SEKC 2F3CI 2SGPI 4L9MA 5FUWA 1K7UA 2J9RA 1MJ9A 1X4SA 1UVFA 2Y0MA 3OXLA 3QWPA 1LR9A 1BUSA 1Z7KB 2ARPF 1Y1BA 2JA1A 1SGYI 2QQDA 3OL0A 2QPOA 1OMTA 3R5AA 2A20A 5FUYA 2X52A 1CE3A 4A24A 1V1HA 1WTJA 9WGAA 1SGQI 2NU3I 3FC3A 1PCEA 1CT4I 2ENNA 2FNFX 1H0ZA 1R0RI 2DIPA 1Y1CA 1U5KA 1TGSI 2L8EA 2YQPA 3UFFA 4E1RA 3VDPA 1K7TA 1M8CA 1TBRR 2VRWB 4UXHA 3SGBI 1HDLA 1KMAA 3UGIA 3UEJA 1SGNI 1TBOA 4WP4A 2ERWA 5J8CA 1IY5A 2JW6A 2OD1A 4JCVE 2KMPA 5FUVA 3OXGA 1TBNA 3SGQI 1YTPA 3OVOA 2M5XA 1V1IA 2J87A 1P9GA 2N52A 2GVIA 2SGDI 2V53A 2KMRA 3QTLD 4UXJA 5J8FA 1HPTA 2OZUA 2BUSA 2SGFI 3GOXA 1HJAI 3TOBA 2KMQA 2CWFA 1OVOA 1LR8A 1Q9BA 4SGBI 3KY9A 2GKVA 3FSYA 3PDNA 1UVGA 2CJSC 1PTRA 1SGDI 4GI3C 1FYBA 3CXLA 1AN1I 2RC4A 2ORVA 1ULKA 2N17A 2JXDA 2DKVA 2P6AC 3R5DA 3UGDA 1DS2I 1MJAA 5CCLA 1CHOI 2YUUA 1CSOI 2B8TA 2GKRI 2JYYA 5JHWC 2QQEA 1SGEI 5E3RA 3B4VC 1CGII 1PPFI 1LR7A 1UHAA 2L7XA 2RIJA 3TJQA 3TOAA 3BJIA 3MEKA 2WVJA 1UUCA 1Y8FA 2CWGA 3R5BA 3UGLA 2SGEI 1TOTA 2WGCA 4AMLA 1KBFA 2PQ8A 1W3SA 3R5CA 1IW4A 1XBTA 2X3TA 1ULMA 5EX0A 1P9ZA 2NU4I 1MJBA 5HI7A 5HQ8A 5EX3A 3D00A 7WGAA 4HGUA 1FAQA 2ODDA 1CGJI 3VE5A 1TIHA 3QAHA
chains in the Genus database with same CATH topology
2W0TA 3OXFA 2NU2I 2KCXA 1MT1A 2QQCA 2UZ3A 5CCMA 1XX6A 4UXIA 4B6DA 1M8BA 2E73A 1CT2I 1FARA 2GKTI 2ELIA 2E5RA 1BMOA 1SGRI 2V1CA 2ORWA 1W4RA 1OYVI 3E2IA 4OVOA 2QQ0A 2WCYA 2V1CC 1OMUA 2B0UC 3RU0A 1TBQR 2NU1I 2LUYA 1R79A 1YU6C 2NU0I 1IY6A 1N13A 3VDUA 1X74A 5FUXA 1KBEA 2DB6A 2SGQI 1PTQA 1NUBA 1DS3I 3UEYA 1RFHA 1SGPI 1XA6A 2N1AB 2XRCA 4FKDA 2ROWA 2N71A 2OVOA 1VDDA 1CT0I 1PJUA 2ENZA 2KMOA 3HH2C 1TUSA 5DAEA 2JZMA 4E1PA 1TURA 2K9HA 2LEOA 3E59A 3SEKC 2F3CI 2SGPI 4L9MA 5FUWA 2J9RA 1X4SA 1UVFA 3OXLA 3QWPA 1LR9A 1BUSA 1Z7KB 2ARPF 1Y1BA 2JA1A 1SGYI 2QQDA 3OL0A 2QPOA 1OMTA 2A20A 5FUYA 1CE3A 4A24A 1V1HA 1SGQI 2NU3I 3FC3A 1PCEA 1CT4I 2ENNA 2FNFX 1H0ZA 1R0RI 2DIPA 1Y1CA 1U5KA 1TGSI 2L8EA 2YQPA 3UFFA 4E1RA 3VDPA 2VRWB 1M8CA 1TBRR 4UXHA 3SGBI 1HDLA 1KMAA 3UGIA 3UEJA 1SGNI 1TBOA 1IY5A 2ERWA 2JW6A 2OD1A 4JCVE 2KMPA 5FUVA 3OXGA 1TBNA 3SGQI 1YTPA 3OVOA 2M5XA 1V1IA 2J87A 2N52A 2GVIA 2SGDI 2V53A 