3GOXA

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i in the absence of edta
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
molecule keywords Restriction endonuclease Hpy99I
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3goxA01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3goxA02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3goxA03
2RHIA 1EN7A 2M1HA 2EKOA 4L59A 3FC3A 3FLGA 2DAQA 2QQRA 2K3YA 4QQDA 3OS1A 4IUVA 4HCZA 3DB3A 3MEAA 1SSFA 2MWOA 3META 2EQJA 3BDLA 3UWNA 2R58A 2LRQA 5D6XA 4IUQA 5M9OA 2XK0A 3ME9A 4ZTFA 4A4FA 4N4HA 4A4GA 2K3XA 3E9FA 2EQMA 4IUUA 2RI2A 4NS5A 5IN1A 3LH0A 1WJQA 4IUPA 2NLUA 2BUDA 3DLMA 3MEVA 3QJ6A 1OZ2A 3OYJA 3S3NA 4E7KA 3OYEA 1RI0A 2WACA 2P0KA 3MEWA 2CKKA 3MP1A 4E7HA 3H6ZA 3OY9A 3OYFA 2DIQA 3M9QA 1XNIA 3S6WA 4C5IA 3F70A 4C5HA 4FL6A 3L42A 3OMCA 3OYBA 3OYAA 2QQSA 2RHYA 3E9GA 1WJSA 3LYIA 2E5QA 4Z02A 3OYCA 5IAYA 2HQEA 2LCCA 4C5EA 2L8DA 3OS0A 4OVAA 2EFIA 4X34A 4BDZA 4PLLA 4IKFA 5D6YA 3LX7A 3GOXA 5KCOA 3PMIA 2D9TA 3L2RA 2RI5A 2R5AA 3ZEHA 2R5MA 4IUTA 4BE0A 3OYIA 3OQ5A 2GFAA 1WJRA 3PFSA 2RJDA 2R57A 1WGSA 2L3RA 3MP6A 1OI1A 2X4WA 5KCHA 5KE3A 3OYMA 2QNFA 4PL6A 4LD6A 2RHZA 3NTKA 3L2VA 3S3MA 2X35A 2RHUA 3OMGA 2QNCA 3PNWC 2LVMA 3PMTA 2IG0A 5D6WA 3MO8A 3L2UA 2LTOA 3P8DA 2RI3A 4E7LA 2JZ2A 2VYTA 1OZ3A 3FEOA 3LGFA 3OYKA 2BKDN 4N4IA 1E7LA 4QW2A 3Q1JA 3L2QA 2GFUA 3QKJA 4A4HA 2F5KA 5FRMA 1N27A 3OYGA 3P8HA 2E6NA 2O4XB 3O8VA 5J39A 1H3ZA 3NTIA 5KE2A 3CEYA 3LGLA 2M16A 4PLIA 3S3OA 3MP8A 2M0OA 4FU6A 4C5GA 1MHNA 3L2WA 2JTFA 2YRVA 2RHXA 4N4GA 3C4SA 4BDYA 4BE2A 5FRNA 4QVZA 1KHCA 4EDUA 2HQXA 3ASKA 4B9XA 5C6SA 4Q5WA 2X4XA 3KUFA 3OA6A 4BE1A 4BD3A 3OYLA 4E7JA 2X4YA 2LDMA 2GF7A 2O4XA 2PQWA 3OB9A 3H8ZA 4GY5A 3OS2A 3OYNA 3LLRA 4IURA 2EQUA 3SD4A 2G3RA 3UT1A 2RJCA 2RO0A 4CRIA 5FROA 2L89A 1G5VA 4II1A 2DIGA 3FDRA 5CIUA 2BIVA 3MEUA 4A4EA 3EAEA 4RG2A 2RJFA 5KH6A 2B8AA 3OYHA 1OYXA 2MWPA 4QQ6A 4QQGA 3QIIA 2EQKA 5J26A 4ZTJA 1E7DA 5C0MA 3QBYA 3NTHA 4BACA 2FHDA 2RJEA 4B9WA 3OYDA 3DB4A 4UC4A 2XDPA 4E7IA
chains in the Genus database with same CATH superfamily
2QXFA 5FU6B 3FJ5A 3QYGB 1CT0I 4PKCC 2LX9A 2WSFE 2RMOA 5CQYA 1P9ZA 1LR9A 4A4GA 4M7DD 1YTPA 2M02A 1P9GA 3LWIA 4Z89A 3QG1A 1VQKA 1ULMA 5GAN2 2CGHA 2KMPA 4QVDA 3L2ZA 1HJAI 4CI0C 1BUSA 3OYBA 2UZ3A 3OS0A 2SGDI 4BDZA 3BW1A 1TTHB 2YXYA 1YU6C 3EG0A 3OBYA 3PMIA 1M3AA 2DL8A 1IW4A 1Q82U 2YRCA 1PPFI 1IY6A 2RJDA 1YI2Q 3PDNA 2CT3A 3M4YA 1ZUUA 4AFSC 1PSFA 3G6ET 2Y4YA 3MJXA 4EMHA 2D0QB 5CK9A 1ZBJA 1IZ6A 3QAHA 3JCMe 5FW9A 1D1AA 2XDDA 3Q1JA 1KIKA 1SGRI 4IIMA 5KE2A 2NU4I 3CCRQ 2J9RA 2YUQA 1S20A 3CMET 2KE9A 2F5TX 3ASKA 9ATCB 1VUBA 1AN1I 5C6SA 1U1SA 2K4YA 1Q9BA 4QVCA 4HCBA 4OB2B 3GF5A 5GMKl 3H8ZA 1VQ6A 2C0OA 2OVOA 4Z8AA 1YJWT 4IURA 2KYBA 3M59A 2G3RA 5J3BA 1W4RA 2YRDA 1BCMA 2D1XA 4F7UG 4FKDA 1W3SA 1PTQA 4JS4A 1OYXA 3HL8A 4OB0B 3QBYA 3EGXB 1OULA 1R0BG 2NUPA 3KFVA 1PJUA 1WHLA 4AFUC 4E7IA 9WGAA 4FYVB 5HKCA 3FC3A 4AMLA 3CCVA 2KY9A 1VQ5Q 1C1AA 4AG2C 2V1CA 1MMGA 3QDRB 4IUVA 2J6FA 1PNJA 3JAME 1QVGP 2JA1A 2HQHA 3J80E 2BUDA 1I8FA 2DPPB 2RF0A 3OYJA 3RDVA 2E5RA 3CCRA 1TUSA 3X24B 3NGPA 1TOVA 2V53A 5LJ3f 2DVJA 5CO7A 3OYCA 3MEKA 1CKBA 1G3YA 1WI7A 1W4SA 1GFCA 2DTHA 1IY5A 1Z7KB 1U3OA 1E7OA 3JCMb 2ZPGB 4ME7A 2GQVA 4UXHA 2RI5A 3PTAA 5FU7C 1MUZA 3EFOB 1EIFA 2P6AC 3PFSA 2L3RA 5FU6C 3HKSA 4M78A 3M0TA 4KGVB 3CCUQ 2PUOB 1YI2A 1D1CA 1CE3A 2F2VA 2LVMA 3VS6A 3U23A 1M2OA 2IG0A 2DB6A 1K73U 2RI3A 1QP2A 1FYNA 4CC4B 1NJIR 2FPDA 5AT1B 1UVGA 1V1HA 3QKJA 1OPLA 1N27A 2ZPEB 2X3TA 1EZZB 1BK2A 1K7TA 2QA4A 1PG5B 2JM8A 1CGJI 1NYFA 2ZPBB 3CCVT 2LCSA 3RU0A 4DBHA 4J6YA 4M75F 3H0IA 1N13A 4O6JA 2HCKA 1HJDA 3GNFB 2PQWA 3OB9A 3HRSA 1ULNA 1Q81C 1I07A 1VQ7Q 1NJIC 4ZGEB 3UPUA 1GRIA 2DD5A 1Q86U 2BIVA 2VGNA 2KSSA 5KH6A 4JZ4A 1UUEA 1YI2T 4KRTA 1YIJA 2QGGA 1VQPT 3SWNC 2A28A 2MIOA 3CCSQ 5CCLA 1LVKA 5GJVB 4M7DB 2HKNA 2GKVA 2DYBA 5EG2A 1RABB 2NWMA 3UOEA 1TIHA 1UUCA 2XICA 2R58A 2LRQA 1BIBA 2H8HA 4M75G 4EMGA 3G4SA 3CC2Q 3REAB 2RQUA 3A8GB 3I35A 2QQBA 4M7DG 2EJ9A 1X6OA 2P0KA 3GLXA 8ATCB 4EMKC 1M30A 3BDUA 2JOYA 1TWBA 2D8HA 4CC2A 1N8RR 2KRNA 3GOXA 2NYSA 2XG8D 3QYHB 3GP8A 1LR8A 1OX8A 3LWHA 5LL6S 1LJOA 3SFMA 3NPFA 1WGSA 4Y92A 3CMAA 4OMOA 1YHQA 4HT9A 2EBPA 4M77F 3NTKA 1K9AA 2EJGA 4PJOE 1T3SA 2KDSA 1B34B 5GAMf 4E1PA 1M8BA 3CPWP 3MO8A 2EYYA 2BKDN 3TO7A 3CC4T 3VDPA 3O8VA 1KC8U 4GBQA 3LGLA 4PLIA 2CZ1B 1H3HA 4LDUA 2RD1A 2M0OA 2HNIA 2X3WD 3SB2A 1K0XA 1SGEI 4PJOG 2EYXA 1V76A 1JBMA 3A8LB 3UA6A 1YJ9T 4C92A 1PC0A 3LW5E 4C0DC 3MPUB 1ZUKA 2QQEA 2JS0A 1RFHA 2SRCA 2DLPA 4II1A 4B6MA 2DIGA 3QTLD 1TBNA 4ELYC 4RG2A 2XU8A 4M75D 3CCMT 2EQKA 1VQOA 1E7DA 1Z9ZA 2CP0A 3CMAQ 5HY6A 4M75C 4A53A 1HYOA 4PJNA 2XD0A 1VQ9T 1NXUA 1M1KC 2L0AA 4C0ZA 3TO9A 2E70A 2MWOA 1YP5A 1M90U 1KHIA 2F3CI 5DLOA 2QQCA 2K3XA 2LQNA 3QSUA 1E6GA 2DVEA 2WACA 4C92B 2P0QA 2PQ8A 4ESRA 5CKEA 4CC3A 4D8KA 5IHKA 5GANj 5GANe 3V7SA 2ZPFB 1PRMC 1H0ZA 2YLCA 2AKLA 2F2WA 3NFCA 1VQ6T 2MMPA 1ABQA 1UEBA 4XAXB 4IUTA 1N8RU 1K1ZA 4J9BA 4M78D 3NMZC 3HPWA 4QKUA 1TU0B 5KYXB 3QO3A 3CC7Q 3CC4Q 5I11A 1QVGA 1NLOC 2PVGB 1UECA 3PMTA 3CQTA 3KBGA 3L2UA 4C92C 2V26A 5LJ3e 3CPFA 4D8DA 1Y7XA 2BTTA 2VYTA 1C0MA 3HSBA 1D3BB 4C92D 2KXCA 1K73C 1IHVA 3CCQT 3RNJA 4JDSA 1X4SA 1VQ9Q 2A3LA 4XU3A 4DBRA 1NBEB 3HFNA 2BUSA 4MMKA 4D6WA 2LNHB 3BJIA 4J9IA 2KR3A 1KD1R 1OOTA 5GANh 2RO0A 1SGDI 3FB9A 2XRCA 2OAUA 1TH7A 2AZVA 1VDDA 5A0DA 3UEYA 4C0FA 4XK8E 2DL3A 2HSPA 5KYYB 4PJLA 2XDPA 1FX7A 1U1TA 3CC4A 2K5IA 5HCKA 3CBOA 3CCUT 1U06A 2JXBA 2PU9B 1GBRA 2DZCA 1M8MA 4IUPA 1K73R 4C0DB 1OMTA 3VS7A 4KUIA 2ED1A 1QKWA 2X9HA 5CKBA 3F70A 4NOYA 1H92A 1D0YA 4MDWA 2ZZDA 2KAFA 2B8TA 1RL2A 1ZBXA 1S1NA 1WNLA 2LCCA 5KYNA 4C8QD 1OQKA 2ECZA 1WTJA 4XU2A 1E6HA 1S72A 3I56T 2M5XA 3G7ZA 3UFFA 2CP7A 1WJRA 2R57A 1M8CA 1Y96B 1OI1A 3EGUA 1UG1A 3UF4A 1QKXA 3QWYA 4J9HA 1JXMA 2N71A 1TSFA 1ZSZB 3A1PA 1VQOT 2WVJA 2DZ9A 3OS5A 4M7AA 3CD6A 2DX1A 4R56A 2FB7A 3P8DA 2OJ2A 1ZUYA 2QASA 4HXJA 4L6V5 2PVDB 3L2QA 1UGSB 1FXXA 2ELIA 2JTMA 4M77A 1VQMQ 2VC8A 5FRMA 5E3RA 2CSIA 2H3JA 3S3OA 2DETA 2A0FB 2LQ8A 2O9VA 3OSSC 2EKHA 4M7DA 3J81E 2FPEA 3R5CA 3JCMd 2RHXA 1NPPA 2FZGB 4LNPA 2E3IA 3EGDB 1VQ4T 2QK0A 4JJDA 1VQOQ 2O4XA 3I55Q 2A08A 1WQ7A 4J7IA 2RJCA 4M78C 1WX6A 3VRYA 1Q7YR 3QWPA 3UEJA 1WHHA 3MEUA 1ZQ1A 5GAOn 3C12A 1MJAA 4F17A 1X6GA 4M75E 4XU1A 3V7CA 1WIEA 2KBTA 2K9GA 3CCVQ 1VQ5A 2CZ0B 1N9RA 1NG2A 4LUEA 1VQ5T 4IIOA 2QEXA 3OW2P 1HEVA 3UGDA 2AIRB 4PJOD 2F1LA 5LJ5e 3WXMB 2EQJA 1N6AA 1W70A 3JB9H 1YWPA 5IXBA 2EGCA 3HTRA 2LX7A 3R5BA 4F04B 1JO8A 4NS5A 3MEVA 3CXCS 1M90C 3S3NA 1XBTA 2NUPB 1RAEB 2HZYA 2GNCA 3GBQA 3M9QA 3S6WA 2KT1A 4L9MA 3OYAA 4WP4A 2COWA 4J7FA 2DL7A 3VUZA 3R5AA 3RMQA 5KYUA 5GAOm 1XA6A 2YDLA 1YJNQ 5KCOA 5GAN5 2L3PA 3AHUA 3ZEHA 4J83A 3JCMh 3OQ5A 1YITQ 1NUBA 4WTOB 3M53A 2ATCB 1N8RC 5EX0A 2LNVA 3SHWA 2ORVA 3DKMA 2DO3A 3CCJT 4J9GA 5GAMe 1ZA1B 4AFQC 3RKWA 3RMSA 1I4K1 2ZAEA 5IT9E 2DERA 2NU2I 3OXLA 2K2VA 1JXOA 2VUBA 3JRZA 4OMNA 1TXQA 2P4TA 5GANd 4RTXA 1YCYA 4M75B 2P0PA 2HL5C 3VS3A 2QQAA 4BDYA 1YBYA 5GMKe 2HQXA 2O2OA 4J5YA 2KCXA 4J9FA 2LZ6B 5LJ3d 1W2BP 2X4XA 1CGII 4GY5A 1K8AC 4JRKA 5HK3A 3SD4A 1SKUB 2LC4A 3E19A 2DFUA 4M7AE 1TOTA 1G5VA 1VOMA 4KGZB 3JCMc 2NU0I 2JYYA 2B8AA 2QYZA 2ROTA 5EX3A 2MWPA 1WGCA 3JCMQ 3WVEB 2MYSA 2HBWA 2CUBA 1PD1A 2LT1A 3TOAA 1MV0B 1VYUA 4R0KA 1AWJA 5HQ8A 4A24A 2EQIA 3G4SQ 2W0TA 1M2VA 2CSQA 3PT9A 3UWNA 3X28B 2C0IA 1A0NB 1SSHA 2OTLT 3AT1B 1KQSS 3INZA 3QJ6A 1OZ2A 4DOWA 1B3QA 1C6VX 3JB9I 2FEIA 3MP1A 4RG8A 2MAMA 1M3BA 3PIOA 4ORZA 4OB1B 4E7SA 3E9GA 4ZN1A 1XTDA 2QG9B 2GVIA 1YITT 3JB9D 4FSXA 2FZKB 3N5BB 1KBEA 3RKXA 1Y1BA 2HSEB 1Y07A 3V8LA 2EAYA 1XQHA 2O31A 3OYMA 1IREB 2YSQA 5GMKi 