3GOXA

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i in the absence of edta
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
b'MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease Hpy99I
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3goxA01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3goxA02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3goxA03
2QQSA 3FDRA 2G3RA 2EFIA 5KE2A 3OYBA 2EQMA 1XNIA 3NTKA 3OB9A 1MHNA 3ASKA 2EQJA 3UWNA 5KE3A 3L2UA 3QBYA 3OA6A 1WJSA 2RJDA 3PMTA 4BDZA 3QJ6A 4NS5A 2DIQA 2RI3A 4C5IA 3H6ZA 3LLRA 2QNFA 2JZ2A 2O4XA 5FRNA 2LVMA 3QKJA 3LH0A 4PLIA 4A4FA 2GFUA 3LGLA 4QQDA 3META 2XK0A 4BACA 2R5AA 4B9WA 3OS0A 1WGSA 4IUPA 2EQKA 2RI5A 4L59A 4C5GA 3PMIA 2HQEA 4IURA 4FL6A 2CKKA 4Z02A 3OS1A 2QNCA 2X4YA 3OYEA 2P0KA 2R57A 3SD4A 4E7JA 3FC3A 4E7LA 3NTHA 3L2WA 2JTFA 3H8ZA 3MO8A 3OMCA 5KH6A 3C4SA 3MEUA 3OY9A 3OYJA 3L2QA 2GF7A 5KCOA 5FRMA 3EAEA 2BKDN 2LTOA 4QQGA 3MEWA 3S3OA 2R58A 3PNWC 4A4HA 3OS2A 3OYGA 4E7KA 4B9XA 3P8DA 2E5QA 5C0MA 3M9QA 3L42A 3F70A 3OYAA 4OVAA 2D9TA 2RHXA 3NTIA 4IUUA 4BE1A 3ME9A 2BUDA 3OYDA 5C6SA 4N4IA 3LX7A 1H3ZA 2RI2A 3FLGA 4E7IA 3MP1A 2GFAA 5M9OA 3S3NA 1G5VA 3MEVA 1EN7A 2E6NA 4EDUA 1SSFA 2M16A 2M0OA 2K3XA 4Q5WA 4RG2A 3OYKA 2O4XB 4LD6A 5J26A 3OYHA 2LDMA 3QIIA 2RHIA 2DIGA 2R5MA 4QVZA 3OMGA 5IN1A 4C5EA 3OYIA 3UT1A 2IG0A 2MWOA 3DB3A 4HCZA 4N4HA 3MEAA 3E9FA 5IAYA 3OYLA 2RJFA 3MP6A 4UC4A 5J39A 4IUTA 2L3RA 3FEOA 4IUVA 5D6YA 2RHUA 5CIUA 3OYFA 2XDPA 3KUFA 3OQ5A 5KCHA 3LYIA 1E7DA 4N4GA 2B8AA 3GOXA 3ZEHA 2QQRA 4GY5A 3S6WA 4C5HA 2EQUA 2PQWA 2FHDA 4CRIA 5FROA 4BDYA 4IUQA 1RI0A 1WJRA 2EKOA 3S3MA 1OI1A 2RHYA 3E9GA 2VYTA 3P8HA 2RJCA 2K3YA 2RO0A 2RJEA 3MP8A 4PLLA 3OYCA 4QW2A 3DLMA 2DAQA 4X34A 2F5KA 4II1A 2LRQA 3PFSA 2LCCA 1OZ3A 2YRVA 2L89A 2X35A 4PL6A 4BD3A 2NLUA 2X4XA 4BE2A 3LGFA 4E7HA 3DB4A 4BE0A 4ZTJA 3BDLA 1OZ2A 2M1HA 1N27A 2MWPA 3Q1JA 3OYMA 3O8VA 3L2VA 2RHZA 1WJQA 3CEYA 5D6WA 2BIVA 2WACA 4ZTFA 5D6XA 1E7LA 4QQ6A 4A4GA 1KHCA 3L2RA 4FU6A 2HQXA 3OYNA 2L8DA 4A4EA 2X4WA 1OYXA 4IKFA
chains in the Genus database with same CATH superfamily
1H641 2CH4A 3CPFA 2XICA 3VS4A 5GAN2 1HDLA 3G7ZA 4LDUA 1ZBXA 2P6AC 4FIBA 2MPXC 1D0ZA 1Q86U 5GAMg 4E1RA 2YUUA 4PFZA 3JCMQ 4PK4A 2I0NA 5GJVB 3EGUA 1NZ9A 2RI5A 1VYTA 2LJ1A 5GJWB 3V8KA 1JJ2P 3R6NA 3EHQA 1AHJB 2X4YA 1GRIA 1UJ0A 3CCLA 2RC4A 3FC3A 5IHKA 3JB9F 2EGAA 1UB4A 1XOVA 1QCNA 3X20B 3L2QA 4TVRA 4XTXA 1X6GA 1KC8R 2OAWA 1U06A 1K9MU 1DJ7B 2RD1A 1QKWA 2KT1A 2VUBA 3M5AA 4LUDA 2MAMA 3R5CA 1AD5A 2YUNA 4E7IA 4J9IA 3MP1A 2QQBA 4EDUA 1YU6C 2KXDA 3OYKA 1OU8A 5FU7C 1JQQA 1IHWA 4JJDA 4BI8B 4HVUA 2O9VA 1SGPI 3HRTA 1CHOI 2COYA 2OU2A 4OMFB 1UGRB 2FNFX 2E3IA 1K1ZA 2GKVA 2J6KA 3G1JA 4WTOB 1JU5C 2O01E 4KRTA 3VS6A 4IUQA 