2KMRA 3QTLD 4UXJA 1HPTA 2BUSA 2SGFI 3GOXA 1HJAI 2KMQA 1OVOA 1LR8A 4SGBI 3KY9A 2GKVA 3PDNA 1UVGA 2CJSC 1PTRA 1SGDI 1FYBA 3CXLA 1AN1I 2ORVA 2N17A 2JXDA 2P6AC 3UGDA 1DS2I 5CCLA 1CHOI 2YUUA 1CSOI 2B8TA 2GKRI 2JYYA 5JHWC 2QQEA 1SGEI 3B4VC 1CGII 1PPFI 1LR7A 2L7XA 3TJQA 3BJIA 3MEKA 2WVJA 1UUCA 1Y8FA 3UGLA 2SGEI 1TOTA 1KBFA 1W3SA 1IW4A 1XBTA 5EX0A 2NU4I 5HI7A 5HQ8A 5EX3A 3D00A 4HGUA 1FAQA 2ODDA 1CGJI 3VE5A 1TIHA 4GI3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NU2 I;  2KCX A;  1MT1 A;  2QQC A;  1M8B A;  1CT2 I;  2GKT I;  1BMO A;  1SGR I;  1OYV I;  4OVO A;  2WCY A;  1OMU A;  2B0U C;  1TBQ R;  2NU1 I;  1YU6 C;  2NU0 I;  1IY6 A;  1N13 A;  2SGQ I;  1NUB A;  1DS3 I;  1SGP I;  2XRC A;  2N71 A;  2OVO A;  1CT0 I;  1PJU A;  2KMO A;  3HH2 C;  1TUS A;  5DAE A;  2JZM A;  1TUR A;  2LEO A;  3SEK C;  2F3C I;  2SGP I;  1UVF A;  1LR9 A;  1BUS A;  1Z7K B;  2ARP F;  1Y1B A;  2QQD A;  1SGY I;  1OMT A;  1CE3 A;  1SGQ I;  2NU3 I;  1PCE A;  1CT4 I;  1H0Z A;  1R0R I;  1Y1C A;  1TGS I;  1M8C A;  1TBR R;  3SGB I;  1HDL A;  1KMA A;  1SGN I;  1IY5 A;  2ERW A;  2KMP A;  3SGQ I;  1YTP A;  3OVO A;  2M5X A;  2N52 A;  2SGD I;  2V53 A;  2KMR A;  3QTL D;  1HPT A;  2BUS A;  2SGF I;  1HJA I;  2KMQ A;  1OVO A;  1LR8 A;  4SGB I;  2GKV A;  1UVG A;  1SGD I;  1FYB A;  1AN1 I;  2N17 A;  2JXD A;  2P6A C;  1DS2 I;  1CHO I;  1CSO I;  2JYY A;  2GKR I;  5JHW C;  1SGE I;  3B4V C;  1CGI I;  1PPF I;  1LR7 A;  3TJQ A;  1UUC A;  2SGE I;  1IW4 A;  2NU4 I;  4HGU A;  1CGJ I;  1TIH A;  4GI3 C; 
#chains in the Genus database with same CATH topology
 2W0T A;  3OXF A;  2NU2 I;  2KCX A;  1MT1 A;  2LB7 A;  1WGC A;  2QQC A;  2UZ3 A;  5CCM A;  1XX6 A;  1NXU A;  4UXI A;  4B6D A;  1M8B A;  2E73 A;  3TO7 A;  1CT2 I;  1FAR A;  2UVO A;  2GKT I;  2ELI A;  1Z2I A;  2GIV A;  2E5R A;  1BMO A;  1SGR I;  2V1C A;  2ORW A;  1W4R A;  1OYV I;  3E2I A;  4OVO A;  3UEY A;  2QQ0 A;  2WCY A;  2V1C C;  5E3P A;  1FY7 A;  1OMU A;  2B0U C;  3RU0 A;  1TBQ R;  2NU1 I;  1WKX A;  2LUY A;  1K7V A;  1R79 A;  1YU6 C;  1WGT A;  2NU0 I;  3FSX A;  4DNC A;  1IY6 A;  1N13 A;  3VDU A;  3TO6 