1KC8R 2V1CC 4M7AB 1AWWA 2QNCA 3MKDA 5GAOl 3EHRA 4B6DA 2CH4A 1MV3A 1BU1A 2W10A 3FIFA 2KRSA 2Z0WA 3LGFA 1VQPQ 1WDXA 1Y1CA 1V29B 3SWNB 1AWXA 1GCQA 2COYA 2J06A 4FSSA 3OYGA 3R6OA 1B34A 3NTIA 1ZSZC 1VQ7A 4RCCA 1SF9A 5FUWA 2NUZA 2VB6A 4EPCA 3SGQI 4FYXB 2DTOA 2IIMA 3L2WA 2YHTA 2J6OA 4BE2A 2NUTA 6AT1B 4UXIA 4K11A 1ZX6A 2M9UA 2G6FX 2COZA 2KVQG 4B9XA 4FT4A 1PKSA 3OYLA 3G4ST 1AWOA 2L7XA 4MZPA 2CZ6B 3UT1A 1VIFA 5GAN4 5FROA 1QCNA 4OF1A 3JSCA 2DBKA 4ZGDB 3M58A 1S72Q 1AVZC 3EAEA 4KH1B 3D7SB 3OYHA 1UGRB 2LP5A 1RAFB 1FARA 4BACA 2SGFI 1LCKA 4LE9A 1UE9A 4B9WA 1WHMA 3UDCA 2GKRI 3E59A 2X4JA 2RHIA 2JW6A 2E4HA 2DAQA 4OVOA 1Q82C 5FUXA 4XQ3A 1G2BA 2DF6A 2A36A 1SSFA 1VQMT 4RMOA 1TUDA 3UGIA 2HD0A 1SG5A 2I2LA 1VQLQ 1N9SA 2JMAA 3EFOA 5D6XA 5GAN8 5M9OA 3G71Q 3RERA 2GGRA 3CCEQ 2DBMA 1BI1A 3HP9A 2A20A 2RI2A 2FRWA 1GBQA 2LCLA 1PD0A 2ENZA 1WHJA 3OYFA 2DIQA 2JW4A 2L3QA 1SRLA 3OMCA 4M4ZA 4DBFA 2ERWA 1UGQB 4M7DE 2JJ9A 4FW1A 3SDZA 1K4US 4PJOF 2KNBB 1VQ7T 5GAOp 2DYIA 1WPYA 1M1FA 1UB4A 3TQ7P 4RTYA 2ZCFB 3UGLA 3OYIA 2AHJB 4NL3A 2N1AB 5FWBA 3MP6A 4OMLA 3TCJA 2X4WA 2BE9B 3UATA 1QVFP 1MJBA 1JU5C 5CKFA 4PFPA 5L23A 2HDAA 4XTVA 3PNWC 1YJWA 2DM1A 2E1HA 4RTZA 2O9SA 1M1GA 4J6XA 4M7AF 1W2BS 1NLPC 4PFOA 1R79A 2DJZA 1NEBA 3RR6A 1KQSA 1I5LA 1ZSGA 2KK4A 5IXFA 3MHXA 4E2FB 4OMPA 5FU7B 3G1JA 1NPRA 3JCMg 4UXJA 1D09B 1YJWQ 2OZUA 4GLKA 1LR7A 2FZCB 2F69A 1KHCA 3RBBB 2ZGWA 4C8QA 1RAAB 2RK1A 2LDMA 1M3CA 2HKQB 4AMCA 3QPHA 3OYNA 1T0JA 2JS2A 1VQNQ 1FMVA 1RAGB 2VV5A 1TUGB 4KULA 2UVOA 2M51A 5L8RE 3VS5A 4XU0A 4BUGA 2DEUA 2LQKA 2RJFA 1PKTA 2YUNA 1MGQA 2J87A 5J26A 2PTKA 3X26B 3PIPA 3JCMW 1MMDA 2KGTA 2DEQA 1RI9A 5CCAA 1M4ZA 4F7UA 1VYTA 2N52A 2FVUA 1EN7A 1X2KA 5CQXA 1KQ1A 2A37A 1UFFA 2LMJA 1X2QA 1WHGA 1VQ4Q 1ULKA 3X20B 4A4FA 5HK0A 4M77B 5GAMj 1RACB 2NLUA 3DLMA 4E7KA 3G71T 2EYWA 1DS3I 3CC7T 2CWHA 2CUDA 1AHJB 3C95A 1YFNA 3ULRB 4DA4A 1KD1U 3LYIA 3JCMV 4LDXA 1FMKA 2BZYA 5IAYA 3HRTA 4OVAA 1PM3A 5CR2A 3OW2A 2HL3A 1IO6A 1ZLMA 3VS4A 2FPFA 2SGEI 3M4GA 4DEYA 2AZSA 1VYVA 2V8KA 2DRMA 3A98A 2YUUA 4M77E 2SGPI 2KMOA 3EG9A 4LD6A 4RTUA 2RK2A 1WXUA 1PCXA 3TJQA 5A0GA 3I56Q 1DJ7B 4GLMA 2QQDA 1YWOA 3OYKA 2M0YA 1UJ0A 5CKDA 1K7VA 4OP0A 4A4HA 2DMOA 2E6NA 1J3TA 1UJYA 1H3ZA 1KSWA 2QQ9A 1FYBA 2FYKA 1O9SA 3EHQA 2V1QA 3HH2C 1I5OB 2EIFA 3KUFA 2A7YA 3CCMQ 4BE1A 1K7UA 2EPDA 3O5ZA 1EX4A 4C92F 2C06A 2ZPHB 3EH2A 2CP2A 3EGDA 5LJ3j 4OMFB 1Q81R 3MCAB 1D1BA 5I22A 1JB0E 3VV0A 4ATOA 3QHSA 4R55A 2OTJQ 1G3WA 1VQKQ 2HMAA 2N17A 2K3YA 1K0SA 1X27A 3ZFJA 4HCZA 1WXTA 3OBWA 2GQIA 2O88A 4BB7A 1GXIE 4OGCA 1K9MU 2QQ0A 2EQMA 5IN1A 4CC7A 2RPNA 3CCQA 1IHWA 2L8EA 3ZBDA 1M90R 2DXTA 3CCJQ 1BB9A 2K5FA 4ANJA 2RN8A 1OU9A 1YITA 2V8JA 4V2SA 2CDTA 2HQEA 4C8QF 2J05A 2RB6A 4SGBI 1KC8C 3REBB 2CH4W 2QI2A 2CP3A 3J7AF 1RLQC 1QCFA 4DQ2A 4F7UE 1YJNT 4PK4A 2LUYA 1TGSI 5GMKh 3QDFA 4OGEA 3G6EA 4VUBA 2RHZA 4M77D 4QT7A 3KY9A 2PVOB 5GJWB 2K7AA 4JUVA 4RKUE 2JZ2A 1OZ3A 2J6KA 1K76A 4M78E 2GKTI 1RAIB 1YJ9A 1YHQQ 4RTWA 2VXEA 1XOVA 4PJMA 4C5GA 3VJPA 3B4VC 3CXCA 5AYFA 2K6DA 4MDXA 3UA7A 4BD3A 5GAOr 1D0XA 2V1RA 1BI3A 2X52A 2OAWA 4BY6B 1SRMA 2KEAA 3NHNA 4XTXA 2F2XA 2LEOA 2L89A 2QTXA 3A8OB 3CMEA 5GAN6 4FIBA 5FLXE 2KDPA 3SEMA 2KI7A 4JJCA 3HFOA 4ZTJA 5I2MA 5JHWC 5C0MA 2VRWB 4F7UB 4Z88A 2N1UA 5EC7A 4JRPA 4ZNXA 4LDWA 3OA6A 4FYYB 2EKOA 2JNGA 4PFZA 4BI4A 3OSVA 1YJNA 5FWCA 2B0UC 1XX6A 2XKOC 4FW2A 2KMTA 3LH5A 3CC2A 3OS1A 2DK3A 2RQWA 1G3SA 2D0NA 1YJ9Q 5GANf 3C94A 1OU8A 3P8BB 5DM7R 1QCOA 2YT6A 5J8FA 4KT0E 3RKYA 3MEWA 3H6ZA 2FG0A 1HPTA 2AKKA 3KXTA 1BMOA 1I81A 3CCST 4JPBW 4C8QG 4OMQA 2EFIA 3M0SA 1GFDA 5GMKj 2P4RA 4JRIA 3CCLA 3SEKC 4P5NA 3JCMP 1BCOA 4BE0A 5J8CA 3OVOA 2GBQA 2GFAA 2CREA 4PL6A 3CXCP 2ROWA 3HHTB 1AZEA 2GTJA 2ARPF 3E2IA 2JTEA 4DEXA 4WF2A 5KYWB 2K5LA 1Y0MA 5DY9A 4BI3A 2YUOA 1NYGA 2LJ1A 5GAMh 2RH2A 4LN2A 4XTYA 5J39A 1JJ2P 2M16A 1UGPB 2I0NA 1T3LA 2ABLA 2KT8A 4JLIA 3M57A 2KYMA 3BE3A 1R8OB 2IVWA 2E12A 2ED0A 1PWTA 1AZGB 2DD4A 3CC2T 2VGMA 1V1IA 2E65A 3EG2A 5IHIA 4RTTA 3TEEA 2JZMA 2X4YA 5LJ5f 4ZN3A 2KMQA 5DAEA 4WCIA 2DL5A 2EW3A 3FDRA 3CCLQ 2B86A 2YQPA 3QIIA 1G3TA 2NUTB 2FHDA 1Z2IA 2LQWA 5KYWA 1SEMA 3OYYA 1OEBA 2M1HA 2ORWA 1W2BA 2L5QA 2CJSC 1PSEA 2QQRA 1BKBA 4QQDA 2QGFB 3DB3A 2FNFX 3EG9B 7AT1B 7WGAA 4PJOB 4IUQA 4JS5A 1QVPA 1Q81U 4LD9K 2RIJA 1NJIU 2PZ1A 4IUUA 4FM4B 3CC7A 1K9MC 1Q86C 4E7HA 2XHCA 4XTUA 3OY9A 1G83A 2EYZA 4C5IA 3G6EQ 1WKXA 1PTRA 1HXDA 2GTOA 2L8DA 2DKVA 3EGXA 5I21A 1M1KR 2KXDA 2SEMA 5LJ3h 1VQ6Q 4LDYA 1VQNA 2R5AA 3CBPA 2P84A 3I5RA 5GAOq 4GI3C 4M77G 8AT1B 1UHAA 1QQJA 2X35A 1M8VA 1CT4I 1FWZA 1R0RI 3FSXA 5CKHA 1RADB 2JMCA 2ESWA 2OU2A 2E41A 1OYVI 1VQMA 3QXEB 2JN0A 2GCXA 1Y96A 4N4IA 2L2PA 4QW2A 5GMKm 1VQ9A 2RC4A 3V7RA 1FY7A 3M55A 3T9NA 4E6RA 1WQWA 2BE7D 3MP8A 1OPKA 2CS7A 2RQTA 1Q82R 1QVFA 4PNOA 2DNUA 3C4SA 1D3BA 1XJWB 2QAZA 3M0RA 2FRYA 3V8KA 3QJYA 1YIJQ 4JRQA 3OW2S 3CPWS 2RA2A 1Q86R 3CCLT 1Q7YU 2EQUA 1T0HA 4J6WA 4C92E 1PCEA 2RNAA 2EYQA 1TBOA 1YCSB 1ZHIA 2QPOA 4C8QB 3QWXX 1V1CA 2E10A 3VS0A 1GL5A 3OYDA 4UC4A 1AOJA 3ER0A 1NE8A 1HD3A 5E3PA 2W0ZA 4L59A 3FLGA 3ZL7C 3RUXA 1WLPB 1M9SA 3PGGA 3H9NA 2XK0A 2E73A 3V8JA 3LH0A 2J7IA 3H0HA 2OTLQ 3OYEA 2WGCA 5LJ5d 2EWNA 2CKKA 2NU3I 2ZPIB 1XNIA 3L42A 3CCUA 1ZSZA 3CCQQ 2RHYA 1WJSA 2E5QA 2HEQA 3SWNA 1VQ8Q 1R77A 3FSYA 2K57A 4FT2A 1M2VB 2DTIA 4X1VA 2D9TA 3L2RA 3CMAT 2MOXA 2R5MA 2DJQA 3TO6A 1X43A 1H8KA 1M1KU 1U5KA 4O5VA 1Y57A 3IQLA 1HSQA 3CD6Q 2CP6A 5A0LA 2PNIA 3L2VA 4BY6C 3PE0A 3JV3A 1JJ2S 1YHQT 2OTLA 1K8AU 2D8JA 4E7ZA 2MK5A 4PJOC 5D6WA 2LTOA 2LJ3A 3OL0A 2PUKB 2E64A 1K9MR 4M7AD 1TBQR 1PZWA 1UTIA 1H641 1WYXA 3H41A 1OMUA 1R0CB 4F16A 3CCMA 4E47A 3CEYA 1WGTA 2X51A 2DXBA 1KFZA 5FRNA 3QZ9B 1JEGA 4KH0B 4EIKA 2K9HA 1EFNA 4E1RA 4PJOA 3VKIA 5E3QA 1P92A 1IRXA 1MNEA 2QEXT 2ENMA 1PHTA 4OMMA 4HA8A 5CIUA 3RIRA 5LJ5h 4DOVA 1CSKA 3QUIA 1BYMA 2C0TA 3M56A 4ELZC 2D6FA 3M54A 3GPLA 1NM7A 3EG1A 1N5ZA 2OTJT 1FAQA 3C0CA 3R6NA 4L5GA 1OVOA 3MEAA 3I55A 4X9DA 3BDLA 2YWWA 1TS9A 1QWEA 4KUDK 3ME9A 4ZTFA 4N4HA 4JCVE 3E9FA 3E1SA 4RCBA 1X01A 4XTZA 2OX7A 1M5Q1 1X6BA 3CPWA 1RUWA 1U5SA 2HAXA 1SGYI 4J9CA 2WSCE 4FCYA 4A4KA 4F14A 1KJWA 2OI3A 4MMLA 3JB9F 4X34A 4JLGA 2ENNA 2VKNA 5D6YA 2JM9A 1I1JA 4M7AG 1MMNA 3VE5A 3JCMX 1HK9A 2DXUA 1X75C 5KE3A 5KCHA 2QNFA 4A63B 1TURA 2EVRA 3S3MA 3OMGA 1MJ9A 5CAIA 1HDLA 4DBQA 3PVLA 1TUCA 4LXCA 1YIJT 3BFMA 2QA4Q 1SHFA 3I55T 3FEOA 3FRNA 2ODDA 5A2QE 1TBRR 4Y91A 4HVUA 1ABOA 2IPOB 1IGUA 3L1AA 4C92G 1WHKA 2GIVA 2O4XB 2ROLA 5LJ3g 1VQKT 3EG3A 2VASA 4FU6A 1IXDA 1VQNT 1PRLC 2DL4A 2YRVA 3I9QA 2OTJA 5GANg 5KYXA 3JB9J 1Y8FA 4E7JA 2OD1A 3H0FA 1WZOA 3OS2A 3TOBA 2CYZB 3LLRA 1IGQA 2MPXC 2O01E 4AFZC 3FJPA 2DXCA 4PJJA 4MZMA 3VU3C 2EJFA 4LUDA 1Q7YC 5ECAA 2QTVA 3SGBI 1MNDA 1F1BB 4HVVA 3VS1A 1QW1A 3NTHA 2DIPA 1SGNI 3CMEQ 1JRIA 3RESA 4HVWA 4RTVA 4M7AC 4J9EA 3CCRT 4HCKA 2K2MA 1WA7A 2DILA 4F7UF 3META 1BI0A 2KQWA 5D7UA 1QWFA 4M7DF 3M5AA 4YTLA 1W1FA 5DLQE 4M7DC 4JZ3A 3EFRA 3TSWA 1GCPA 4KGXB 2DRKA 4A54A 3OXFA 4C5HA 5FUYA 1W6XA 1G8XA 4BI8B 4C5EA 2YUPA 2KROA 3CBMA 4IKFA 3LX7A 2EGEA 3GIBA 3URGA 4C0GA 2LT4A 3CCET 5FUVA 1CKAA 2DA9A 2L3SA 4MZTA 4HCCA 1SGQI 1IB8A 2V8IA 2JVVA 2RHUA 2JXDA 2Y4XA 2EGAA 3VUBA 3A5ZB 2CZ7B 2RQVA 4OB3B 1UHFA 1Q95G 2Y90A 4E7LA 1B07A 4LDVA 2E6ZA 2VVKA 2YLBA 1JQQA 2F5KA 4M78G 1O75A 1NEGA 3QZ5B 3VYHB 2KMRA 2QA4T 2LB7A 4HGUA 2Y0MA 1Z9QA 2JT4A 1RLPC 1KQ2A 1MMAA 3M0QA 1X69A 4C8QE 5IH2A 3CCJA 3M0PA 3TVTA 1MHNA 1MT1A 2JTFA 3EH1A 5GAN7 3X25B 3JB9G 4EDUA 1I0CA 4Q5WA 2XIDA 4NL2A 3VRZA 4N0AC 3CCEA 4MPIA 2JUFA 4CRIA 2QEXQ 1Y71A 2SGQI 2NU1I 1DS2I 1SPKA 4X9CA 2XMFA 1VQLA 4HT8A 4QQ6A 4QQGA 3TREA 4J8OA 1KD1C 3BY7A 1QVGS 3WVDB 1BBZA 1UDLA 4AT1B 1VQLT 2DKGA 4M78F 3HRUA 4JJNK 1SGPI 5GAMd 3DB4A 1D0ZA 4EMKA 3G71A 1VA7A 1QLYA 3A8MB 4RUGA 5I2SA 1OX9A 4AG1C 2XI9A 1FMWA 1B7TA 2MF2A 1UVFA 1QVFS 1AEYA 4Y28E 1WJQA 2CWGA 3JCMJ 1YN8A 1S72T 1AT1B 1SHGA 5GAN3 4XTWA 2VWFA 5LJ5g 3M0UA 1YNZA 3THKA 1RI0A 3GNGA 2E5KA 2K3BA 2CWFA 1UGVA 4FL6A 4HKEA 2QQSA 2LJ0A 4Z02A 2VXFA 3R5DA 1WXBA 3JCMf 1RAHB 3VDUA 1TG0A 4PLLA 2HBPA 1BI2A 3OXGA 2XDBA 1AD5A 1KQSP 3TU4K 5LJ5j 2BZXA 2FL7A 3PVQA 1LNXA 1VQ8T 1VQPA 1KG1A 4JJBA 3VYGA 2E3HA 4ZGJB 3E2UA 2CT4A 3CCSA 1M27C 5HI7A 2FO0A 4N0AA 2H3EB 3TSZA 1KMAA 2BZ8A 4EMKB 4M77C 2WCYA 2QDYB 1NZ9A 2MI6A 3DLLA 1ARKA 4DNCA 1E7LA 1VQ4A 2GFUA 2MCNA 4FYWB 2KRMA 5CVIA 3P8HA 5GAMg 1U8RA 5KYUB 4KBMB 2RQRA 2K79A 3VS2A 2RM4A 3I56A 1GCQC 1CT2I 1OV3A 4N4GA 2QDLA 1UHCA 4QVZA 1KK7A 4C8QC 5CCMA 1WFWA 2CP5A 5KYYA 4M78B 3CXLA 1LPLA 1CSOI 2GF7A 1X74A 1QP3A 2AK5A 1QMCA 1LOJA 1VIEA 4TVRA 1K8AR 3CD6T 1CHOI 1BIAA 1VQ8A 1KBFA 2DE0X 4A4EA 4M75A 2WSEE 1ACMB 1JJ2A 3I5SA 3A8HB 2RJEA 2AT1B 2X3XD 4J9DA 1ZA2B 3D00A 3EFSA 5IHNA