4BDYA 1UHAA 1MNEA 4C8QB 5LJ3f 4OMQA 3WVDB 1SRMA 2DRKA 1BIBA 3JCMe 3RIRA 4KGVB 3FIFA 2SGFI 1R0BG 3A8GB 3PFSA 1TSFA 2ATCB 3EGDB 3OXFA 1NM7A 3TVTA 2K4YA 4C8QE 5CQXA 3L2VA 4J9GA 2QK0A 1VQLQ 4QQ6A 1KSWA 3VUZA 1AN1I 4R56A 1R79A 4JJNK 4C92A 1YJNQ 2FRYA 2QQSA 2F5TX 3CCSA 4EMKA 3SGBI 1N8RC 3OB9A 1E6GA 1FMKA 1I1JA 1V29B 3L1AA 5CKFA 3EG1A 3VS1A 1S72A 1JXOA 4C92C 4PJOA 1K73R 4M7AA 5I2MA 4C5GA 1K7VA 3CC7A 1NJIU 1IHVA 3CD6A 1HEVA 1KFZA 1QP2A 5GAN3 2R57A 2OTJT 1IZ6A 2KMOA 1P92A 4RTVA 1Q86R 3NPFA 1VQPA 2MIOA 3FSXA 2ZAEA 5LJ5e 5I11A 3QDFA 4KULA 3CCRQ 3H0FA 1OX9A 1Y0MA 4M7AC 3OS2A 4XTZA 2RQRA 1YCYA 3D00A 3QAHA 1SHGA 3OYAA 1M1KR 4M7DC 4IUUA 1CT4I 3SHWA 1TUCA 1MMDA 1NE8A 5HY6A 3VYGA 4F16A 2DFUA 2RM4A 1VA7A 4JRIA 1M5Q1 2PVOB 1K4US 1VOMA 2K3BA 1YHQQ 2RHIA 1ZSZA 2F3CI 5FUXA 3LWIA 2A7YA 1VQ4T 3UFFA 2ENNA 1QQJA 2EJFA 3VE5A 1VYUA 3MP6A 1FMWA 1BBZA 3HP9A 3SDZA 2M02A 3V7SA 4F7UB 2DTOA 1GBQA 4J9HA 2JUFA 1O75A 4PJMA 3G6EQ 3VDUA 4RTWA 1W2BP 4QT7A 2KROA 1PTRA 3FSYA 1RI0A 1WJRA 3M0PA 2L5QA 2VYTA 2FZCB 5E3PA 2XHCA 4C92G 3AT1B 3QDRB 1KBEA 1C0MA 4B6MA 2QQDA 2EIFA 4X9DA 1YJ9A 4DOVA 2H3EB 2LRQA 4F7UE 3VYHB 2CP5A 2V26A 1VUBA 1SKUB 3M55A 4E2FB 3FJ5A 4O6JA 1N27A 1BUSA 1WHHA 2DXUA 2DX1A 2OVOA 3VS7A 3SB2A 4MMKA 2RMOA 1JO8A 2HQXA 2X4JA 2L8DA 4M7AG 5J8FA 5FW9A 1VQMT 4M78A 4M7DG 1D1AA 2CZ1B 3OXGA 1X01A 2EYYA 4M75A 4VUBA 4DEXA 1PM3A 1Q7YU 4JJBA 3QBYA 2O2OA 4DBHA 2NU0I 3C12A 1Y1CA 3UDCA 2KK4A 4C5IA 1VQ5Q 9ATCB 3AHUA 3SWNA 2H3JA 2JVVA 1MV3A 1PNJA 2QEXA 3GNFB 4XU2A 2NUPA 2XG8D 1EFNA 3OS1A 2F2WA 2DXBA 4C92F 3DKMA 5KYWB 1YITA 2YXYA 4JCVE 3TQ7P 4OMNA 2KRMA 1W4SA 2CREA 4ATOA 4NOYA 2DL8A 3NTHA 5LJ3h 3RMQA 3V8LA 2RQTA 3SWNC 2X52A 2LTOA 1T0HA 3E19A 2QG9B 3PVLA 1M90U 1RLQC 2QGGA 2CP3A 2KDPA 1D1CA 4OVOA 4CC7A 5CKHA 3CMAA 4M7AF 4XU3A 4A63B 4GBQA 2NUZA 2DRMA 2E6NA 4M7DF 2E41A 1QWFA 5JHWC 2VWFA 2B8TA 3CCQQ 2MWOA 3OYLA 4OP0A 2ZPEB 3QWPA 1KHIA 1R0RI 2L3RA 1YI2A 2RHUA 2CWHA 3LYIA 4N4GA 1KQSS 4RCCA 4GY5A 4E47A 2LZ6B 2EQUA 5EC7A 4FT4A 1YWOA 2PU9B 1Q81C 2DM1A 3I9QA 1Y1BA 4M77D 3G4SA 2CZ7B 1NUBA 3M0UA 2MOXA 4XK8E 1AOJA 2IVWA 1UVGA 3FB9A 2L89A 4M75G 1U3OA 1NG2A 1AZGB 5KYUA 1ZX6A 3CC2Q 3H41A 2CWGA 2LNHB 5GANg 1YIJA 4SGBI 3UA6A 2W0TA 1HYOA 4HCBA 2O9SA 4LN2A 2EFIA 3I55T 4AFSC 2EQMA 4YTLA 2V1CA 1OV3A 2GTJA 2Y0MA 3KFVA 3OA6A 3C94A 1S72T 4RCBA 2QQ0A 3CCMT 2ABLA 2EPDA 2EVRA 3BFMA 2EQKA 2LX7A 4E7ZA 1G3WA 1TG0A 3RKXA 3CD6T 3CCEA 3OYEA 4LDVA 5LJ3d 4E7LA 1VQPT 4OB2B 5KH6A 4OB0B 3BW1A 3OXLA 1ZBJA 1N13A 1PSEA 3KXTA 5LJ5f 2WSCE 1J3TA 1PPFI 4LNPA 3JB9H 3T9NA 1H8KA 3QJYA 3EG0A 2E5RA 3X28B 4B6DA 2ZZDA 1EN7A 1VQOA 2KVQG 3JSCA 3VDPA 2LCSA 3CC4A 2YLBA 2CP0A 2QA4T 4C0DC 1RADB 1VQ7Q 3M0QA 2FVUA 1S20A 1UJYA 2YRCA 1RAHB 3RDVA 5A0GA 2XDPA 3REBB 4PNOA 2PUKB 2DA9A 2JMAA 