A;  1X74 A;  5FUX A;  1KBE A;  1ULN A;  2DB6 A;  2SGQ I;  1PTQ A;  1NUB A;  1DS3 I;  4MPI A;  5E3Q A;  1RFH A;  1SGP I;  2CWH A;  1S20 A;  1XA6 A;  2N1A B;  2XRC A;  4FKD A;  2ROW A;  2N71 A;  2OVO A;  1VDD A;  1CT0 I;  1PJU A;  2ENZ A;  2KMO A;  3HH2 C;  1TUS A;  5DAE A;  2OU2 A;  3UOE A;  1HEV A;  2JZM A;  4E1P A;  3TO9 A;  1TUR A;  2K9H A;  2LEO A;  3E59 A;  3SEK C;  2F3C I;  2SGP I;  4L9M A;  5FUW A;  1K7U A;  2J9R A;  1MJ9 A;  1X4S A;  1UVF A;  2Y0M A;  3OXL A;  3QWP A;  1LR9 A;  1BUS A;  1Z7K B;  2ARP F;  1Y1B A;  2JA1 A;  1SGY I;  2QQD A;  3OL0 A;  2QPO A;  1OMT A;  3R5A A;  2A20 A;  5FUY A;  2X52 A;  1CE3 A;  4A24 A;  1V1H A;  1WTJ A;  9WGA A;  1SGQ I;  2NU3 I;  3FC3 A;  1PCE A;  1CT4 I;  2ENN A;  2FNF X;  1H0Z A;  1R0R I;  2DIP A;  1Y1C A;  1U5K A;  1TGS I;  2L8E A;  2YQP A;  3UFF A;  4E1R A;  3VDP A;  1K7T A;  1M8C A;  1TBR R;  2VRW B;  4UXH A;  3SGB I;  1HDL A;  1KMA A;  3UGI A;  3UEJ A;  1SGN I;  1TBO A;  4WP4 A;  2ERW A;  5J8C A;  1IY5 A;  2JW6 A;  2OD1 A;  4JCV E;  2KMP A;  5FUV A;  3OXG A;  1TBN A;  3SGQ I;  1YTP A;  3OVO A;  2M5X A;  1V1I A;  2J87 A;  1P9G A;  2N52 A;  2GVI A;  2SGD I;  2V53 A;  2KMR A;  3QTL D;  4UXJ A;  5J8F A;  1HPT A;  2OZU A;  2BUS A;  2SGF I;  3GOX A;  1HJA I;  3TOB A;  2KMQ A;  2CWF A;  1OVO A;  1LR8 A;  1Q9B A;  4SGB I;  3KY9 A;  2GKV A;  3FSY A;  3PDN A;  1UVG A;  2CJS C;  1PTR A;  1SGD I;  4GI3 C;  1FYB A;  3CXL A;  1AN1 I;  2RC4 A;  2ORV A;  1ULK A;  2N17 A;  2JXD A;  2DKV A;  2P6A C;  3R5D A;  3UGD A;  1DS2 I;  1MJA A;  5CCL A;  1CHO I;  2YUU A;  1CSO I;  2B8T A;  2GKR I;  2JYY A;  5JHW C;  2QQE A;  1SGE I;  5E3R A;  3B4V C;  1CGI I;  1PPF I;  1LR7 A;  1UHA A;  2L7X A;  2RIJ A;  3TJQ A;  3TOA A;  3BJI A;  3MEK A;  2WVJ A;  1UUC A;  1Y8F A;  2CWG A;  3R5B A;  3UGL A;  2SGE I;  1TOT A;  2WGC A;  4AML A;  1KBF A;  2PQ8 A;  1W3S A;  3R5C A;  1IW4 A;  1XBT A;  2X3T A;  1ULM A;  5EX0 A;  1P9Z A;  2NU4 I;  1MJB A;  5HI7 A;  5HQ8 A;  5EX3 A;  3D00 A;  7WGA A;  4HGU A;  1FAQ A;  2ODD A;  1CGJ I;  3VE5 A;  1TIH A;  3QAH A; 
#chains in the Genus database with same CATH homology