chains in the Genus database with same CATH topology
2FVUA 2QXFA 1EN7A 1NE8A 5FU6B 1FX7A 1U1TA 4L59A 5CQXA 3CC4A 2K5IA 1KQ1A 3FLGA 3QYGB 3RUXA 3CBOA 1CT0I 3CCUT 4PKCC 2LX9A 1M9SA 2WSFE 2PU9B 3PGGA 5CQYA 2DZCA 3X20B 2XK0A 1LR9A 2E73A 4A4FA 5HK0A 4A4GA 4M7DD 4M77B 5GAMj 3V8JA 3LH0A 4IUPA 2NLUA 3DLMA 1YTPA 4C0DB 1OMTA 3LWIA 4E7KA 3OYEA 3QG1A 4KUIA 1VQKA 5LJ5d 5GAN2 2EWNA 2CGHA 2CKKA 3G71T 2KMPA 1DS3I 5CKBA 4QVDA 2ZPIB 3CC7T 1XNIA 2NU3I 3F70A 4NOYA 3L42A 3CCUA 3L2ZA 1AHJB 4MDWA 4CI0C 2ZZDA 2KAFA 3C95A 3OYBA 4DA4A 1KD1U 2RHYA 3LYIA 2B8TA 1WJSA 3JCMV 2E5QA 4LDXA 1RL2A 2UZ3A 1ZBXA 1WNLA 2LCCA 5IAYA 3HRTA 3OS0A 4OVAA 4C8QD 3SWNA 2SGDI 5CR2A 4BDZA 3OW2A 3BW1A 2K57A 4XU2A 1YU6C 3OBYA 1S72A 4FT2A 3PMIA 2DTIA 2SGEI 3I56T 2M5XA 2D9TA 3G7ZA 3M4GA 3L2RA 3CMAT 3UFFA 1IW4A 1Q82U 2R5MA 2V8KA 1PPFI 1IY6A 1M1KU 1WJRA 2RJDA 2R57A 1M8CA 1U5KA 4O5VA 1Y96B 3PDNA 1OI1A 2YUUA 4M77E 2SGPI 5A0LA 2KMOA 4LD6A 3M4YA 3L2VA 4BY6C 2RK2A 1PSFA 3G6ET 1JJ2S 2N71A 1YHQT 2OTLA 1K8AU 2Y4YA 1VQOT 2WVJA 2DZ9A 3OS5A 4M7AA 4PJOC 4EMHA 3CD6A 3TJQA 5D6WA 4R56A 2FB7A 2LTOA 1DJ7B 2D0QB 3P8DA 5A0GA 3OL0A 2PUKB 5CK9A 2QQDA 2E64A 4L6V5 1IZ6A 4M7AD 1TBQR 3JCMe 3OYKA 1H641 2XDDA 2PVDB 3Q1JA 5CKDA 1OMUA 3L2QA 1UGSB 4OP0A 1FXXA 4A4HA 2ELIA 3CCMA 2JTMA 4M77A 5FRMA 2VC8A 1SGRI 4E47A 2E6NA 1H3ZA 5KE2A 3CEYA 2NU4I 2H3JA 2QQ9A 3S3OA 1FYBA 2LQ8A 3OSSC 2J9RA 2FYKA 4M7DA 2DXBA 3J81E 1O9SA 3JCMd 2RHXA 5FRNA 1NPPA 3QZ9B 3CMET 2F5TX 3ASKA 1AN1I 1VUBA 3HH2C 5C6SA 1U1SA 2K4YA 1VQ4T 2K9HA 4QVCA 2EIFA 3KUFA 2A7YA 3GF5A 4OB2B 4BE1A 4HCBA 4PJOA 2QQCA 3VKIA 4E1RA 2O4XA 5GMKl 1P92A 3H8ZA 1VQ6A 2OVOA 1WQ7A 1YJWT 4IURA 3M59A 2G3RA 4C92F 4J7IA 5J3BA 2C06A 2RJCA 1W4RA 4M78C 2ZPHB 2QEXT 4F7UG 4FKDA 1W3SA 1PTQA 4HA8A 5CIUA 3RIRA 5LJ5h 3QWPA 4JS4A 3UEJA 3MEUA 4DOVA 1ZQ1A 5LJ3j 5GAOn 1OYXA 3C12A 3HL8A 3QUIA 1BYMA 4OB0B 4M75E 4OMFB 4XU1A 3QBYA 3V7CA 3MCAB 3M56A 1VQ5A 2CZ0B 4ELZC 1PJUA 2D6FA 1JB0E 3M54A 3VV0A 4E7IA 1N9RA 3QHSA 4R55A 3GPLA 4ATOA 1VQ5T 3SEKC 2QEXA 1G3WA 5HKCA 3FC3A 3CCVA 2KY9A 2OTJT 3UGDA 2N17A 2V1CA 2K3YA 4PJOD 1FAQA 5LJ5e 3WXMB 3QDRB 4IUVA 4L5GA 3ZFJA 4HCZA 1OVOA 3MEAA 3I55A 3OBWA 2EQJA 1N6AA 4X9DA 3BDLA 3JB9H 3JAME 4BB7A 1GXIE 4KUDK 4OGCA 3ME9A 1K9MU 4ZTFA 4N4HA 4JCVE 3E9FA 2EQMA 3E1SA 4RCBA 4NS5A 5IN1A 3J80E 2JA1A 2QQ0A 2BUDA 1X01A 3MEVA 3CXCS 1I8FA 2DPPB 3CCQA 1M90C 3OYJA 3S3NA 4XTZA 1XBTA 2E5RA 2L8EA 3ZBDA 1M5Q1 3CCRA 2DXTA 1TUSA 3X24B 3M9QA 3S6WA 3CPWA 2K5FA 2HAXA 2V53A 5LJ3f 1YITA 4L9MA 2V8JA 4V2SA 3OYAA 5CO7A 1SGYI 2WSCE 3OYCA 3MEKA 4J7FA 2HQEA 3VUZA 4A4KA 1G3YA 4C8QF 3RMQA 2RB6A 4SGBI 4MMLA 3JB9F 4X34A 1KC8C 1W4SA 2DTHA 4JLGA 2ENNA 1IY5A 5GAOm 5D6YA 1XA6A 1Z7KB 2QI2A 3JCMb 3J7AF 2ZPGB 5KCOA 3VE5A 4ME7A 5GAN5 2GQVA 4DQ2A 4F7UE 1YJNT 4M7AG 4UXHA 2RI5A 3PTAA 3ZEHA 4J83A 3AHUA 5FU7C 2LUYA 3JCMh 3OQ5A 1EIFA 2P6AC 3PFSA 3JCMX 1HK9A 5GMKh 1TGSI 2DXUA 2L3RA 5FU6C 4OGEA 1X75C 3G6EA 3HKSA 4M78A 5KCHA 5KE3A 1NUBA 2QNFA 3M53A 4VUBA 2RHZA 4M77D 1TURA 1N8RC 3S3MA 2LNVA 2PUOB 5EX0A 3OMGA 5CAIA 2ORVA 3KY9A 1HDLA 1YI2A 2PVOB 3DKMA 2DO3A 3CCJT 1YIJT 1CE3A 2LVMA 3BFMA 5GAMe 2IG0A 2DB6A 3RKWA 4JUVA 1I4K1 4RKUE 2RI3A 1QP2A 3RMSA 5IT9E 1K73U 2KMRA 2JZ2A 3I55T 1OZ3A 3FEOA 3FRNA 4M78E 2GKTI 2NU2I 5A2QE 2ODDA 1TBRR 2K2VA 4Y91A 3OXLA 1YJ9A 1UVGA 2VUBA 3L1AA 1V1HA 3QKJA 4C92G 3JRZA 2P4TA 1N27A 5GANd 3RU0A 2O4XB 1YCYA 2VXEA 4M75B 2ZPEB 5LJ3g 2P0PA 1VQKT 1XOVA 4FU6A 4C5GA 3VJPA 3B4VC 2QA4A 1VQNT 1HJAI 2QQAA 2YRVA 4BDYA 2ZPBB 1CGJI 1BUSA 1YBYA 5GMKe 3CXCA 3CCVT 2OTJA 5GANg 2HQXA 4J5YA 4J6YA 4M75F 5AYFA 3JB9J 2KCXA 5LJ3d 4MDXA 2X4XA 1CGII 1N13A 4O6JA 4BD3A 4E7JA 1Y8FA 2OD1A 3GNFB 5GAOr 2PQWA 3OB9A 3HRSA 4GY5A 3OS2A 1K8AC 1Q81C 1BI3A 2CYZB 4JRKA 5HK3A 3LLRA 4BY6B 1NJIC 3SD4A 4ZGEB 2LC4A 2O01E 3UPUA 3FJPA 3E19A 2DXCA 4XTXA 4MZMA 2DD5A 4M7AE 2LEOA 2L89A 3VU3C 2EJFA 1G5VA 1TOTA 2QTXA 3A8OB 1Q7YC 3JCMc 2BIVA 1Q86U 2NU0I 2VGNA 3CMEA 2JYYA 2KSSA 5GAN6 2B8AA 4FIBA 5FLXE 5KH6A 5EX3A 3SGBI 2MWPA 1YI2T 3JCMQ 3HFOA 3WVEB 5I2MA 4ZTJA 1QW1A 1YIJA 5JHWC 5C0MA 1VQPT 2VRWB 3NTHA 4F7UB 2DIPA 3SWNC 1SGNI 4JRPA 1JRIA 4LDWA 3RESA 2LT1A 3OA6A 4M7AC 2EKOA 2JNGA 5CCLA 4BI4A 3CCRT 3OSVA 1YJNA 4M7DB 2B0UC 5HQ8A 4A24A 1XX6A 2XKOC 3CC2A 2KMTA 2GKVA 2W0TA 5EG2A 4F7UF 3OS1A 2DK3A 3META 1TIHA 1UUCA 2XICA 1BI0A 3PT9A 2KQWA 3UWNA 1G3SA 2R58A 3X28B 2LRQA 1BIBA 5GANf 3C94A 4M75G 4EMGA 3G4SA 3A8GB 3P8BB 5DM7R 2OTLT 3M5AA 4M7DF 4YTLA 2F3CI 2QQBA 4M7DG 1KQSS 2EJ9A 3INZA 3QJ6A 1OZ2A 4DOWA 5DLQE 3JB9I 1X6OA 4M7DC 4KT0E 3RKYA 3EFRA 2P0KA 3MEWA 3MP1A 4RG8A 3GLXA 3H6ZA 2MAMA 4A54A 3OXFA 4C5HA 1HPTA 4EMKC 5FUYA 3BDUA 2JOYA 3KXTA 1BMOA 3PIOA 1I81A 3CCST 4OB1B 4ZN1A 3E9GA 4C8QG 4BI8B 1E7LA 4C5EA 1XTDA 2GVIA 1YITT 3JB9D 2EFIA 4FSXA 3CBMA 4IKFA 3N5BB 5GMKj 3LX7A 3GOXA 3GIBA 4JRIA 3URGA 3RKXA 3CCLA 2XG8D 1KBEA 1Y07A 3QYHB 3V8LA 2EAYA 3GP8A 4C0GA 4P5NA 3LWHA 2LT4A 1LR8A 5LL6S 3JCMP 1LJOA 4BE0A 3SFMA 3CCET 3OVOA 5FUVA 2GFAA 1WGSA 3CMAA 1XQHA 1YHQA 3OYMA 4HT9A 1IREB 4MZTA 4PL6A 4HCCA 1SGQI 4M77F 2ROWA 3NTKA 5GMKi 2V1CC 3HHTB 2V8IA 2EJGA 4M7AB 2JVVA 2RHUA 4PJOE 2JXDA 2QNCA 2KDSA 5GAOl 2Y4XA 1B34B 5GAMf 2ARPF 3VUBA 3E2IA 3A5ZB 4B6DA 4E1PA 1M8BA 2CZ7B 3MO8A 4OB3B 4WF2A 2K5LA 4E7LA 2Y90A 4M7AF 3FIFA 5DY9A 4BI3A 3LGFA 1Y1CA 2BKDN 1V29B 5GAMh 3CC4T 3SWNB 4LDVA 2E6ZA 2YLBA 2RH2A 2F5KA 4M78G 1O75A 3VDPA 3OYGA 3QZ5B 3R6OA 3O8VA 4XTYA 3VYHB 1B34A 3NTIA 5J39A 2QA4T 3LGLA 1KC8U 1VQ7A 4HGUA 2M16A 4PLIA 2CZ1B 1UGPB 2RD1A 4LDUA 4RCCA 4C8QE 4EPCA 2M0OA 3CCJA 1KQ2A 5FUWA 3SGQI 2DTOA 4JLIA 1MHNA 2HNIA 3M57A 1MT1A 3L2WA 2JTFA 2YHTA 1R8OB 2IVWA 2E12A 3SB2A 5GAN7 4PJOG 1SGEI 4BE2A 3X25B 3JB9G 4UXIA 4EDUA 1JBMA 2DD4A 3CC2T 2M9UA 2VGMA 3A8LB 1V1IA 2KVQG 2E65A 4B9XA 1YJ9T 4Q5WA 4C92A 4FT4A 3TEEA 3OYLA 2JZMA 2X4YA 3LW5E 4C0DC 5LJ5f 2QQEA 2XIDA 4NL2A 3G4ST 4ZN3A 2KMQA 2L7XA 4N0AC 4MZPA 1RFHA 3CCEA 5DAEA 2CZ6B 3UT1A 2JUFA 1VIFA 4CRIA 5GAN4 5FROA 1Y71A 4OF1A 3JSCA 2SGQI 4II1A 4ZGDB 2NU1I 3M58A 3QTLD 2DIGA 3FDRA 1DS2I 1TBNA 4X9CA 4ELYC 3EAEA 4RG2A 1VQLA 4HT8A 3OYHA 4QQ6A 2XU8A 4QQGA 1UGRB 3QIIA 4J8OA 4M75D 2EQKA 1G3TA 3BY7A 3CCMT 1VQOA 1QVGS 3WVDB 1KD1C 1VQLT 1E7DA 1FARA 4BACA 2DKGA 2FHDA 4M78F 3HRUA 2SGFI 4JJNK 1SGPI 4B9WA 5HY6A 4M75C 4A53A 3DB4A 3UDCA 5GAMd 2GKRI 3E59A 2X4JA 3OYYA 2RHIA 2JW6A 2M1HA 2XD0A 1VQ9T 2ORWA 4EMKA 3G71A 1W2BA 2L5QA 2CJSC 2DAQA 1PSEA 2QQRA 3TREA 4OVOA 1BKBA 1Q82C 3A8MB 4QQDA 5I2SA 4XQ3A 5FUXA 1M1KC 3DB3A 4C0ZA 2FNFX 1SSFA 2E70A 2MWOA 4RMOA 1VQMT 3UGIA 2HD0A 2I2LA 1M90U 1N9SA 1KHIA 2XI9A 5D6XA 4IUQA 5M9OA 1QVPA 5GAN8 4JS5A 5DLOA 2MF2A 1Q81U 4LD9K 3RERA 1UVFA 1BI1A 1NJIU 2K3XA 3HP9A 4IUUA 2A20A 2RI2A 4FM4B 1QVFS 4Y28E 2LCLA 