4EMGA 1FARA 2DJZA 3QHSA 4BI3A 3MP8A 5GAN6 1RAAB 1K9MC 4XTUA 2CZ0B 1A0NB 2M9UA 3KBGA 2YRVA 3M59A 1Y96A 4LD9K 3JAME 1VQ6T 1BMOA 2GCXA 3CEYA 3U23A 1U1SA 2L2PA 1E6HA 1N5ZA 1RI9A 1TUSA 1NEBA 4OB3B 1VQ8A 2RK2A 3VV0A 1QVGP 1MGQA 1UGVA 3GF5A 5I2SA 2DB6A 2KRSA 1M3CA 1Z7KB 3UWNA 3V8JA 1RABB 1TBQR 1QVPA 3LLRA 5FU6B 2JNGA 3J7AF 1D3BB 4N0AA 4QQDA 4IIOA 4HT8A 2R5AA 1OPLA 2KBTA 3RKWA 1YITT 2YLCA 1Q82C 2K9GA 1VQKA 4L5GA 3QYHB 4GLKA 4XQ3A 5AT1B 1WIEA 1ARKA 1Z9ZA 1ABOA 2GBQA 2OZUA 3LWHA 1N8RR 4J9CA 4A4HA 2HDAA 2YDLA 4B9XA 5DM7R 3L42A 4JRPA 3JCMh 3CMAT 4JRKA 4J9BA 4DBFA 5I22A 1XQHA 3S3NA 3EFOB 2XDDA 1MMGA 3QIIA 3CCVA 2R5MA 2E1HA 1LNXA 5CAIA 1YI2T 5GAMj 2DLPA 4RTXA 4L6V5 5D6YA 4M77C 1E7DA 4RG8A 4PJOD 4JLIA 5KYXB 3GNGA 2KAFA 2DD4A 1SSHA 1TUDA 4HCCA 2E64A 4JS5A 2DAQA 5L23A 1UGSB 4HVWA 1TTHB 3QG1A 1V1IA 1DS3I 2ROTA 3DB4A 3M57A 2RQUA 1SGEI 1V1CA 3OW2A 2IPOB 2LT1A 3UEYA 1PJUA 4V2SA 1AWWA 2JT4A 1YIJT 3L2RA 1M8BA 2AT1B 4FU6A 3TO6A 5LJ5h 3KY9A 4IKFA 2HBPA 2KXCA 2E73A 2OTJQ 1I81A 2LC4A 4HXJA 2UZ3A 1VQ9T 1MHNA 2DEQA 2EQJA 1YNZA 2ENZA 3ZBDA 4CI0C 1B34A 4D8DA 2J6FA 1W6XA 3G71T 4PJJA 5FRNA 4WP4A 4LDXA 4PFPA 5IT9E 2B86A 4BY6B 4KH0B 2QPOA 5GAN4 1BYMA 2LNVA 3MKDA 1KG1A 2O88A 2CKKA 1X6OA 2BE7D 4M77G 4F7UA 1W1FA 1W4RA 2YSQA 2QAZA 5A0DA 1VQ4Q 3I35A 2K6DA 2DPPB 3EFSA 3UPUA 2GIVA 3JCMd 2RH2A 1SGQI 2C0TA 1PTQA 3X24B 4BE1A 3UGLA 4BI4A 4A4KA 1M1KU 2BUDA 1XX6A 1VQOT 1H3ZA 2CT3A 1VQNA 2M0OA 3SEKC 4M78D 4A54A 3OW2S 4KUDK 1PKTA 1Y57A 3RMSA 3EG9B 1KD1C 3HFOA 4KBMB 4KH1B 3UT1A 1M8VA 2Z0WA 1BU1A 2GNCA 2KMQA 4M75D 1ULMA 2KCXA 5IHIA 4Y92A 2D8HA 1BIAA 4BB7A 1CE3A 2JN0A 4XTVA 5KCHA 1YJWQ 2CH4W 2FHDA 3OVOA 2CSIA 2PNIA 2NUTB 1I0CA 4DBRA 4M77F 1NPRA 1VQMQ 2NU4I 2X51A 5CO7A 1H92A 5GAOm 1CGJI 4PFOA 3X26B 1BCMA 1XBTA 3DLMA 4J6YA 3DLLA 1N6AA 3VS3A 2ED1A 2YWWA 1SPKA 2X4XA 4JUVA 3CCUA 4BE2A 4LXCA 4FYYB 1B07A 2VC8A 5KYWA 2YQPA 1OQKA 1W2BS 1HJAI 1E7LA 5LJ5d 1KHCA 2A3LA 2RB6A 1QP3A 1YN8A 1YBYA 2A37A 4FKDA 1YJNA 4FSSA 4F7UG 1I07A 1Q81R 2KNBB 5EX3A 1JRIA 4AG2C 5CVIA 1OPKA 1JEGA 1B3QA 3GIBA 2V1RA 2Y4XA 2FO0A 2HCKA 2D0QB 4XU1A 1G2BA 3GLXA 2P4RA 1FY7A 1RAEB 1P9ZA 3A8LB 1WGSA 1IXDA 3OL0A 4IURA 1RLPC 1VQKT 5CCMA 3TO7A 4Y91A 2KY9A 4RTYA 1T3SA 2EBPA 2KSSA 2GTOA 1K8AC 3OY9A 1FYNA 1YWPA 8ATCB 1CT2I 4A53A 2ODDA 1M27C 3CCRA 2EQIA 4KGXB 2D6FA 3M9QA 4OVAA 1WFWA 4HKEA 3PIPA 4XTWA 4EMKC 4FYXB 1LR9A 1U5KA 2AKLA 3HFNA 3UATA 1V1HA 4QVDA 1YHQA 4C5EA 1R8OB 2H8HA 2HL5C 2HNIA 3OYYA 2GQIA 4HCZA 2BE9B 4XAXB 3CCJA 2OTLQ 4PJOC 1HK9A 3I56T 1HD3A 4PKCC 3JRZA 3OQ5A 2V1QA 1H3HA 3GBQA 2QQEA 2HEQA 3G6EA 4C5HA 1XTDA 5A0LA 8AT1B 2LEOA 2FPFA 3PVQA 3H9NA 5LJ5g 2NU2I 3CQTA 3GPLA 2RJCA 2LQNA 1FMVA 3PGGA 3NHNA 1IB8A 3EHRA 3I55Q 4PLLA 2XDBA 5GMKi 1X43A 4ZNXA 1TWBA 1W3SA 2JZMA 