 2W0T A;  3OXF A;  2NU2 I;  2KCX A;  1MT1 A;  2QQC A;  2UZ3 A;  5CCM A;  1XX6 A;  4UXI A;  4B6D A;  1M8B A;  2E73 A;  1CT2 I;  1FAR A;  2GKT I;  2ELI A;  2E5R A;  1BMO A;  1SGR I;  2V1C A;  2ORW A;  1W4R A;  1OYV I;  3E2I A;  4OVO A;  2QQ0 A;  2WCY A;  2V1C C;  1OMU A;  2B0U C;  3RU0 A;  1TBQ R;  2NU1 I;  2LUY A;  1R79 A;  1YU6 C;  2NU0 I;  1IY6 A;  1N13 A;  3VDU A;  1X74 A;  5FUX A;  1KBE A;  2DB6 A;  2SGQ I;  1PTQ A;  1NUB A;  1DS3 I;  3UEY A;  1RFH A;  1SGP I;  1XA6 A;  2N1A B;  2XRC A;  4FKD A;  2ROW A;  2N71 A;  2OVO A;  1VDD A;  1CT0 I;  1PJU A;  2ENZ A;  2KMO A;  3HH2 C;  1TUS A;  5DAE A;  2JZM A;  4E1P A;  1TUR A;  2K9H A;  2LEO A;  3E59 A;  3SEK C;  2F3C I;  2SGP I;  4L9M A;  5FUW A;  2J9R A;  1X4S A;  1UVF A;  3OXL A;  3QWP A;  1LR9 A;  1BUS A;  1Z7K B;  2ARP F;  1Y1B A;  2JA1 A;  1SGY I;  2QQD A;  3OL0 A;  2QPO A;  1OMT A;  2A20 A;  5FUY A;  1CE3 A;  4A24 A;  1V1H A;  1SGQ I;  2NU3 I;  3FC3 A;  1PCE A;  1CT4 I;  2ENN A;  2FNF X;  1H0Z A;  1R0R I;  2DIP A;  1Y1C A;  1U5K A;  1TGS I;  2L8E A;  2YQP A;  3UFF A;  4E1R A;  3VDP A;  2VRW B;  1M8C A;  1TBR R;  4UXH A;  3SGB I;  1HDL A;  1KMA A;  3UGI A;  3UEJ A;  1SGN I;  1TBO A;  1IY5 A;  2ERW A;  2JW6 A;  2OD1 A;  4JCV E;  2KMP A;  5FUV A;  3OXG A;  1TBN A;  3SGQ I;  1YTP A;  3OVO A;  2M5X A;  1V1I A;  2J87 A;  2N52 A;  2GVI A;  2SGD I;  2V53 A;  2KMR A;  3QTL D;  4UXJ A;  1HPT A;  2BUS A;  2SGF I;  3GOX A;  1HJA I;  2KMQ A;  1OVO A;  1LR8 A;  4SGB I;  3KY9 A;  2GKV A;  3PDN A;  1UVG A;  2CJS C;  1PTR A;  1SGD I;  1FYB A;  3CXL A;  1AN1 I;  2ORV A;  2N17 A;  2JXD A;  2P6A C;  3UGD A;  1DS2 I;  5CCL A;  1CHO I;  2YUU A;  1CSO I;  2B8T A;  2GKR I;  2JYY A;  5JHW C;  2QQE A;  1SGE I;  3B4V C;  1CGI I;  1PPF I;  1LR7 A;  2L7X A;  3TJQ A;  3BJI A;  3MEK A;  2WVJ A;  1UUC A;  1Y8F A;  3UGL A;  2SGE I;  1TOT A;  1KBF A;  1W3S A;  1IW4 A;  1XBT A;  5EX0 A;  2NU4 I;  5HI7 A;  5HQ8 A;  5EX3 A;  3D00 A;  4HGU A;  1FAQ A;  2ODD A;  1CGJ I;  3VE5 A;  1TIH A;  4GI3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...