1WJQA 3JCMJ 1S72T 3QSUA 5GAN3 3CC7A 4XTWA 5LJ5g 2N52A 2ENZA 1RI0A 2DVEA 1K9MC 2WACA 3GNGA 1Q86C 4E7HA 2XHCA 4XTUA 4C92B 3OY9A 2DIQA 2P0QA 4C5IA 3OYFA 4FL6A 3OMCA 4HKEA 1PTRA 5CKEA 2QQSA 4Z02A 2ERWA 2VXFA 1HXDA 5GANj 1UGQB 5GANe 3V7SA 2ZPFB 4M7DE 1H0ZA 3JCMf 2L8DA 2YLCA 3SDZA 3VDUA 5I21A 4PLLA 4PJOF 1VQ7T 2HBPA 5GAOp 1BI2A 1WPYA 3OXGA 1M1FA 3NFCA 5LJ3h 2XDBA 1UB4A 1VQ6T 2MMPA 3TU4K 5LJ5j 4LDYA 2FL7A 1UEBA 1VQNA 2R5AA 2ZCFB 1LNXA 4IUTA 4XAXB 2YQPA 3OYIA 1N8RU 2AHJB 3CBPA 3UGLA 1VQ8T 4NL3A 1VQPA 1Y1BA 2N1AB 3MP6A 4M78D 1KG1A 5GAOq 3TCJA 3VYGA 3HPWA 2X4WA 4M77G 4ZGJB 4GI3C 5HI7A 3CCSA 3D00A 4N0AA 2X35A 5CKFA 3QO3A 1M8VA 1CT4I 1FWZA 4XTVA 1R0RI 1KMAA 3PNWC 1YJWA 1QVGA 2PVGB 4EMKB 3PMTA 5CKHA 4M77C 3KBGA 2WCYA 2QDYB 4C92C 5LJ3e 3L2UA 3CPFA 2E41A 1OYVI 2E1HA 1VQMA 1NZ9A 1Y7XA 2VYTA 2MI6A 3DLLA 3QXEB 1M1GA 2JN0A 1D3BB 4J6XA 3HSBA 2GCXA 1Y96A 4N4IA 4C92D 4QW2A 5GMKm 1VQ4A 1W2BS 1VQ9A 3V7RA 1K73C 2GFUA 3M55A 1R79A 2DJZA 5CVIA 3P8HA 3CCQT 1KQSA 3T9NA 5GAMg 4JDSA 1I5LA 1X4SA 1U8RA 1WQWA 2KK4A 3MHXA 4KBMB 3MP8A 2A3LA 5FU7B 2RM4A 4XU3A 3I56A 1NPRA 3JCMg 1CT2I 2CS7A 4UXJA 1QVFA 4PNOA 4N4GA 4GLKA 3C4SA 1D3BA 3HFNA 1LR7A 2F69A 1KHCA 4QVZA 2BUSA 4MMKA 4C8QC 3V8KA 3QJYA 2ZGWA 4C8QA 5CCMA 4M78B 4D6WA 4JRQA 3OW2S 3CXLA 2RK1A 3CPWS 1CSOI 2LDMA 2GF7A 2RA2A 1X74A 1QP3A 3CCLT 3QPHA 3BJIA 3OYNA 1Q7YU 1LOJA 2EQUA 1VIEA 4TVRA 3CD6T 2VV5A 1CHOI 1BIAA 5GANh 2RO0A 4J6WA 4KULA 4C92E 1VQ8A 1SGDI 4PJOB 3FB9A 1PCEA 5L8RE 1KBFA 2XRCA 2OAUA 4XU0A 2EYQA 4BUGA 2LQKA 1TH7A 4A4EA 1ZHIA 4M75A 2RJFA 4C8QB 1TBOA 1VDDA 2WSEE 5A0DA 2QPOA 3UEYA 1JJ2A 4C0FA 1MGQA 4XK8E 2J87A 5J26A 3PIPA 3X26B 3JCMW 2E10A 3A8HB 2DEQA 2RJEA 5CCAA 1M4ZA 3OYDA 4UC4A 4F7UA 2XDPA 3EFSA 3ER0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHI A;  1EN7 A;  2M1H A;  2EKO A;  4L59 A;  3FC3 A;  3FLG A;  2DAQ A;  2QQR A;  2K3Y A;  4QQD A;  3OS1 A;  4IUV A;  4HCZ A;  3DB3 A;  3MEA A;  1SSF A;  2MWO A;  3MET A;  2EQJ A;  3BDL A;  3UWN A;  2R58 A;  2LRQ A;  5D6X A;  4IUQ A;  5M9O A;  2XK0 A;  3ME9 A;  4ZTF A;  4A4F A;  4N4H A;  4A4G A;  2K3X A;  3E9F A;  2EQM A;  4IUU A;  2RI2 A;  4NS5 A;  5IN1 A;  3LH0 A;  1WJQ A;  4IUP A;  2NLU A;  2BUD A;  3DLM A;  3MEV A;  3QJ6 A;  1OZ2 A;  3OYJ A;  3S3N A;  4E7K A;  3OYE A;  1RI0 A;  2WAC A;  2P0K A;  3MEW A;  2CKK A;  3MP1 A;  4E7H A;  3H6Z A;  3OY9 A;  3OYF A;  2DIQ A;  3M9Q A;  1XNI A;  3S6W A;  4C5I A;  3F70 A;  4C5H A;  4FL6 A;  3L42 A;  3OMC A;  3OYB A;  3OYA A;  2QQS A;  2RHY A;  3E9G A;  1WJS A;  3LYI A;  2E5Q A;  4Z02 A;  3OYC A;  5IAY A;  2HQE A;  2LCC A;  4C5E A;  2L8D A;  3OS0 A;  4OVA A;  2EFI A;  4X34 A;  4BDZ A;  4PLL A;  4IKF A;  5D6Y A;  3LX7 A;  3GOX A;  5KCO A;  3PMI A;  2D9T A;  3L2R A;  2RI5 A;  2R5A A;  3ZEH A;  2R5M A;  4IUT A;  4BE0 A;  3OYI A;  3OQ5 A;  2GFA A;  1WJR A;  3PFS A;  2RJD A;  2R57 A;  1WGS A;  2L3R A;  3MP6 A;  1OI1 A;  2X4W A;  5KCH A;  5KE3 A;  3OYM A;  2QNF A;  4PL6 A;  4LD6 A;  2RHZ A;  3NTK A;  3L2V A;  3S3M A;  2X35 A;  2RHU A;  3OMG A;  2QNC A;  3PNW C;  2LVM A;  3PMT A;  2IG0 A;  5D6W A;  3MO8 A;  3L2U A;  2LTO A;  3P8D A;  2RI3 A;  4E7L A;  2JZ2 A;  2VYT A;  1OZ3 A;  3FEO A;  3LGF A;  3OYK A;  2BKD N;  4N4I A;  1E7L A;  4QW2 A;  3Q1J A;  3L2Q A;  2GFU A;  3QKJ A;  4A4H A;  2F5K A;  5FRM A;  1N27 A;  3OYG A;  3P8H A;  2E6N A;  2O4X B;  3O8V A;  5J39 A;  1H3Z A;  3NTI A;  5KE2 A;  3CEY A;  3LGL A;  2M16 A;  4PLI A;  3S3O A;  3MP8 A;  2M0O A;  4FU6 A;  4C5G A;  1MHN A;  3L2W A;  2JTF A;  2YRV A;  2RHX A;  4N4G A;  3C4S A;  4BDY A;  4BE2 A;  5FRN A;  4QVZ A;  1KHC A;  4EDU A;  2HQX A;  3ASK A;  4B9X A;  5C6S A;  4Q5W A;  2X4X A;  3KUF A;  3OA6 A;  4BE1 A;  4BD3 A;  3OYL A;  4E7J A;  2X4Y A;  2LDM A;  2GF7 A;  2O4X A;  2PQW A;  3OB9 A;  3H8Z A;  4GY5 A;  3OS2 A;  3OYN A;  3LLR A;  4IUR A;  2EQU A;  3SD4 A;  2G3R A;  3UT1 A;  2RJC A;  2RO0 A;  4CRI A;  5FRO A;  2L89 A;  1G5V A;  4II1 A;  2DIG A;  3FDR A;  5CIU A;  2BIV A;  3MEU A;  4A4E A;  3EAE A;  4RG2 A;  2RJF A;  5KH6 A;  2B8A A;  3OYH A;  1OYX A;  2MWP A;  4QQ6 A;  4QQG A;  3QII A;  2EQK A;  5J26 A;  4ZTJ A;  1E7D A;  5C0M A;  3QBY A;  3NTH A;  4BAC A;  2FHD A;  2RJE A;  4B9W A;  3OYD A;  3DB4 A;  4UC4 A;  2XDP A;  4E7I A; 
#chains in the Genus database with same CATH topology
 2QXF A;  5FU6 B;  3FJ5 A;  3QYG B;  1CT0 I;  4PKC C;  2LX9 A;  2WSF E;  2RMO A;  5CQY A;  1P9Z A;  1LR9 A;  4A4G A;  4M7D D;  1YTP A;  2M02 A;  1P9G A;  3LWI A;  4Z89 A;  3QG1 A;  1VQK A;  1ULM A;  5GAN 2;  2CGH A;  2KMP A;  4QVD A;  3L2Z A;  1HJA I;  4CI0 C;  1BUS A;  3OYB A;  2UZ3 A;  3OS0 A;  2SGD I;  4BDZ A;  3BW1 A;  1TTH B;  2YXY A;  1YU6 C;  3EG0 A;  3OBY A;  3PMI A;  1M3A A;  2DL8 A;  1IW4 A;  1Q82 U;  2YRC A;  1PPF I;  1IY6 A;  2RJD A;  1YI2 Q;  3PDN A;  2CT3 A;  3M4Y A;  1ZUU A;  4AFS C;  1PSF A;  3G6E T;  2Y4Y A;  3MJX A;  4EMH A;  2D0Q B;  5CK9 A;  1ZBJ A;  1IZ6 A;  3QAH A;  3JCM e;  5FW9 A;  1D1A A;  2XDD A;  3Q1J A;  1KIK A;  1SGR I;  4IIM A;  5KE2 A;  2NU4 I;  3CCR Q;  2J9R A;  2YUQ A;  1S20 A;  3CME T;  2KE9 A;  2F5T X;  3ASK A;  9ATC B;  1VUB A;  1AN1 I;  5C6S A;  1U1S A;  2K4Y A;  1Q9B A;  4QVC A;  4HCB A;  4OB2 B;  3GF5 A;  5GMK l;  3H8Z A;  1VQ6 A;  2C0O A;  2OVO A;  4Z8A A;  1YJW T;  4IUR A;  2KYB A;  3M59 A;  2G3R A;  5J3B A;  1W4R A;  2YRD A;  1BCM A;  2D1X A;  4F7U G;  4FKD A;  1W3S A;  1PTQ A;  4JS4 A;  1OYX A;  3HL8 A;  4OB0 B;  3QBY A;  3EGX B;  1OUL A;  1R0B G;  2NUP A;  3KFV A;  1PJU A;  1WHL A;  4AFU C;  4E7I A;  9WGA A;  4FYV B;  5HKC A;  3FC3 A;  4AML A;  3CCV A;  2KY9 A;  1VQ5 Q;  1C1A A;  4AG2 C;  2V1C A;  1MMG A;  3QDR B;  4IUV A;  2J6F A;  1PNJ A;  3JAM E;  1QVG P;  2JA1 A;  2HQH A;  3J80 E;  2BUD A;  1I8F A;  2DPP B;  2RF0 A;  3OYJ A;  3RDV A;  2E5R A;  3CCR A;  1TUS A;  3X24 B;  3NGP A;  1TOV A;  2V53 A;  5LJ3 f;  2DVJ A;  5CO7 A;  3OYC A;  3MEK A;  1CKB A;  1G3Y A;  1WI7 A;  1W4S A;  1GFC A;  2DTH A;  1IY5 A;  1Z7K B;  1U3O A;  1E7O A;  3JCM b;  2ZPG B;  4ME7 A;  2GQV A;  4UXH A;  2RI5 A;  3PTA A;  5FU7 C;  1MUZ A;  3EFO B;  1EIF A;  2P6A C;  3PFS A;  2L3R A;  5FU6 C;  3HKS A;  4M78 A;  3M0T A;  4KGV B;  3CCU Q;  2PUO B;  1YI2 A;  1D1C A;  1CE3 A;  2F2V A;  2LVM A;  3VS6 A;  3U23 A;  1M2O A;  2IG0 A;  2DB6 A;  1K73 U;  2RI3 A;  1QP2 A;  1FYN A;  4CC4 B;  1NJI R;  2FPD A;  5AT1 B;  1UVG A;  1V1H A;  3QKJ A;  1OPL A;  1N27 A;  2ZPE B;  2X3T A;  1EZZ B;  1BK2 A;  1K7T A;  2QA4 A;  1PG5 B;  2JM8 A;  1CGJ I;  1NYF A;  2ZPB B;  3CCV T;  2LCS A;  3RU0 A;  4DBH A;  4J6Y A;  4M75 F;  3H0I A;  1N13 A;  4O6J A;  2HCK A;  1HJD A;  3GNF B;  2PQW A;  3OB9 A;  3HRS A;  1ULN A;  1Q81 C;  1I07 A;  1VQ7 Q;  1NJI C;  4ZGE B;  3UPU A;  1GRI A;  2DD5 A;  1Q86 U;  2BIV A;  2VGN A;  2KSS A;  5KH6 A;  4JZ4 A;  1UUE A;  1YI2 T;  4KRT A;  1YIJ A;  2QGG A;  1VQP T;  3SWN C;  2A28 A;  2MIO A;  3CCS Q;  5CCL A;  1LVK A;  5GJV B;  4M7D B;  2HKN A;  2GKV A;  2DYB A;  5EG2 A;  1RAB B;  2NWM A;  3UOE A;  1TIH A;  1UUC A;  2XIC A;  2R58 A;  2LRQ A;  1BIB A;  2H8H A;  4M75 G;  4EMG A;  3G4S A;  3CC2 Q;  3REA B;  2RQU A;  3A8G B;  3I35 A;  2QQB A;  4M7D G;  2EJ9 A;  1X6O A;  2P0K A;  3GLX A;  8ATC B;  4EMK C;  1M30 A;  3BDU A;  2JOY A;  1TWB A;  2D8H A;  4CC2 A;  1N8R R;  2KRN A;  3GOX A;  2NYS A;  2XG8 D;  3QYH B;  3GP8 A;  1LR8 A;  1OX8 A;  3LWH A;  5LL6 S;  1LJO A;  3SFM A;  3NPF A;  1WGS A;  4Y92 A;  3CMA A;  4OMO A;  1YHQ A;  4HT9 A;  2EBP A;  4M77 F;  3NTK A;  1K9A A;  2EJG A;  4PJO E;  1T3S A;  2KDS A;  1B34 B;  5GAM f;  4E1P A;  1M8B A;  3CPW P;  3MO8 A;  