2ED0A 1XA6A 4JPBW 5CKDA 3RKYA 3CCMQ 1K76A 2N1AB 2L3QA 2K5FA 4FW2A 3H0IA 2P84A 4PJNA 5IXFA 3M54A 1GXIE 1ZSZC 3JCMP 2ROLA 2PUOB 1PD1A 4AMLA 1UHCA 3TCJA 3PT9A 2CP7A 1F1BB 1OYVI 4M4ZA 1PWTA 2NYSA 2EJ9A 1KIKA 2L0AA 2ECZA 1WJSA 3QJ6A 1UG1A 5FWCA 1VQ5A 1WLPB 1GFDA 5A2QE 3CXLA 4PJOG 3VKIA 2JW4A 3PTAA 2HBWA 2KYMA 3WVEB 2KT8A 1TS9A 2CWFA 1NPPA 2K2MA 2N17A 2XKOC 2DXCA 2QA4Q 3CMEQ 1KQSA 2FYKA 5E3RA 1BI1A 4D8KA 3B4VC 2R58A 3QZ9B 2LJ0A 2E5QA 5C0MA 1SEMA 3HSBA 4LDWA 4M78C 3M4YA 2F69A 2JOYA 4N4IA 4EMHA 1VQNT 2RI2A 1Y07A 5FU7B 1G5VA 4AMCA 3A8MB 5GANj 3CCLT 2K3XA 4M75C 4QKUA 5GMKj 3X25B 2OAUA 2QI2A 3SGQI 4J8OA 1Q82R 3CCQA 4N4HA 1EIFA 1HJDA 3OBYA 2PZ1A 1MV0B 4KGZB 1WHGA 2JXDA 4IUTA 4X1VA 2LX9A 3FEOA 4OMMA 1WI7A 2VB6A 3KUFA 1OU9A 1VQ6Q 1GFCA 2QQRA 1TBOA 4PJOF 1WGTA 2W0ZA 2QTVA 1WKXA 1UGQB 4OMOA 2RHYA 1VDDA 2E65A 4UXHA 4ZN3A 2EYQA 1KC8C 4RTUA 1NBEB 2XIDA 2YRDA 1D3BA 2VXEA 3EG2A 3PE0A 2M5XA 1M2OA 3CCUT 4RUGA 5KYNA 2E4HA 4C8QD 4E7HA 1U5SA 2QTXA 4ZTJA 2RQWA 1IGUA 3CC2A 4HGUA 1LR8A 4RMOA 2XD0A 2WSFE 3JCMc 2DBKA 3HL8A 2G3RA 1AWXA 3OYBA 4M78G 3A8HB 2HQHA 2JTEA 1RAIB 2A20A 3UEJA 2FEIA 4FYVB 4C92B 1CKAA 2CP2A 3JCMf 3HTRA 2GKTI 4UXIA 1D1BA 3EFOA 2DILA 5HQ8A 3LH0A 1AZEA 1QVFS 4AFUC 1H0ZA 2ZCFB 3META 2JM9A 4J6WA 1X74A 1NLPC 4OGEA 2UVOA 4XTYA 3CCST 1QVGS 2AIRB 1G83A 2P0KA 5D7UA 4C92E 1Z2IA 5KYYA 2ZGWA 4M7AB 2RNAA 1WXTA 3MEUA 3VUBA 5GANe 5GMKe 1YI2Q 2HSPA 4M7DB 3MCAB 4ELYC 1G3YA 2BKDN 1CGII 2L3PA 1N8RU 3P8DA 2J9RA 3F70A 2V8JA 3CC7T 4KUIA 2NU3I 1NEGA 3CPWS 2MK5A 2VV5A 2V1CC 4RG2A 2Y4YA 4M78F 3CBPA 2QXFA 3TU4K 1YHQT 1WYXA 2LDMA 3CCJT 4M7DE 1VQ7A 5GAOn 1M4ZA 5IAYA 4M75F 1IGQA 3CXCA 2RJFA 1K73C 1X4SA 3M58A 2B8AA 2ZPFB 1NYGA 2J06A 1MMNA 2PQWA 1YIJQ 1Q86C 1P9GA 2K3YA 4O5VA 5HK3A 3JB9J 1VQ9Q 1BI2A 1C1AA 1ZQ1A 3G71Q 1KD1R 1OZ2A 2M1HA 4K11A 4ME7A 3O8VA 2RHZA 2NU1I 4C0GA 1LPLA 1DS2I 1M3BA 1NLOC 4DOWA 3TOBA 1LCKA 1QMCA 1OYXA 2EW3A 4AT1B 1YJ9T 4MZMA 2O31A 2QQAA 2VKNA 3MJXA 2DEUA 5DAEA 3UGIA 1OULA 5LL6S 3UOEA 2L3SA 1ABQA 1PZWA 1KQSP 2JZ2A 2LVMA 2CYZB 4A4FA 1OOTA 4D6WA 4ZGEB 3THKA 4DA4A 3CXCS 3QXEB 4FL6A 4Z02A 3QYGB 1UUEA 3SWNB 4HCKA 3SD4A 3ER0A 5LJ3g 1ULKA 4EPCA 2FRWA 1WZOA 3N5BB 4OB1B 1RACB 1X75C 1Z9QA 7WGAA 1IRXA 2QEXT 2KEAA 4FT2A 1NYFA 2LMJA 3J81E 1PRMC 2F2XA 3P8BB 5M9OA 1M9SA 2O4XB 2CUBA 4LD6A 3O5ZA 4AFQC 3R6OA 5CCAA 3OMGA 4J7FA 2HD0A 3DB3A 3E9FA 3VRYA 4UC4A 5CK9A 4C8QA 4N0AC 1ZA1B 3OYFA 3BJIA 2DMOA 2DL4A 3LW5E 4MMLA 3S6WA 3NGPA 4CRIA 1E7OA 2VASA 5FUYA 3EGDA 2DD5A 1JJ2S 3M53A 1GCPA 3QWYA 5ECAA 4C8QC 2RQVA 5EX0A 2C0OA 4C0ZA 2EGCA 1NJIC 1C6VX 1AEYA 4J9DA 2EAYA 2E12A 5FUWA 1WJQA 3FJPA 3MPUB 4GI3C 2K5IA 5GAOq 3SFMA 3HH2C 2EYWA 3G4ST 1VQKQ 4HA8A 1PCXA 1M30A 5FWBA 2HMAA 1WXBA 1B7TA 4MDWA 3MHXA 2KRNA 1SGDI 1QCOA 2OTJA 1JXMA 