2EYY A;  2BKD N;  3TO7 A;  3CC4 T;  3VDP A;  3O8V A;  1KC8 U;  4GBQ A;  3LGL A;  4PLI A;  2CZ1 B;  1H3H A;  4LDU A;  2RD1 A;  2M0O A;  2HNI A;  2X3W D;  3SB2 A;  1K0X A;  1SGE I;  4PJO G;  2EYX A;  1V76 A;  1JBM A;  3A8L B;  3UA6 A;  1YJ9 T;  4C92 A;  1PC0 A;  3LW5 E;  4C0D C;  3MPU B;  1ZUK A;  2QQE A;  2JS0 A;  1RFH A;  2SRC A;  2DLP A;  4II1 A;  4B6M A;  2DIG A;  3QTL D;  1TBN A;  4ELY C;  4RG2 A;  2XU8 A;  4M75 D;  3CCM T;  2EQK A;  1VQO A;  1E7D A;  1Z9Z A;  2CP0 A;  3CMA Q;  5HY6 A;  4M75 C;  4A53 A;  1HYO A;  4PJN A;  2XD0 A;  1VQ9 T;  1NXU A;  1M1K C;  2L0A A;  4C0Z A;  3TO9 A;  2E70 A;  2MWO A;  1YP5 A;  1M90 U;  1KHI A;  2F3C I;  5DLO A;  2QQC A;  2K3X A;  2LQN A;  3QSU A;  1E6G A;  2DVE A;  2WAC A;  4C92 B;  2P0Q A;  2PQ8 A;  4ESR A;  5CKE A;  4CC3 A;  4D8K A;  5IHK A;  5GAN j;  5GAN e;  3V7S A;  2ZPF B;  1PRM C;  1H0Z A;  2YLC A;  2AKL A;  2F2W A;  3NFC A;  1VQ6 T;  2MMP A;  1ABQ A;  1UEB A;  4XAX B;  4IUT A;  1N8R U;  1K1Z A;  4J9B A;  4M78 D;  3NMZ C;  3HPW A;  4QKU A;  1TU0 B;  5KYX B;  3QO3 A;  3CC7 Q;  3CC4 Q;  5I11 A;  1QVG A;  1NLO C;  2PVG B;  1UEC A;  3PMT A;  3CQT A;  3KBG A;  3L2U A;  4C92 C;  2V26 A;  5LJ3 e;  3CPF A;  4D8D A;  1Y7X A;  2BTT A;  2VYT A;  1C0M A;  3HSB A;  1D3B B;  4C92 D;  2KXC A;  1K73 C;  1IHV A;  3CCQ T;  3RNJ A;  4JDS A;  1X4S A;  1VQ9 Q;  2A3L A;  4XU3 A;  4DBR A;  1NBE B;  3HFN A;  2BUS A;  4MMK A;  4D6W A;  2LNH B;  3BJI A;  4J9I A;  2KR3 A;  1KD1 R;  1OOT A;  5GAN h;  2RO0 A;  1SGD I;  3FB9 A;  2XRC A;  2OAU A;  1TH7 A;  2AZV A;  1VDD A;  5A0D A;  3UEY A;  4C0F A;  4XK8 E;  2DL3 A;  2HSP A;  5KYY B;  4PJL A;  2XDP A;  1FX7 A;  1U1T A;  3CC4 A;  2K5I A;  5HCK A;  3CBO A;  3CCU T;  1U06 A;  2JXB A;  2PU9 B;  1GBR A;  2DZC A;  1M8M A;  4IUP A;  1K73 R;  4C0D B;  1OMT A;  3VS7 A;  4KUI A;  2ED1 A;  1QKW A;  2X9H A;  5CKB A;  3F70 A;  4NOY A;  1H92 A;  1D0Y A;  4MDW A;  2ZZD A;  2KAF A;  2B8T A;  1RL2 A;  1ZBX A;  1S1N A;  1WNL A;  2LCC A;  5KYN A;  4C8Q D;  1OQK A;  2ECZ A;  1WTJ A;  4XU2 A;  1E6H A;  1S72 A;  3I56 T;  2M5X A;  3G7Z A;  3UFF A;  2CP7 A;  1WJR A;  2R57 A;  1M8C A;  1Y96 B;  1OI1 A;  3EGU A;  1UG1 A;  3UF4 A;  1QKX A;  3QWY A;  4J9H A;  1JXM A;  2N71 A;  1TSF A;  1ZSZ B;  3A1P A;  1VQO T;  2WVJ A;  2DZ9 A;  3OS5 A;  4M7A A;  3CD6 A;  2DX1 A;  4R56 A;  2FB7 A;  3P8D A;  2OJ2 A;  1ZUY A;  2QAS A;  4HXJ A;  4L6V 5;  2PVD B;  3L2Q A;  1UGS B;  1FXX A;  2ELI A;  2JTM A;  4M77 A;  1VQM Q;  2VC8 A;  5FRM A;  5E3R A;  2CSI A;  2H3J A;  3S3O A;  2DET A;  2A0F B;  2LQ8 A;  2O9V A;  3OSS C;  2EKH A;  4M7D A;  3J81 E;  2FPE A;  3R5C A;  3JCM d;  2RHX A;  1NPP A;  2FZG B;  4LNP A;  2E3I A;  3EGD B;  1VQ4 T;  2QK0 A;  4JJD A;  1VQO Q;  2O4X A;  3I55 Q;  2A08 A;  1WQ7 A;  4J7I A;  2RJC A;  4M78 C;  1WX6 A;  3VRY A;  1Q7Y R;  3QWP A;  3UEJ A;  1WHH A;  3MEU A;  1ZQ1 A;  5GAO n;  3C12 A;  1MJA A;  4F17 A;  1X6G A;  4M75 E;  4XU1 A;  3V7C A;  1WIE A;  2KBT A;  2K9G A;  3CCV Q;  1VQ5 A;  2CZ0 B;  1N9R A;  1NG2 A;  4LUE A;  1VQ5 T;  4IIO A;  2QEX A;  3OW2 P;  1HEV A;  3UGD A;  2AIR B;  4PJO D;  2F1L A;  5LJ5 e;  3WXM B;  2EQJ A;  1N6A A;  1W70 A;  3JB9 H;  1YWP A;  5IXB A;  2EGC A;  3HTR A;  2LX7 A;  3R5B A;  4F04 B;  1JO8 A;  4NS5 A;  3MEV A;  3CXC S;  1M90 C;  3S3N A;  1XBT A;  2NUP B;  1RAE B;  2HZY A;  2GNC A;  3GBQ A;  3M9Q A;  3S6W A;  2KT1 A;  4L9M A;  3OYA A;  4WP4 A;  2COW A;  4J7F A;  2DL7 A;  3VUZ A;  3R5A A;  3RMQ A;  5KYU A;  5GAO m;  1XA6 A;  2YDL A;  1YJN Q;  5KCO A;  5GAN 5;  2L3P A;  3AHU A;  3ZEH A;  4J83 A;  3JCM h;  3OQ5 A;  1YIT Q;  1NUB A;  4WTO B;  3M53 A;  2ATC B;  1N8R C;  5EX0 A;  2LNV A;  3SHW A;  2ORV A;  3DKM A;  2DO3 A;  3CCJ T;  4J9G A;  5GAM e;  1ZA1 B;  4AFQ C;  3RKW A;  3RMS A;  1I4K 1;  2ZAE A;  5IT9 E;  2DER A;  2NU2 I;  3OXL A;  2K2V A;  1JXO A;  2VUB A;  3JRZ A;  4OMN A;  1TXQ A;  2P4T A;  5GAN d;  4RTX A;  1YCY A;  4M75 B;  2P0P A;  2HL5 C;  3VS3 A;  2QQA A;  4BDY A;  1YBY A;  5GMK e;  2HQX A;  2O2O A;  4J5Y A;  2KCX A;  4J9F A;  2LZ6 B;  5LJ3 d;  1W2B P;  2X4X A;  1CGI I;  4GY5 A;  1K8A C;  4JRK A;  5HK3 A;  3SD4 A;  1SKU B;  2LC4 A;  3E19 A;  2DFU A;  4M7A E;  1TOT A;  1G5V A;  1VOM A;  4KGZ B;  3JCM c;  2NU0 I;  2JYY A;  2B8A A;  2QYZ A;  2ROT A;  5EX3 A;  2MWP A;  1WGC A;  3JCM Q;  3WVE B;  2MYS A;  2HBW A;  2CUB A;  1PD1 A;  2LT1 A;  3TOA A;  1MV0 B;  1VYU A;  4R0K A;  1AWJ A;  5HQ8 A;  4A24 A;  2EQI A;  3G4S Q;  2W0T A;  1M2V A;  2CSQ A;  3PT9 A;  3UWN A;  3X28 B;  2C0I A;  1A0N B;  1SSH A;  2OTL T;  3AT1 B;  1KQS S;  3INZ A;  3QJ6 A;  1OZ2 A;  4DOW A;  1B3Q A;  1C6V X;  3JB9 I;  2FEI A;  3MP1 A;  4RG8 A;  2MAM A;  1M3B A;  3PIO A;  4ORZ A;  4OB1 B;  4E7S A;  3E9G A;  4ZN1 A;  1XTD A;  2QG9 B;  2GVI A;  1YIT T;  3JB9 D;  4FSX A;  2FZK B;  3N5B B;  1KBE A;  3RKX A;  1Y1B A;  2HSE B;  1Y07 A;  3V8L A;  2EAY A;  1XQH A;  2O31 A;  3OYM A;  1IRE B;  2YSQ A;  5GMK i;  1KC8 R;  2V1C C;  4M7A B;  1AWW A;  2QNC A;  3MKD A;  5GAO l;  3EHR A;  4B6D A;  2CH4 A;  1MV3 A;  1BU1 A;  2W10 A;  3FIF A;  2KRS A;  2Z0W A;  3LGF A;  1VQP Q;  1WDX A;  1Y1C A;  1V29 B;  3SWN B;  1AWX A;  1GCQ A;  2COY A;  2J06 A;  4FSS A;  3OYG A;  3R6O A;  1B34 A;  3NTI A;  1ZSZ C;  1VQ7 A;  4RCC A;  1SF9 A;  5FUW A;  2NUZ A;  2VB6 A;  4EPC A;  3SGQ I;  4FYX B;  2DTO A;  2IIM A;  3L2W A;  2YHT A;  2J6O A;  4BE2 A;  2NUT A;  6AT1 B;  4UXI A;  4K11 A;  1ZX6 A;  2M9U A;  2G6F X;  2COZ A;  2KVQ G;  4B9X A;  4FT4 A;  1PKS A;  3OYL A;  3G4S T;  1AWO A;  2L7X A;  4MZP A;  2CZ6 B;  3UT1 A;  1VIF A;  5GAN 4;  5FRO A;  1QCN A;  4OF1 A;  3JSC A;  2DBK A;  4ZGD B;  3M58 A;  1S72 Q;  1AVZ C;  3EAE A;  4KH1 B;  3D7S B;  3OYH A;  1UGR B;  2LP5 A;  1RAF B;  1FAR A;  4BAC A;  2SGF I;  1LCK A;  4LE9 A;  1UE9 A;  4B9W A;  1WHM A;  3UDC A;  2GKR I;  3E59 A;  2X4J A;  2RHI A;  2JW6 A;  2E4H A;  2DAQ A;  4OVO A;  1Q82 C;  5FUX A;  4XQ3 A;  1G2B A;  2DF6 A;  2A36 A;  1SSF A;  1VQM T;  4RMO A;  1TUD A;  3UGI A;  2HD0 A;  1SG5 A;  2I2L A;  1VQL Q;  1N9S A;  2JMA A;  3EFO A;  5D6X A;  5GAN 8;  5M9O A;  3G71 Q;  3RER A;  2GGR A;  3CCE Q;  2DBM A;  1BI1 A;  3HP9 A;  2A20 A;  2RI2 A;  2FRW A;  1GBQ A;  2LCL A;  1PD0 A;  2ENZ A;  1WHJ A;  3OYF A;  2DIQ A;  2JW4 A;  2L3Q A;  1SRL A;  3OMC A;  4M4Z A;  4DBF A;  2ERW A;  1UGQ B;  4M7D E;  2JJ9 A;  4FW1 A;  3SDZ A;  1K4U S;  4PJO F;  2KNB B;  1VQ7 T;  5GAO p;  2DYI A;  1WPY A;  1M1F A;  1UB4 A;  3TQ7 P;  4RTY A;  2ZCF B;  3UGL A;  3OYI A;  2AHJ B;  4NL3 A;  2N1A B;  5FWB A;  3MP6 A;  4OML A;  3TCJ A;  2X4W A;  2BE9 B;  3UAT A;  1QVF P;  1MJB A;  1JU5 C;  5CKF A;  4PFP A;  5L23 A;  2HDA A;  4XTV A;  3PNW C;  1YJW A;  2DM1 A;  2E1H A;  4RTZ A;  2O9S A;  1M1G A;  4J6X A;  4M7A F;  1W2B S;  1NLP C;  4PFO A;  1R79 A;  2DJZ A;  1NEB A;  3RR6 A;  1KQS A;  1I5L A;  1ZSG A;  2KK4 A;  5IXF A;  3MHX A;  4E2F B;  4OMP A;  5FU7 B;  3G1J A;  1NPR A;  3JCM g;  4UXJ A;  1D09 B;  1YJW Q;  2OZU A;  4GLK A;  1LR7 A;  2FZC B;  2F69 A;  1KHC A;  3RBB B;  2ZGW A;  4C8Q A;  1RAA B;  2RK1 A;  2LDM A;  1M3C A;  2HKQ B;  4AMC A;  3QPH A;  3OYN A;  1T0J A;  2JS2 A;  1VQN Q;  1FMV A;  1RAG B;  2VV5 A;  1TUG B;  4KUL A;  2UVO A;  2M51 A;  5L8R E;  3VS5 A;  4XU0 A;  4BUG A;  2DEU A;  2LQK A;  2RJF A;  1PKT A;  2YUN A;  1MGQ A;  2J87 A;  5J26 A;  2PTK A;  3X26 B;  3PIP A;  3JCM W;  1MMD A;  2KGT A;  2DEQ A;  1RI9 A;  5CCA A;  1M4Z A;  4F7U A;  1VYT A;  2N52 A;  2FVU A;  1EN7 A;  1X2K A;  5CQX A;  1KQ1 A;  2A37 A;  1UFF A;  2LMJ A;  1X2Q A;  1WHG A;  1VQ4 Q;  1ULK A;  3X20 B;  4A4F A;  5HK0 A;  4M77 B;  5GAM j;  1RAC B;  2NLU A;  3DLM A;  4E7K A;  3G71 T;  2EYW A;  1DS3 I;  3CC7 T;  2CWH A;  2CUD A;  1AHJ B;  3C95 A;  1YFN A;  3ULR B;  4DA4 A;  1KD1 U;  3LYI A;  3JCM V;  4LDX A;  1FMK A;  2BZY A;  5IAY A;  3HRT A;  4OVA A;  1PM3 A;  5CR2 A;  3OW2 A;  2HL3 A;  1IO6 A;  1ZLM A;  3VS4 A;  2FPF A;  2SGE I;  3M4G A;  4DEY A;  2AZS A;  1VYV A;  2V8K A;  2DRM A;  3A98 A;  2YUU A;  4M77 E;  2SGP I;  2KMO A;  3EG9 A;  4LD6 A;  4RTU A;  2RK2 A;  1WXU A;  1PCX A;  3TJQ A;  5A0G A;  3I56 Q;  1DJ7 B;  4GLM A;  2QQD A;  1YWO A;  3OYK A;  2M0Y A;  1UJ0 A;  5CKD A;  1K7V A;  4OP0 A;  4A4H A;  2DMO A;  2E6N A;  1J3T A;  1UJY A;  1H3Z A;  1KSW A;  2QQ9 A;  1FYB A;  2FYK A;  1O9S A;  3EHQ A;  2V1Q A;  3HH2 C;  1I5O B;  2EIF A;  3KUF A;  2A7Y A;  3CCM Q;  4BE1 A;  1K7U A;  2EPD A;  3O5Z A;  1EX4 A;  4C92 F;  2C06 A;  2ZPH B;  3EH2 A;  2CP2 A;  3EGD A;  5LJ3 j;  4OMF B;  1Q81 R;  3MCA B;  1D1B A;  5I22 A;  1JB0 E;  3VV0 A;  4ATO A;  3QHS A;  4R55 A;  2OTJ Q;  1G3W A;  1VQK Q;  2HMA A;  2N17 A;  2K3Y A;  1K0S A;  1X27 A;  3ZFJ A;  4HCZ A;  1WXT A;  3OBW A;  2GQI A;  2O88 A;  4BB7 A;  1GXI E;  4OGC A;  1K9M U;  2QQ0 A;  2EQM A;  5IN1 A;  4CC7 A;  2RPN A;  3CCQ A;  1IHW A;  2L8E A;  3ZBD A;  1M90 R;  2DXT A;  3CCJ Q;  1BB9 A;  2K5F A;  4ANJ A;  2RN8 A;  1OU9 A;  1YIT A;  2V8J A;  4V2S A;  2CDT A;  2HQE A;  4C8Q F;  2J05 A;  2RB6 A;  4SGB I;  1KC8 C;  3REB B;  2CH4 W;  2QI2 A;  2CP3 A;  3J7A F;  1RLQ C;  1QCF A;  4DQ2 A;  4F7U E;  1YJN T;  4PK4 A;  2LUY A;  1TGS I;  5GMK h;  3QDF A;  4OGE A;  3G6E A;  4VUB A;  2RHZ A;  4M77 D;  4QT7 A;  3KY9 A;  2PVO B;  5GJW B;  2K7A A;  4JUV A;  4RKU E;  2JZ2 A;  1OZ3 A;  2J6K A;  1K76 A;  4M78 E;  2GKT I;  1RAI B;  1YJ9 A;  1YHQ Q;  4RTW A;  2VXE A;  1XOV A;  4PJM A;  4C5G A;  3VJP A;  3B4V C;  3CXC A;  5AYF A;  2K6D A;  4MDX A;  3UA7 A;  4BD3 A;  5GAO r;  1D0X A;  2V1R A;  1BI3 A;  2X52 A;  2OAW A;  4BY6 B;  1SRM A;  2KEA A;  3NHN A;  4XTX A;  2F2X A;  2LEO A;  2L89 A;  2QTX A;  3A8O B;  3CME A;  5GAN 6;  4FIB A;  5FLX E;  2KDP A;  3SEM A;  2KI7 A;  4JJC A;  3HFO A;  4ZTJ A;  5I2M A;  5JHW C;  5C0M A;  2VRW B;  4F7U B;  4Z88 A;  2N1U A;  5EC7 A;  4JRP A;  4ZNX A;  4LDW A;  3OA6 A;  4FYY B;  2EKO A;  2JNG A;  4PFZ A;  4BI4 A;  3OSV A;  1YJN A;  5FWC A;  2B0U C;  1XX6 A;  2XKO C;  4FW2 A;  2KMT A;  3LH5 A;  3CC2 A;  3OS1 A;  2DK3 A;  2RQW A;  1G3S A;  2D0N A;  1YJ9 Q;  5GAN f;  3C94 A;  1OU8 A;  3P8B B;  5DM7 R;  1QCO A;  2YT6 A;  5J8F A;  4KT0 E;  3RKY A;  3MEW A;  3H6Z A;  2FG0 A;  1HPT A;  2AKK A;  3KXT A;  1BMO A;  1I81 A;  3CCS T;  4JPB W;  4C8Q G;  4OMQ A;  2EFI A;  3M0S A;  1GFD A;  5GMK j;  2P4R A;  4JRI A;  3CCL A;  3SEK C;  4P5N A;  3JCM P;  1BCO A;  4BE0 A;  5J8C A;  3OVO A;  2GBQ A;  2GFA A;  2CRE A;  4PL6 A;  3CXC P;  2ROW A;  3HHT B;  1AZE A;  2GTJ A;  2ARP F;  3E2I A;  2JTE A;  4DEX A;  4WF2 A;  5KYW B;  2K5L A;  1Y0M A;  5DY9 A;  4BI3 A;  2YUO A;  1NYG A;  2LJ1 A;  5GAM h;  2RH2 A;  4LN2 A;  4XTY A;  5J39 A;  1JJ2 P;  2M16 A;  1UGP B;  2I0N A;  1T3L A;  2ABL A;  2KT8 A;  4JLI A;  3M57 A;  2KYM A;  3BE3 A;  1R8O B;  2IVW A;  2E12 A;  2ED0 A;  1PWT A;  1AZG B;  2DD4 A;  3CC2 T;  2VGM A;  1V1I A;  2E65 A;  3EG2 A;  5IHI A;  4RTT A;  3TEE A;  2JZM A;  2X4Y A;  5LJ5 f;  4ZN3 A;  2KMQ A;  5DAE A;  4WCI A;  2DL5 A;  2EW3 A;  3FDR A;  3CCL Q;  2B86 A;  2YQP A;  3QII A;  1G3T A;  2NUT B;  2FHD A;  1Z2I A;  2LQW A;  5KYW A;  1SEM A;  3OYY A;  1OEB A;  2M1H A;  2ORW A;  1W2B A;  2L5Q A;  2CJS C;  1PSE A;  2QQR A;  1BKB A;  4QQD A;  2QGF B;  3DB3 A;  2FNF X;  3EG9 B;  7AT1 B;  7WGA A;  4PJO B;  4IUQ A;  4JS5 A;  1QVP A;  1Q81 U;  4LD9 K;  2RIJ A;  1NJI U;  2PZ1 A;  4IUU A;  4FM4 B;  3CC7 A;  1K9M C;  1Q86 C;  4E7H A;  2XHC A;  4XTU A;  3OY9 A;  1G83 A;  2EYZ A;  4C5I A;  3G6E Q;  1WKX A;  1PTR A;  1HXD A;  2GTO A;  2L8D A;  2DKV A;  3EGX A;  5I21 A;  1M1K R;  2KXD A;  2SEM A;  5LJ3 h;  1VQ6 Q;  4LDY A;  1VQN A;  2R5A A;  3CBP A;  2P84 A;  3I5R A;  5GAO q;  4GI3 C;  4M77 G;  8AT1 B;  1UHA A;  1QQJ A;  2X35 A;  1M8V A;  1CT4 I;  1FWZ A;  1R0R I;  3FSX A;  5CKH A;  1RAD B;  2JMC A;  2ESW A;  2OU2 A;  2E41 A;  1OYV I;  1VQM A;  3QXE B;  2JN0 A;  2GCX A;  1Y96 A;  4N4I A;  2L2P A;  4QW2 A;  5GMK m;  1VQ9 A;  2RC4 A;  3V7R A;  1FY7 A;  3M55 A;  3T9N A;  4E6R A;  1WQW A;  2BE7 D;  3MP8 A;  1OPK A;  2CS7 A;  2RQT A;  1Q82 R;  1QVF A;  4PNO A;  2DNU A;  3C4S A;  1D3B A;  1XJW B;  2QAZ A;  3M0R A;  2FRY A;  3V8K A;  3QJY A;  1YIJ Q;  4JRQ A;  3OW2 S;  3CPW S;  2RA2 A;  1Q86 R;  3CCL T;  1Q7Y U;  2EQU A;  1T0H A;  4J6W A;  4C92 E;  1PCE A;  2RNA A;  2EYQ A;  1TBO A;  1YCS B;  1ZHI A;  2QPO A;  4C8Q B;  3QWX X;  1V1C A;  2E10 A;  3VS0 A;  1GL5 A;  3OYD A;  4UC4 A;  1AOJ A;  3ER0 A;  1NE8 A;  1HD3 A;  5E3P A;  2W0Z A;  4L59 A;  3FLG A;  3ZL7 C;  3RUX A;  1WLP B;  1M9S A;  3PGG A;  3H9N A;  2XK0 A;  2E73 A;  3V8J A;  3LH0 A;  2J7I A;  3H0H A;  2OTL Q;  3OYE A;  2WGC A;  5LJ5 d;  2EWN A;  2CKK A;  2NU3 I;  2ZPI B;  1XNI A;  3L42 A;  3CCU A;  1ZSZ A;  3CCQ Q;  2RHY A;  1WJS A;  2E5Q A;  2HEQ A;  3SWN A;  1VQ8 Q;  1R77 A;  3FSY A;  2K57 A;  4FT2 A;  1M2V B;  2DTI A;  4X1V A;  2D9T A;  3L2R A;  3CMA T;  2MOX A;  2R5M A;  2DJQ A;  3TO6 A;  1X43 A;  1H8K A;  1M1K U;  1U5K A;  4O5V A;  1Y57 A;  3IQL A;  1HSQ A;  3CD6 Q;  2CP6 A;  5A0L A;  2PNI A;  3L2V A;  4BY6 C;  3PE0 A;  3JV3 A;  1JJ2 S;  1YHQ T;  2OTL A;  1K8A U;  2D8J A;  4E7Z A;  2MK5 A;  4PJO C;  5D6W A;  2LTO A;  2LJ3 A;  3OL0 A;  2PUK B;  2E64 A;  1K9M R;  4M7A D;  1TBQ R;  1PZW A;  1UTI A;  1H64 1;  1WYX A;  3H41 A;  1OMU A;  1R0C B;  4F16 A;  3CCM A;  4E47 A;  3CEY A;  1WGT A;  2X51 A;  2DXB A;  1KFZ A;  5FRN A;  3QZ9 B;  1JEG A;  4KH0 B;  4EIK A;  2K9H A;  1EFN A;  4E1R A;  4PJO A;  3VKI A;  5E3Q A;  1P92 A;  1IRX A;  1MNE A;  2QEX T;  2ENM A;  1PHT A;  4OMM A;  4HA8 A;  5CIU A;  3RIR A;  5LJ5 h;  4DOV A;  1CSK A;  3QUI A;  1BYM A;  2C0T A;  3M56 A;  4ELZ C;  2D6F A;  3M54 A;  3GPL A;  1NM7 A;  3EG1 A;  1N5Z A;  2OTJ T;  1FAQ A;  3C0C A;  3R6N A;  4L5G A;  1OVO A;  3MEA A;  3I55 A;  4X9D A;  3BDL A;  2YWW A;  1TS9 A;  1QWE A;  4KUD K;  3ME9 A;  4ZTF A;  4N4H A;  4JCV E;  3E9F A;  3E1S A;  4RCB A;  1X01 A;  4XTZ A;  2OX7 A;  1M5Q 1;  1X6B A;  3CPW A;  1RUW A;  1U5S A;  2HAX A;  1SGY I;  4J9C A;  2WSC E;  4FCY A;  4A4K A;  4F14 A;  1KJW A;  2OI3 A;  4MML A;  3JB9 F;  4X34 A;  4JLG A;  2ENN A;  2VKN A;  5D6Y A;  2JM9 A;  1I1J A;  4M7A G;  1MMN A;  3VE5 A;  3JCM X;  1HK9 A;  2DXU A;  1X75 C;  5KE3 A;  5KCH A;  2QNF A;  4A63 B;  1TUR A;  2EVR A;  3S3M A;  3OMG A;  1MJ9 A;  5CAI A;  1HDL A;  4DBQ A;  3PVL A;  1TUC A;  4LXC A;  1YIJ T;  3BFM A;  2QA4 Q;  1SHF A;  3I55 T;  3FEO A;  3FRN A;  2ODD A;  5A2Q E;  1TBR R;  4Y91 A;  4HVU A;  1ABO A;  2IPO B;  1IGU A;  3L1A A;  4C92 G;  1WHK A;  2GIV A;  2O4X B;  2ROL A;  5LJ3 g;  1VQK T;  3EG3 A;  2VAS A;  4FU6 A;  1IXD A;  1VQN T;  1PRL C;  2DL4 A;  2YRV A;  3I9Q A;  2OTJ A;  5GAN g;  5KYX A;  3JB9 J;  1Y8F A;  4E7J A;  2OD1 A;  3H0F A;  1WZO A;  3OS2 A;  3TOB A;  2CYZ B;  3LLR A;  1IGQ A;  2MPX C;  2O01 E;  4AFZ C;  3FJP A;  2DXC A;  4PJJ A;  4MZM A;  3VU3 C;  2EJF A;  4LUD A;  1Q7Y C;  5ECA A;  2QTV A;  3SGB I;  1MND A;  1F1B B;  4HVV A;  3VS1 A;  1QW1 A;  3NTH A;  2DIP A;  1SGN I;  3CME Q;  1JRI A;  3RES A;  4HVW A;  4RTV A;  4M7A C;  4J9E A;  3CCR T;  4HCK A;  2K2M A;  1WA7 A;  2DIL A;  4F7U F;  3MET A;  1BI0 A;  2KQW A;  5D7U A;  1QWF A;  4M7D F;  3M5A A;  4YTL A;  1W1F