1Q81U 2WVJA 1TUGB 2RPNA 2WSEE 1GL5A 3EH2A 3PMTA 1PHTA 2A0FB 3TSZA 4E6RA 2AZVA 1HPTA 2LUYA 2A36A 2CT4A 3LGLA 2XRCA 1TGSI 4L9MA 1TH7A 2ZPIB 2CP6A 2COZA 4EIKA 2ARPF 1UGPB 2DKVA 3C4SA 1VQ4A 1JBMA 2LT4A 2DETA 2V8KA 2BTTA 4C8QG 3I56Q 5GANf 4E7KA 1ZUKA 2FZKB 4ELZC 2PVGB 1SHFA 1TURA 4DNCA 5C6SA 4Y28E 4C0DB 3CCET 4Z89A 3OYHA 1M2VB 4QVZA 1W2BA 4JJCA 4ORZA 2J6OA 2K57A 2K5LA 5J3BA 1MT1A 2ZPGB 1YJWA 2JTMA 5FROA 5GAMe 2DNUA 1Q7YC 3VS5A 3CC4T 2RO0A 1UTIA 1VQMA 4CC4B 2FG0A 1RUWA 1G8XA 4X34A 5DLOA 3JCMW 2LCCA 4NL3A 4BD3A 4C8QF 2B0UC 1VIFA 4FM4B 4FYWB 1T0JA 3OSVA 1EZZB 5J8CA 3R5BA 2KYBA 3RR6A 5CKEA 4ZTFA 2SGEI 2J7IA 1IO6A 4WF2A 2DL7A 1Y96B 4OGCA 3BDUA 5I21A 1M90C 1IY6A 4LDYA 3E59A 4RTZA 1OMTA 4CC3A 4BDZA 2D1XA 3BE3A 2AHJB 1PG5B 2DIQA 2RN8A 4IIMA 2X3XD 2GQVA 2AZSA 2DL3A 2GFUA 3M0RA 1TU0B 3SEMA 3OS0A 1VQ8T 2YHTA 1WHJA 4IUPA 4L59A 1VQNQ 1VQLA 3PMIA 2WGCA 2KGTA 4NL2A 1FWZA 1N9RA 3CCLQ 5LJ5j 4E7JA 3A98A 2E10A 2JJ9A 2M51A 3A1PA 1TBRR 3QWXX 2DVEA 2BZXA 2W10A 3RNJA 5GAOl 2DTHA 1RAGB 3S3OA 1JB0E 1X69A 4DBQA 1GCQA 3EFRA 3JCMg 1I5LA 2GFAA 1WDXA 1SSFA 2OD1A 1IW4A 1UECA 2QGFB 4JRQA 2IG0A 5DLQE 2ERWA 3CCUQ 2SRCA 1X6BA 4M77B 1GCQC 2OTLA 1Q82U 2LQWA 2XMFA 2EKHA 1N9SA 4ESRA 2QQCA 4E1PA 2KE9A 1X27A 3GOXA 2CGHA 2V8IA 2M0YA 3I5SA 3QSUA 1WTJA 2DYBA 2E6ZA 4F7UF 3CCVT 4M77E 4JS4A 3I55A 1MJBA 3REAB 4F04B 4II1A 1M1FA 2FZGB 4JZ3A 1BB9A 4PL6A 2ENMA 2SGQI 3CCMA 2LCLA 3Q1JA 2PQ8A 5GAOr 3EGXB 4J6XA 2P0PA 5GANh 5GMKh 4M7DA 4MPIA 1CKBA 3CCSQ 4J9FA 3QO3A 4DEYA 3OW2P 5IXBA 4J5YA 3NTKA 3HHTB 3V7RA 1BK2A 4Z8AA 2MMPA 2WCYA 2DJQA 2VXFA 3NMZC 4ZN1A 2RJDA 1S72Q 1SG5A 1HXDA 2QNFA 3WXMB 1CSOI 4PLIA 1BCOA 1AVZC 1RAFB 3M0TA 2KMRA 2KMTA 4BACA 3CC7Q 1B34B 2JXBA 2Y90A 1OX8A 3CD6Q 2P4TA 5IH2A 1I5OB 2HKQB 2LP5A 2MCNA 2MYSA 2VRWB 3CCJQ 2QA4A 3L2WA 3CMEA 2JTFA 1VQPQ 5KCOA 1RL2A 2JW6A 1K9MR 3PDNA 3UGDA 1ZA2B 1MJ9A 4FSXA 2EYZA 2J87A 2LQ8A 1UDLA 2F1LA 3CBMA 3ME9A 1M3AA 2BZYA 2C0IA 5HK0A 5GAOp 5FUVA 2X3TA 4Q5WA 2DYIA 2VGMA 5J26A 1G3SA 1SGRI 1TIHA 5IN1A 2CUDA 2FPEA 1QW1A 1TBNA 2RIJA 1GBRA 1YJWT 1VQ6A 5AYFA 3TSWA 1G3TA 5DY9A 3QTLD 1WA7A 2QYZA 2EKOA 2RK1A 1OI1A 3UA7A 1O9SA 2DL5A 2L8EA 1UFFA 2RJEA 5GAMf 3JCMb 1M1GA 3VU3C 1FXXA 5GMKm 1YJ9Q 4QW2A 1U8RA 1QVFA 2JYYA 1XJWB 3LGFA 2JM8A 4BE0A 1QVGA 3VJPA 1KD1U 5D6WA 2WACA 5GANd 1RFHA 4Z88A 2PVDB 1VIEA 2I2LA 1FX7A 2JMCA 4J83A 3HRSA 2QDYB 3E2IA 1TOVA 2MF2A 1LR7A 5GMKl 4OMPA 5KE3A 3L2UA 1QWEA 3OS5A 2XI9A 4X9CA 4NS5A 3ZFJA 3CPWA 2O4XA 1UUCA 2JA1A 3QKJA 2QEXQ 3JCMX 5CKBA 1MJAA 1VQLT 5FU6C 3VS2A 1NJIR 1IY5A 5CR2A 1LOJA 1YJNT 3ZL7C 1YITQ 4MDXA 1LJOA 2DBMA 1WQ7A 1I8FA 3JB9D 3QZ5B 1ZLMA 5HKCA 3QPHA 2ROWA 1BI0A 2BZ8A 3EAEA 4QQGA 1CSKA 5IHNA 3PNWC 5CQYA 3OYGA 1D0YA 4EMKB 2KR3A 1I4K1 1QCFA 2RHXA 3NTIA 4ZGJB 2N52A 3CMAQ 1YP5A 1KQ2A 1BI3A 3JB9I 2A08A 3FRNA 3HKSA 1IREB 1S1NA 1WNLA 2LB7A 4PJOB 1R77A 2DIGA 1KQ1A 4LUEA 2OTLT 2FPDA 3MEAA 5KYXA 5J39A 3CCRT 3PIOA 2COWA 2L7XA 5CIUA 3CBOA 4JDSA 1VYVA 1K8AU 5EG2A 2DF6A 3G4SQ 4PJOE 1UEBA 2KQWA 2PTKA 3RUXA 2OI3A 4M7AE 1PRLC 2BUSA 1OMUA 2F5KA 4HVVA 1VQ9A 3NFCA 1BKBA 3BY7A 2QQ9A 5LJ3j 3ULRB 3VRZA 1U1TA 2YUPA 3M56A 3M4GA 3G71A 3G6ET 4C0FA 7AT1B 1ZSZB 2BIVA 2DTIA 5D6XA 4HT9A 3OSSC 2E5KA 3INZA 1WHLA 1EX4A 2CDTA 2X9HA 2SEMA 2EYXA 3C95A 1T3LA 3RBBB 2DO3A 4R0KA 1XNIA 4MZPA 4QVCA 1Q7YR 2HSEB 2YT6A 1X2KA 3ASKA 2SGDI 3RU0A 1HSQA 2EWNA 3J80E 1M1KC 2MI6A 1K0XA 2ESWA 2J05A 3HRUA 4KT0E 4LE9A 1WHKA 4GLMA 4J7IA 2K9HA 3TEEA 3H6ZA 2OJ2A 2ELIA 1M2VA 1PCEA 2K7AA 1NXUA 1KJWA 2QDLA 3A8OB 4CC2A 2CSQA 3CCEQ 4BY6C 4FCYA 3IQLA 2X3WD 3H0HA 3RERA 1WQWA 3CMET 2DK3A 2AK5A 1AWJA 2N71A 1SRLA 5GAMh 4AG1C 3TOAA 1M90R 2GF7A 2RA2A 5FRMA 1W70A 3MEWA 2DXTA 4M78B 5FLXE 1VQ5T 2K79A 1JJ2A 1TXQA 3RESA 1ZUUA 3EH1A 3E1SA 3EG9A 3M0SA 1OVOA 1Y8FA 2VGNA 4M75B 3OYDA 1WGCA 2EJGA 3LX7A 1VQOQ 4RKUE 3CC4Q 2HL3A 2VVKA 1K9AA 1Y71A 1SF9A 1QKXA 4F17A 5HCKA 3TO9A 2JS0A 6AT1B 4R55A 4XU0A 4M78E 2NUPB 2NUTA 3V7CA 1ACMB 4WCIA 2HAXA 2ORVA 3UF4A 4IUVA 3URGA 3D7SB 1QVFP 3R5DA 4M75E 1ULNA 3ZEHA 4AFZC 5LJ3e 5L8RE 5HI7A 1Q9BA 3TJQA 3P8HA 1MUZA 5GAN8 2GGRA 1UE9A 2RF0A 1FYBA 1UVFA 4MZTA 2A28A 1MNDA 2HZYA 1LVKA 3CCQT 3EG3A 1SGYI 2X35A 4P5NA 2NLUA 1M8MA 1TOTA 3JCMJ 4JZ4A 3BDLA 4A24A 4DQ2A 3OYMA 1K8AR 2K2VA 1K0SA 1SGNI 4A4GA 1VQ8Q 3OYNA 1PC0A 3CPWP 1Q95G 4F14A 3HPWA 1K7UA 3FDRA 5KE2A 2EGEA 4OMLA 1PKSA 1CT0I 2DIPA 3C0CA 2E3HA 3VS0A 3I5RA 3TREA 3GP8A 1KC8U 2RI3A 1WPYA 2KDSA 1D0XA 3CC2T 1Y7XA 1ZHIA 2XK0A 2CJSC 2YUOA 4B9WA 1YCSB 4M77A 4BUGA 2HQEA 4RTTA 2QNCA 2D8JA 4C92D 1OEBA 2DZ9A 5KYUB 2HKNA 1M8CA 5GAMd 2XU8A 2DZCA 3H8ZA 3L2ZA 3MO8A 3OMCA 5CCLA 1WXUA 2FB7A 3OYJA 1PD0A 2V53A 2CZ6B 3MEKA 1KK7A 2E70A 3I56A 3E2UA 2IIMA 5GAN7 5KYYB 2GVIA 2D9TA 4UXJA 1D09B 4M7AD 2N1UA 3FLGA 1WX6A 4J9EA 4ANJA 3MEVA 3LH5A 2F2VA 2M16A 4M7DD 3OBWA 3CCVQ 1R0CB 2P0QA 2DE0X 3EGXA 3OYIA 1YTPA 1KBFA 1X2QA 2JS2A 2DVJA 1AT1B 4FW1A 2KMPA 3JV3A 1FAQA 1UHFA 3JCMV 2CS7A 2OX7A 1QLYA 2DKGA 1V76A 1K7TA 3CXCP 3R5AA 2AKKA 2G6FX 3S3MA 1PSFA 1ZSGA 3E9GA 2DERA 2ZPBB 2YUQA 2FL7A 2C06A 4OF1A 1YFNA 4ZGDB 2D0NA 3OYCA 1KMAA 1AWOA 4PJLA 2QASA 2LJ3A 1VQ7T 3QUIA 3JB9G 1OZ3A 5E3QA 2ZPHB 4JLGA 1ZUYA 9WGAA 2MWPA 5GAN5 1WHMA 3A5ZB 2SGPI 1MMAA 2GKRI 1K73U 2LQKA 4E7SA 4A4EA 2NWMA 2ORWA 2X4WA 2KI7A
chains in the Genus database with same CATH topology