A;  5DLQ E;  4M7D C;  4JZ3 A;  3EFR A;  3TSW A;  1GCP A;  4KGX B;  2DRK A;  4A54 A;  3OXF A;  4C5H A;  5FUY A;  1W6X A;  1G8X A;  4BI8 B;  4C5E A;  2YUP A;  2KRO A;  3CBM A;  4IKF A;  3LX7 A;  2EGE A;  3GIB A;  3URG A;  4C0G A;  2LT4 A;  3CCE T;  5FUV A;  1CKA A;  2DA9 A;  2L3S A;  4MZT A;  4HCC A;  1SGQ I;  1IB8 A;  2V8I A;  2JVV A;  2RHU A;  2JXD A;  2Y4X A;  2EGA A;  3VUB A;  3A5Z B;  2CZ7 B;  2RQV A;  4OB3 B;  1UHF A;  1Q95 G;  2Y90 A;  4E7L A;  1B07 A;  4LDV A;  2E6Z A;  2VVK A;  2YLB A;  1JQQ A;  2F5K A;  4M78 G;  1O75 A;  1NEG A;  3QZ5 B;  3VYH B;  2KMR A;  2QA4 T;  2LB7 A;  4HGU A;  2Y0M A;  1Z9Q A;  2JT4 A;  1RLP C;  1KQ2 A;  1MMA A;  3M0Q A;  1X69 A;  4C8Q E;  5IH2 A;  3CCJ A;  3M0P A;  3TVT A;  1MHN A;  1MT1 A;  2JTF A;  3EH1 A;  5GAN 7;  3X25 B;  3JB9 G;  4EDU A;  1I0C A;  4Q5W A;  2XID A;  4NL2 A;  3VRZ A;  4N0A C;  3CCE A;  4MPI A;  2JUF A;  4CRI A;  2QEX Q;  1Y71 A;  2SGQ I;  2NU1 I;  1DS2 I;  1SPK A;  4X9C A;  2XMF A;  1VQL A;  4HT8 A;  4QQ6 A;  4QQG A;  3TRE A;  4J8O A;  1KD1 C;  3BY7 A;  1QVG S;  3WVD B;  1BBZ A;  1UDL A;  4AT1 B;  1VQL T;  2DKG A;  4M78 F;  3HRU A;  4JJN K;  1SGP I;  5GAM d;  3DB4 A;  1D0Z A;  4EMK A;  3G71 A;  1VA7 A;  1QLY A;  3A8M B;  4RUG A;  5I2S A;  1OX9 A;  4AG1 C;  2XI9 A;  1FMW A;  1B7T A;  2MF2 A;  1UVF A;  1QVF S;  1AEY A;  4Y28 E;  1WJQ A;  2CWG A;  3JCM J;  1YN8 A;  1S72 T;  1AT1 B;  1SHG A;  5GAN 3;  4XTW A;  2VWF A;  5LJ5 g;  3M0U A;  1YNZ A;  3THK A;  1RI0 A;  3GNG A;  2E5K A;  2K3B A;  2CWF A;  1UGV A;  4FL6 A;  4HKE A;  2QQS A;  2LJ0 A;  4Z02 A;  2VXF A;  3R5D A;  1WXB A;  3JCM f;  1RAH B;  3VDU A;  1TG0 A;  4PLL A;  2HBP A;  1BI2 A;  3OXG A;  2XDB A;  1AD5 A;  1KQS P;  3TU4 K;  5LJ5 j;  2BZX A;  2FL7 A;  3PVQ A;  1LNX A;  1VQ8 T;  1VQP A;  1KG1 A;  4JJB A;  3VYG A;  2E3H A;  4ZGJ B;  3E2U A;  2CT4 A;  3CCS A;  1M27 C;  5HI7 A;  2FO0 A;  4N0A A;  2H3E B;  3TSZ A;  1KMA A;  2BZ8 A;  4EMK B;  4M77 C;  2WCY A;  2QDY B;  1NZ9 A;  2MI6 A;  3DLL A;  1ARK A;  4DNC A;  1E7L A;  1VQ4 A;  2GFU A;  2MCN A;  4FYW B;  2KRM A;  5CVI A;  3P8H A;  5GAM g;  1U8R A;  5KYU B;  4KBM B;  2RQR A;  2K79 A;  3VS2 A;  2RM4 A;  3I56 A;  1GCQ C;  1CT2 I;  1OV3 A;  4N4G A;  2QDL A;  1UHC A;  4QVZ A;  1KK7 A;  4C8Q C;  5CCM A;  1WFW A;  2CP5 A;  5KYY A;  4M78 B;  3CXL A;  1LPL A;  1CSO I;  2GF7 A;  1X74 A;  1QP3 A;  2AK5 A;  1QMC A;  1LOJ A;  1VIE A;  4TVR A;  1K8A R;  3CD6 T;  1CHO I;  1BIA A;  1VQ8 A;  1KBF A;  2DE0 X;  4A4E A;  4M75 A;  2WSE E;  1ACM B;  1JJ2 A;  3I5S A;  3A8H B;  2RJE A;  2AT1 B;  2X3X D;  4J9D A;  1ZA2 B;  3D00 A;  3EFS A;  5IHN A; 
#chains in the Genus database with same CATH homology
 2FVU A;  2QXF A;  1EN7 A;  1NE8 A;  5FU6 B;  1FX7 A;  1U1T A;  4L59 A;  5CQX A;  3CC4 A;  2K5I A;  1KQ1 A;  3FLG A;  3QYG B;  3RUX A;  3CBO A;  1CT0 I;  3CCU T;  4PKC C;  2LX9 A;  1M9S A;  2WSF E;  2PU9 B;  3PGG A;  5CQY A;  2DZC A;  3X20 B;  2XK0 A;  1LR9 A;  2E73 A;  4A4F A;  5HK0 A;  4A4G A;  4M7D D;  4M77 B;  5GAM j;  3V8J A;  3LH0 A;  4IUP A;  2NLU A;  3DLM A;  1YTP A;  4C0D B;  1OMT A;  3LWI A;  4E7K A;  3OYE A;  3QG1 A;  4KUI A;  1VQK A;  5LJ5 d;  5GAN 2;  2EWN A;  2CGH A;  2CKK A;  3G71 T;  2KMP A;  1DS3 I;  5CKB A;  4QVD A;  2ZPI B;  3CC7 T;  1XNI A;  2NU3 I;  3F70 A;  4NOY A;  3L42 A;  3CCU A;  3L2Z A;  1AHJ B;  4MDW A;  4CI0 C;  2ZZD A;  2KAF A;  3C95 A;  3OYB A;  4DA4 A;  1KD1 U;  2RHY A;  3LYI A;  2B8T A;  1WJS A;  3JCM V;  2E5Q A;  4LDX A;  1RL2 A;  2UZ3 A;  1ZBX A;  1WNL A;  2LCC A;  5IAY A;  3HRT A;  3OS0 A;  4OVA A;  4C8Q D;  3SWN A;  2SGD I;  5CR2 A;  4BDZ A;  3OW2 A;  3BW1 A;  2K57 A;  4XU2 A;  1YU6 C;  3OBY A;  1S72 A;  4FT2 A;  3PMI A;  2DTI A;  2SGE I;  3I56 T;  2M5X A;  2D9T A;  3G7Z A;  3M4G A;  3L2R A;  3CMA T;  3UFF A;  1IW4 A;  1Q82 U;  2R5M A;  2V8K A;  1PPF I;  1IY6 A;  1M1K U;  1WJR A;  2RJD A;  2R57 A;  1M8C A;  1U5K A;  4O5V A;  1Y96 B;  3PDN A;  1OI1 A;  2YUU A;  4M77 E;  2SGP I;  5A0L A;  2KMO A;  4LD6 A;  3M4Y A;  3L2V A;  4BY6 C;  2RK2 A;  1PSF A;  3G6E T;  1JJ2 S;  2N71 A;  1YHQ T;  2OTL A;  1K8A U;  2Y4Y A;  1VQO T;  2WVJ A;  2DZ9 A;  3OS5 A;  4M7A A;  4PJO C;  4EMH A;  3CD6 A;  3TJQ A;  5D6W A;  4R56 A;  2FB7 A;  2LTO A;  1DJ7 B;  2D0Q B;  3P8D A;  5A0G A;  3OL0 A;  2PUK B;  5CK9 A;  2QQD A;  2E64 A;  4L6V 5;  1IZ6 A;  4M7A D;  1TBQ R;  3JCM e;  3OYK A;  1H64 1;  2XDD A;  2PVD B;  3Q1J A;  5CKD A;  1OMU A;  3L2Q A;  1UGS B;  4OP0 A;  1FXX A;  4A4H A;  2ELI A;  3CCM A;  2JTM A;  4M77 A;  5FRM A;  2VC8 A;  1SGR I;  4E47 A;  2E6N A;  1H3Z A;  5KE2 A;  3CEY A;  2NU4 I;  2H3J A;  2QQ9 A;  3S3O A;  1FYB A;  2LQ8 A;  3OSS C;  2J9R A;  2FYK A;  4M7D A;  2DXB A;  3J81 E;  1O9S A;  3JCM d;  2RHX A;  5FRN A;  1NPP A;  3QZ9 B;  3CME T;  2F5T X;  3ASK A;  1AN1 I;  1VUB A;  3HH2 C;  5C6S A;  1U1S A;  2K4Y A;  1VQ4 T;  2K9H A;  4QVC A;  2EIF A;  3KUF A;  2A7Y A;  3GF5 A;  4OB2 B;  4BE1 A;  4HCB A;  4PJO A;  2QQC A;  3VKI A;  4E1R A;  2O4X A;  5GMK l;  1P92 A;  3H8Z A;  1VQ6 A;  2OVO A;  1WQ7 A;  1YJW T;  4IUR A;  3M59 A;  2G3R A;  4C92 F;  4J7I A;  5J3B A;  2C06 A;  2RJC A;  1W4R A;  4M78 C;  2ZPH B;  2QEX T;  4F7U G;  4FKD A;  1W3S A;  1PTQ A;  4HA8 A;  5CIU A;  3RIR A;  5LJ5 h;  3QWP A;  4JS4 A;  3UEJ A;  3MEU A;  4DOV A;  1ZQ1 A;  5LJ3 j;  5GAO n;  1OYX A;  3C12 A;  3HL8 A;  3QUI A;  1BYM A;  4OB0 B;  4M75 E;  4OMF B;  4XU1 A;  3QBY A;  3V7C A;  3MCA B;  3M56 A;  1VQ5 A;  2CZ0 B;  4ELZ C;  1PJU A;  2D6F A;  1JB0 E;  3M54 A;  3VV0 A;  4E7I A;  1N9R A;  3QHS A;  4R55 A;  3GPL A;  4ATO A;  1VQ5 T;  3SEK C;  2QEX A;  1G3W A;  5HKC A;  3FC3 A;  3CCV A;  2KY9 A;  2OTJ T;  3UGD A;  2N17 A;  2V1C A;  2K3Y A;  4PJO D;  1FAQ A;  5LJ5 e;  3WXM B;  3QDR B;  4IUV A;  4L5G A;  3ZFJ A;  4HCZ A;  1OVO A;  3MEA A;  3I55 A;  3OBW A;  2EQJ A;  1N6A A;  4X9D A;  3BDL A;  3JB9 H;  3JAM E;  4BB7 A;  1GXI E;  4KUD K;  4OGC A;  3ME9 A;  1K9M U;  4ZTF A;  4N4H A;  4JCV E;  3E9F A;  2EQM A;  3E1S A;  4RCB A;  4NS5 A;  5IN1 A;  3J80 E;  2JA1 A;  2QQ0 A;  2BUD A;  1X01 A;  3MEV A;  3CXC S;  1I8F A;  2DPP B;  3CCQ A;  1M90 C;  3OYJ A;  3S3N A;  4XTZ A;  1XBT A;  2E5R A;  2L8E A;  3ZBD A;  1M5Q 1;  3CCR A;  2DXT A;  1TUS A;  3X24 B;  3M9Q A;  3S6W A;  3CPW A;  2K5F A;  2HAX A;  2V53 A;  5LJ3 f;  1YIT A;  4L9M A;  2V8J A;  4V2S A;  3OYA A;  5CO7 A;  1SGY I;  2WSC E;  3OYC A;  3MEK A;  4J7F A;  2HQE A;  3VUZ A;  4A4K A;  1G3Y A;  4C8Q F;  3RMQ A;  2RB6 A;  4SGB I;  4MML A;  3JB9 F;  4X34 A;  1KC8 C;  1W4S A;  2DTH A;  4JLG A;  2ENN A;  1IY5 A;  5GAO m;  5D6Y A;  1XA6 A;  1Z7K B;  2QI2 A;  3JCM b;  3J7A F;  2ZPG B;  5KCO A;  3VE5 A;  4ME7 A;  5GAN 5;  2GQV A;  4DQ2 A;  4F7U E;  1YJN T;  4M7A G;  4UXH A;  2RI5 A;  3PTA A;  3ZEH A;  4J83 A;  3AHU A;  5FU7 C;  2LUY A;  3JCM h;  3OQ5 A;  1EIF A;  2P6A C;  3PFS A;  3JCM X;  1HK9 A;  5GMK h;  1TGS I;  2DXU A;  2L3R A;  5FU6 C;  4OGE A;  1X75 C;  3G6E A;  3HKS A;  4M78 A;  5KCH A;  5KE3 A;  1NUB A;  2QNF A;  3M53 A;  4VUB A;  2RHZ A;  4M77 D;  1TUR A;  1N8R C;  3S3M A;  2LNV A;  2PUO B;  5EX0 A;  3OMG A;  5CAI A;  2ORV A;  3KY9 A;  1HDL A;  1YI2 A;  2PVO B;  3DKM A;  2DO3 A;  3CCJ T;  1YIJ T;  1CE3 A;  2LVM A;  3BFM A;  5GAM e;  2IG0 A;  2DB6 A;  3RKW A;  4JUV A;  1I4K 1;  4RKU E;  2RI3 A;  1QP2 A;  3RMS A;  5IT9 E;  1K73 U;  2KMR A;  2JZ2 A;  3I55 T;  1OZ3 A;  3FEO A;  3FRN A;  4M78 E;  2GKT I;  2NU2 I;  5A2Q E;  2ODD A;  1TBR R;  2K2V A;  4Y91 A;  3OXL A;  1YJ9 A;  1UVG A;  2VUB A;  3L1A A;  1V1H A;  3QKJ A;  4C92 G;  3JRZ A;  2P4T