1H641 3CPFA 2XICA 5GAN2 1HDLA 3G7ZA 4LDUA 1ZBXA 2P6AC 4FIBA 1Q86U 5GAMg 4E1RA 2YUUA 3JCMQ 1NZ9A 2RI5A 3V8KA 1AHJB 2X4YA 3CCLA 3FC3A 3JB9F 1UB4A 1XOVA 3X20B 3L2QA 4TVRA 4XTXA 1K9MU 1DJ7B 2RD1A 2VUBA 3M5AA 2MAMA 4E7IA 3MP1A 2QQBA 4EDUA 3OYKA 5FU7C 4BI8B 1SGPI 3HRTA 1CHOI 4OMFB 1UGRB 2FNFX 2GKVA 1YU6C 2O01E 4BDYA 4IUQA 4C8QB 5LJ3f 3WVDB 1BIBA 3JCMe 3RIRA 3FIFA 2SGFI 3A8GB 3PFSA 3OXFA 2K4YA 4C8QE 5CQXA 3L2VA 4QQ6A 3VUZA 1AN1I 4R56A 1R79A 4JJNK 4C92A 2QQSA 2F5TX 3CCSA 4EMKA 3SGBI 1N8RC 3OB9A 1V29B 3L1AA 5CKFA 1S72A 4C92C 4PJOA 4M7AA 5I2MA 4C5GA 3CC7A 1NJIU 3CD6A 1QP2A 5GAN3 2R57A 2OTJT 1IZ6A 2KMOA 1P92A 1VQPA 5LJ5e 4KULA 4M7AC 3OS2A 4XTZA 1YCYA 3D00A 4M7DC 3OYAA 4IUUA 1CT4I 1NE8A 3VYGA 5HY6A 2RM4A 4JRIA 1M5Q1 2PVOB 2RHIA 2F3CI 5FUXA 3LWIA 2A7YA 1VQ4T 3UFFA 2ENNA 2EJFA 3VE5A 3MP6A 3HP9A 3SDZA 3V7SA 4F7UB 2DTOA 2JUFA 1O75A 3VDUA 1PTRA 1RI0A 1WJRA 2L5QA 2VYTA 2XHCA 4C92G 3QDRB 1KBEA 2QQDA 2EIFA 4X9DA 1YJ9A 4DOVA 2LRQA 4F7UE 3VYHB 1VUBA 3M55A 4O6JA 1N27A 1BUSA 2DXUA 2OVOA 3SB2A 4MMKA 2HQXA 2X4JA 2L8DA 4M7AG 1VQMT 4M78A 4M7DG 2CZ1B 3OXGA 1X01A 4M75A 4VUBA 1Q7YU 3QBYA 2NU0I 3C12A 1Y1CA 3UDCA 2KK4A 4C5IA 3AHUA 3SWNA 2H3JA 2JVVA 2QEXA 3GNFB 4XU2A 2XG8D 3OS1A 2DXBA 4C92F 3DKMA 1YITA 4JCVE 1W4SA 4ATOA 4NOYA 3NTHA 5LJ3h 3RMQA 3V8LA 3SWNC 2LTOA 3E19A 1M90U 4OVOA 5CKHA 3CMAA 4M7AF 4XU3A 2E6NA 4M7DF 2E41A 5JHWC 2B8TA 2MWOA 3OYLA 4OP0A 2ZPEB 3QWPA 1KHIA 1R0RI 2L3RA 1YI2A 2RHUA 3LYIA 4N4GA 1KQSS 4RCCA 4GY5A 4E47A 2EQUA 4FT4A 2PU9B 1Q81C 1Y1BA 4M77D 3G4SA 2CZ7B 1NUBA 4XK8E 2IVWA 1UVGA 3FB9A 2L89A 4M75G 5GANg 1YIJA 4SGBI 2W0TA 4HCBA 2EFIA 3I55T 2EQMA 4YTLA 2V1CA 3OA6A 3C94A 1S72T 4RCBA 2QQ0A 3CCMT 3BFMA 2EQKA 1G3WA 3RKXA 3CD6T 3CCEA 3OYEA 4LDVA 5LJ3d 4E7LA 1VQPT 4OB2B 5KH6A 4OB0B 3BW1A 3OXLA 1N13A 1PSEA 3KXTA 5LJ5f 2WSCE 1PPFI 3JB9H 3T9NA 3QJYA 2E5RA 3X28B 4B6DA 2ZZDA 1EN7A 1VQOA 2KVQG 3JSCA 3VDPA 3CC4A 2YLBA 2QA4T 4C0DC 2FVUA 5A0GA 2XDPA 4PNOA 2PUKB 4EMGA 1FARA 2DJZA 3QHSA 4BI3A 3MP8A 5GAN6 1K9MC 4XTUA 2CZ0B 2M9UA 3KBGA 2YRVA 3M59A 1Y96A 4LD9K 3JAME 1VQ6T 1BMOA 2GCXA 3CEYA 1U1SA 1TUSA 4OB3B 1VQ8A 2RK2A 3VV0A 1MGQA 3GF5A 5I2SA 2DB6A 1Z7KB 3UWNA 3V8JA 1TBQR 1QVPA 3LLRA 5FU6B 2JNGA 3J7AF 1D3BB 4N0AA 4QQDA 4HT8A 2R5AA 3RKWA 1YITT 2YLCA 1Q82C 1VQKA 4L5GA 3QYHB 4GLKA 4XQ3A 3LWHA 4A4HA 4B9XA 5DM7R 3L42A 4JRPA 3JCMh 3CMAT 4JRKA 1XQHA 3S3NA 2XDDA 3QIIA 3CCVA 2R5MA 2E1HA 1LNXA 5CAIA 1YI2T 5GAMj 5D6YA 4L6V5 4M77C 1E7DA 4RG8A 4PJOD 4JLIA 3GNGA 2KAFA 2DD4A 4HCCA 2E64A 4JS5A 2DAQA 1UGSB 3QG1A 1V1IA 1DS3I 3DB4A 3M57A 1SGEI 3OW2A 2LT1A 3UEYA 1PJUA 4V2SA 1YIJT 3L2RA 1M8BA 4FU6A 5LJ5h 3KY9A 4IKFA 2HBPA 2E73A 1I81A 2LC4A 2UZ3A 1VQ9T 1MHNA 2DEQA 2EQJA 2ENZA 3ZBDA 4CI0C 1B34A 3G71T 5FRNA 4LDXA 5IT9E 4BY6B 2QPOA 5GAN4 1BYMA 2LNVA 1KG1A 2CKKA 1X6OA 4M77G 4F7UA 1W4RA 5A0DA 2DPPB 3EFSA 3UPUA 3JCMd 2RH2A 1SGQI 1PTQA 3X24B 4BE1A 3UGLA 4BI4A 4A4KA 1M1KU 2BUDA 1XX6A 1VQOT 1H3ZA 1VQNA 2M0OA 3SEKC 4M78D 4A54A 3OW2S 4KUDK 3RMSA 1KD1C 3HFOA 4KBMB 3UT1A 1M8VA 2KMQA 