A;  1N27 A;  5GAN d;  3RU0 A;  2O4X B;  1YCY A;  2VXE A;  4M75 B;  2ZPE B;  5LJ3 g;  2P0P A;  1VQK T;  1XOV A;  4FU6 A;  4C5G A;  3VJP A;  3B4V C;  2QA4 A;  1VQN T;  1HJA I;  2QQA A;  2YRV A;  4BDY A;  2ZPB B;  1CGJ I;  1BUS A;  1YBY A;  5GMK e;  3CXC A;  3CCV T;  2OTJ A;  5GAN g;  2HQX A;  4J5Y A;  4J6Y A;  4M75 F;  5AYF A;  3JB9 J;  2KCX A;  5LJ3 d;  4MDX A;  2X4X A;  1CGI I;  1N13 A;  4O6J A;  4BD3 A;  4E7J A;  1Y8F A;  2OD1 A;  3GNF B;  5GAO r;  2PQW A;  3OB9 A;  3HRS A;  4GY5 A;  3OS2 A;  1K8A C;  1Q81 C;  1BI3 A;  2CYZ B;  4JRK A;  5HK3 A;  3LLR A;  4BY6 B;  1NJI C;  3SD4 A;  4ZGE B;  2LC4 A;  2O01 E;  3UPU A;  3FJP A;  3E19 A;  2DXC A;  4XTX A;  4MZM A;  2DD5 A;  4M7A E;  2LEO A;  2L89 A;  3VU3 C;  2EJF A;  1G5V A;  1TOT A;  2QTX A;  3A8O B;  1Q7Y C;  3JCM c;  2BIV A;  1Q86 U;  2NU0 I;  2VGN A;  3CME A;  2JYY A;  2KSS A;  5GAN 6;  2B8A A;  4FIB A;  5FLX E;  5KH6 A;  5EX3 A;  3SGB I;  2MWP A;  1YI2 T;  3JCM Q;  3HFO A;  3WVE B;  5I2M A;  4ZTJ A;  1QW1 A;  1YIJ A;  5JHW C;  5C0M A;  1VQP T;  2VRW B;  3NTH A;  4F7U B;  2DIP A;  3SWN C;  1SGN I;  4JRP A;  1JRI A;  4LDW A;  3RES A;  2LT1 A;  3OA6 A;  4M7A C;  2EKO A;  2JNG A;  5CCL A;  4BI4 A;  3CCR T;  3OSV A;  1YJN A;  4M7D B;  2B0U C;  5HQ8 A;  4A24 A;  1XX6 A;  2XKO C;  3CC2 A;  2KMT A;  2GKV A;  2W0T A;  5EG2 A;  4F7U F;  3OS1 A;  2DK3 A;  3MET A;  1TIH A;  1UUC A;  2XIC A;  1BI0 A;  3PT9 A;  2KQW A;  3UWN A;  1G3S A;  2R58 A;  3X28 B;  2LRQ A;  1BIB A;  5GAN f;  3C94 A;  4M75 G;  4EMG A;  3G4S A;  3A8G B;  3P8B B;  5DM7 R;  2OTL T;  3M5A A;  4M7D F;  4YTL A;  2F3C I;  2QQB A;  4M7D G;  1KQS S;  2EJ9 A;  3INZ A;  3QJ6 A;  1OZ2 A;  4DOW A;  5DLQ E;  3JB9 I;  1X6O A;  4M7D C;  4KT0 E;  3RKY A;  3EFR A;  2P0K A;  3MEW A;  3MP1 A;  4RG8 A;  3GLX A;  3H6Z A;  2MAM A;  4A54 A;  3OXF A;  4C5H A;  1HPT A;  4EMK C;  5FUY A;  3BDU A;  2JOY A;  3KXT A;  1BMO A;  3PIO A;  1I81 A;  3CCS T;  4OB1 B;  4ZN1 A;  3E9G A;  4C8Q G;  4BI8 B;  1E7L A;  4C5E A;  1XTD A;  2GVI A;  1YIT T;  3JB9 D;  2EFI A;  4FSX A;  3CBM A;  4IKF A;  3N5B B;  5GMK j;  3LX7 A;  3GOX A;  3GIB A;  4JRI A;  3URG A;  3RKX A;  3CCL A;  2XG8 D;  1KBE A;  1Y07 A;  3QYH B;  3V8L A;  2EAY A;  3GP8 A;  4C0G A;  4P5N A;  3LWH A;  2LT4 A;  1LR8 A;  5LL6 S;  3JCM P;  1LJO A;  4BE0 A;  3SFM A;  3CCE T;  3OVO A;  5FUV A;  2GFA A;  1WGS A;  3CMA A;  1XQH A;  1YHQ A;  3OYM A;  4HT9 A;  1IRE B;  4MZT A;  4PL6 A;  4HCC A;  1SGQ I;  4M77 F;  2ROW A;  3NTK A;  5GMK i;  2V1C C;  3HHT B;  2V8I A;  2EJG A;  4M7A B;  2JVV A;  2RHU A;  4PJO E;  2JXD A;  2QNC A;  2KDS A;  5GAO l;  2Y4X A;  1B34 B;  5GAM f;  2ARP F;  3VUB A;  3E2I A;  3A5Z B;  4B6D A;  4E1P A;  1M8B A;  2CZ7 B;  3MO8 A;  4OB3 B;  4WF2 A;  2K5L A;  4E7L A;  2Y90 A;  4M7A F;  3FIF A;  5DY9 A;  4BI3 A;  3LGF A;  1Y1C A;  2BKD N;  1V29 B;  5GAM h;  3CC4 T;  3SWN B;  4LDV A;  2E6Z A;  2YLB A;  2RH2 A;  2F5K A;  4M78 G;  1O75 A;  3VDP A;  3OYG A;  3QZ5 B;  3R6O A;  3O8V A;  4XTY A;  3VYH B;  1B34 A;  3NTI A;  5J39 A;  2QA4 T;  3LGL A;  1KC8 U;  1VQ7 A;  4HGU A;  2M16 A;  4PLI A;  2CZ1 B;  1UGP B;  2RD1 A;  4LDU A;  4RCC A;  4C8Q E;  4EPC A;  2M0O A;  3CCJ A;  1KQ2 A;  5FUW A;  3SGQ I;  2DTO A;  4JLI A;  1MHN A;  2HNI A;  3M57 A;  1MT1 A;  3L2W A;  2JTF A;  2YHT A;  1R8O B;  2IVW A;  2E12 A;  3SB2 A;  5GAN 7;  4PJO G;  1SGE I;  4BE2 A;  3X25 B;  3JB9 G;  4UXI A;  4EDU A;  1JBM A;  2DD4 A;  3CC2 T;  2M9U A;  2VGM A;  3A8L B;  1V1I A;  2KVQ G;  2E65 A;  4B9X A;  1YJ9 T;  4Q5W A;  4C92 A;  4FT4 A;  3TEE A;  3OYL A;  2JZM A;  2X4Y A;  3LW5 E;  4C0D C;  5LJ5 f;  2QQE A;  2XID A;  4NL2 A;  3G4S T;  4ZN3 A;  2KMQ A;  2L7X A;  4N0A C;  4MZP A;  1RFH A;  3CCE A;  5DAE A;  2CZ6 B;  3UT1 A;  2JUF A;  1VIF A;  4CRI A;  5GAN 4;  5FRO A;  1Y71 A;  4OF1 A;  3JSC A;  2SGQ I;  4II1 A;  4ZGD B;  2NU1 I;  3M58 A;  3QTL D;  2DIG A;  3FDR A;  1DS2 I;  1TBN A;  4X9C A;  4ELY C;  3EAE A;  4RG2 A;  1VQL A;  4HT8 A;  3OYH A;  4QQ6 A;  2XU8 A;  4QQG A;  1UGR B;  3QII A;  4J8O A;  4M75 D;  2EQK A;  1G3T A;  3BY7 A;  3CCM T;  1VQO A;  1QVG S;  3WVD B;  1KD1 C;  1VQL T;  1E7D A;  1FAR A;  4BAC A;  2DKG A;  2FHD A;  4M78 F;  3HRU A;  2SGF I;  4JJN K;  1SGP I;  4B9W A;  5HY6 A;  4M75 C;  4A53 A;  3DB4 A;  3UDC A;  5GAM d;  2GKR I;  3E59 A;  2X4J A;  3OYY A;  2RHI A;  2JW6 A;  2M1H A;  2XD0 A;  1VQ9 T;  2ORW A;  4EMK A;  3G71 A;  1W2B A;  2L5Q A;  2CJS C;  2DAQ A;  1PSE A;  2QQR A;  3TRE A;  4OVO A;  1BKB A;  1Q82 C;  3A8M B;  4QQD A;  5I2S A;  4XQ3 A;  5FUX A;  1M1K C;  3DB3 A;  4C0Z A;  2FNF X;  1SSF A;  2E70 A;  2MWO A;  4RMO A;  1VQM T;  3UGI A;  2HD0 A;  2I2L A;  1M90 U;  1N9S A;  1KHI A;  2XI9 A;  5D6X A;  4IUQ A;  5M9O A;  1QVP A;  5GAN 8;  4JS5 A;  5DLO A;  2MF2 A;  1Q81 U;  4LD9 K;  3RER A;  1UVF A;  1BI1 A;  1NJI U;  2K3X A;  3HP9 A;  4IUU A;  2A20 A;  2RI2 A;  4FM4 B;  1QVF S;  4Y28 E;  2LCL A;  1WJQ A;  3JCM J;  1S72 T;  3QSU A;  5GAN 3;  3CC7 A;  4XTW A;  5LJ5 g;  2N52 A;  2ENZ A;  1RI0 A;  2DVE A;  1K9M C;  2WAC A;  3GNG A;  1Q86 C;  4E7H A;  2XHC A;  4XTU A;  4C92 B;  3OY9 A;  2DIQ A;  2P0Q A;  4C5I A;  3OYF A;  4FL6 A;  3OMC A;  4HKE A;  1PTR A;  5CKE A;  2QQS A;  4Z02 A;  2ERW A;  2VXF A;  1HXD A;  5GAN j;  1UGQ B;  5GAN e;  3V7S A;  2ZPF B;  4M7D E;  1H0Z A;  3JCM f;  2L8D A;  2YLC A;  3SDZ A;  3VDU A;  5I21 A;  4PLL A;  4PJO F;  1VQ7 T;  2HBP A;  5GAO p;  1BI2 A;  1WPY A;  3OXG A;  1M1F A;  3NFC A;  5LJ3 h;  2XDB A;  1UB4 A;  1VQ6 T;  2MMP A;  3TU4 K;  5LJ5 j;  4LDY A;  2FL7 A;  1UEB A;  1VQN A;  2R5A A;  2ZCF B;  1LNX A;  4IUT A;  4XAX B;  2YQP A;  3OYI A;  1N8R U;  2AHJ B;  3CBP A;  3UGL A;  1VQ8 T;  4NL3 A;  1VQP A;  1Y1B A;  2N1A B;  3MP6 A;  4M78 D;  1KG1 A;  5GAO q;  3TCJ A;  3VYG A;  3HPW A;  2X4W A;  4M77 G;  4ZGJ B;  4GI3 C;  5HI7 A;  3CCS A;  3D00 A;  4N0A A;  2X35 A;  5CKF A;  3QO3 A;  1M8V A;  1CT4 I;  1FWZ A;  4XTV A;  1R0R I;  1KMA A;  3PNW C;  1YJW A;  1QVG A;  2PVG B;  4EMK B;  3PMT A;  5CKH A;  4M77 C;  3KBG A;  2WCY A;  2QDY B;  4C92 C;  5LJ3 e;  3L2U A;  3CPF A;  2E41 A;  1OYV I;  2E1H A;  1VQM A;  1NZ9 A;  1Y7X A;  2VYT A;  2MI6 A;  3DLL A;  3QXE B;  1M1G A;  2JN0 A;  1D3B B;  4J6X A;  3HSB A;  2GCX A;  1Y96 A;  4N4I A;  4C92 D;  4QW2 A;  5GMK m;  1VQ4 A;  1W2B S;  1VQ9 A;  3V7R A;  1K73 C;  2GFU A;  3M55 A;  1R79 A;  2DJZ A;  5CVI A;  3P8H A;  3CCQ T;  1KQS A;  3T9N A;  5GAM g;  4JDS A;  1I5L A;  1X4S A;  1U8R A;  1WQW A;  2KK4 A;  3MHX A;  4KBM B;  3MP8 A;  2A3L A;  5FU7 B;  2RM4 A;  4XU3 A;  3I56 A;  1NPR A;  3JCM g;  1CT2 I;  2CS7 A;  4UXJ A;  1QVF A;  4PNO A;  4N4G A;  4GLK A;  3C4S A;  1D3B A;  3HFN A;  1LR7 A;  2F69 A;  1KHC A;  4QVZ A;  2BUS A;  4MMK A;  4C8Q C;  3V8K A;  3QJY A;  2ZGW A;  4C8Q A;  5CCM A;  4M78 B;  4D6W A;  4JRQ A;  3OW2 S;  3CXL A;  2RK1 A;  3CPW S;  1CSO I;  2LDM A;  2GF7 A;  2RA2 A;  1X74 A;  1QP3 A;  3CCL T;  3QPH A;  3BJI A;  3OYN A;  1Q7Y U;  1LOJ A;  2EQU A;  1VIE A;  4TVR A;  3CD6 T;  2VV5 A;  1CHO I;  1BIA A;  5GAN h;  2RO0 A;  4J6W A;  4KUL A;  4C92 E;  1VQ8 A;  1SGD I;  4PJO B;  3FB9 A;  1PCE A;  5L8R E;  1KBF A;  2XRC A;  2OAU A;  4XU0 A;  2EYQ A;  4BUG A;  2LQK A;  1TH7 A;  4A4E A;  1ZHI A;  4M75 A;  2RJF A;  4C8Q B;  1TBO A;  1VDD A;  2WSE E;  5A0D A;  2QPO A;  3UEY A;  1JJ2 A;  4C0F A;  1MGQ A;  4XK8 E;  2J87 A;  5J26 A;  3PIP A;  3X26 B;  3JCM W;  2E10 A;  3A8H B;  2DEQ A;  2RJE A;  5CCA A;  1M4Z A;  3OYD A;  4UC4 A;  4F7U A;  2XDP A;  3EFS A;  3ER0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...