4M75D 2KCXA 1BIAA 4BB7A 1CE3A 2JN0A 4XTVA 5KCHA 2FHDA 3OVOA 4M77F 1NPRA 2NU4I 5CO7A 5GAOm 1CGJI 3X26B 1XBTA 3DLMA 4J6YA 3DLLA 1N6AA 2X4XA 4JUVA 3CCUA 4BE2A 2YQPA 2VC8A 1W2BS 1HJAI 1E7LA 5LJ5d 1KHCA 2A3LA 2RB6A 1QP3A 1YBYA 4FKDA 1YJNA 4F7UG 5EX3A 1JRIA 5CVIA 3GIBA 2Y4XA 2D0QB 4XU1A 3GLXA 3A8LB 1WGSA 3OL0A 4IURA 1VQKT 5CCMA 4Y91A 2KY9A 2KSSA 1K8AC 3OY9A 1CT2I 4A53A 2ODDA 3CCRA 2D6FA 3M9QA 4OVAA 3PIPA 4HKEA 4XTWA 4EMKC 1LR9A 1U5KA 3HFNA 1V1HA 4QVDA 1YHQA 4C5EA 1R8OB 3OYYA 2HNIA 4HCZA 4XAXB 3CCJA 4PJOC 1HK9A 3I56T 4PKCC 3JRZA 3OQ5A 2QQEA 3G6EA 4C5HA 1XTDA 5A0LA 2LEOA 5LJ5g 2NU2I 3GPLA 2RJCA 3PGGA 4PLLA 2XDBA 5GMKi 1W3SA 2JZMA 1XA6A 5CKDA 3RKYA 2N1AB 2K5FA 3M54A 1GXIE 3JCMP 2PUOB 3TCJA 3PT9A 1OYVI 2EJ9A 1WJSA 3QJ6A 1VQ5A 5A2QE 3CXLA 4PJOG 3VKIA 3PTAA 3WVEB 1NPPA 2N17A 2XKOC 2DXCA 1KQSA 2FYKA 1BI1A 3B4VC 2R58A 3QZ9B 2E5QA 5C0MA 3HSBA 4LDWA 4M78C 3M4YA 2F69A 2JOYA 4N4IA 4EMHA 1VQNT 2RI2A 1Y07A 5FU7B 1G5VA 3A8MB 5GANj 3CCLT 2K3XA 4M75C 5GMKj 3X25B 2OAUA 2QI2A 3SGQI 4J8OA 3CCQA 4N4HA 1EIFA 3OBYA 2JXDA 4IUTA 2LX9A 3FEOA 3KUFA 2QQRA 1TBOA 4PJOF 1UGQB 2RHYA 1VDDA 2E65A 4UXHA 4ZN3A 2EYQA 1KC8C 2XIDA 1D3BA 2VXEA 2M5XA 3CCUT 4C8QD 4E7HA 2QTXA 4ZTJA 3CC2A 4HGUA 1LR8A 4RMOA 2XD0A 2WSFE 3JCMc 3HL8A 2G3RA 3OYBA 4M78G 3A8HB 2A20A 3UEJA 4C92B 3JCMf 2GKTI 4UXIA 5HQ8A 3LH0A 1QVFS 1H0ZA 2ZCFB 3META 4J6WA 1X74A 4OGEA 4XTYA 3CCST 1QVGS 2P0KA 4C92E 2ZGWA 4M7AB 3MEUA 3VUBA 5GANe 5GMKe 4M7DB 3MCAB 4ELYC 1G3YA 2BKDN 1CGII 1N8RU 3P8DA 2J9RA 3F70A 2V8JA 3CC7T 4KUIA 2NU3I 3CPWS 2VV5A 2V1CC 4RG2A 2Y4YA 4M78F 3CBPA 2QXFA 3TU4K 1YHQT 2LDMA 3CCJT 4M7DE 1VQ7A 5GAOn 1M4ZA 5IAYA 4M75F 3CXCA 1K73C 2RJFA 1X4SA 3M58A 2B8AA 2ZPFB 2PQWA 1Q86C 2K3YA 4O5VA 5HK3A 3JB9J 1BI2A 1ZQ1A 1OZ2A 2M1HA 4ME7A 3O8VA 2RHZA 2NU1I 4C0GA 1DS2I 4DOWA 1OYXA 1YJ9T 4MZMA 2QQAA 5DAEA 3UGIA 5LL6S 2JZ2A 2LVMA 2CYZB 4A4FA 4D6WA 4ZGEB 4DA4A 3CXCS 3QXEB 4FL6A 4Z02A 3QYGB 3SWNB 3SD4A 3ER0A 5LJ3g 4EPCA 3N5BB 4OB1B 1X75C 2QEXT 4FT2A 3J81E 3P8BB 5M9OA 1M9SA 2O4XB 4LD6A 5CCAA 3R6OA 3OMGA 4J7FA 2HD0A 3DB3A 3E9FA 4UC4A 5CK9A 4C8QA 4N0AC 3OYFA 3BJIA 3LW5E 4MMLA 3S6WA 4CRIA 5FUYA 2DD5A 1JJ2S 3M53A 4C8QC 5EX0A 4C0ZA 1NJIC 2EAYA 2E12A 5FUWA 1WJQA 3FJPA 4GI3C 2K5IA 5GAOq 3SFMA 3HH2C 3G4ST 4HA8A 4MDWA 3MHXA 1SGDI 2OTJA 1Q81U 2WVJA 2WSEE 3PMTA 1HPTA 2LUYA 3LGLA 2XRCA 1TGSI 4L9MA 1TH7A 2ZPIB 2ARPF 1UGPB 3C4SA 1VQ4A 1JBMA 2LT4A 2V8KA 4C8QG 5GANf 4E7KA 4ELZC 2PVGB 1TURA 5C6SA 4Y28E 4C0DB 3CCET 3OYHA 4QVZA 1W2BA 2K57A 2K5LA 5J3BA 1MT1A 2ZPGB 1YJWA 2JTMA 5FROA 5GAMe 1Q7YC 3CC4T 2RO0A 1VQMA 4X34A 5DLOA 3JCMW 2LCCA 4NL3A 4BD3A 4C8QF 2B0UC 1VIFA 4FM4B 3OSVA 5CKEA 4ZTFA 2SGEI 4WF2A 1Y96B 4OGCA 3BDUA 5I21A 1M90C 1IY6A 4LDYA 3E59A 1OMTA 4BDZA 2AHJB 2DIQA 2GQVA 2GFUA 3OS0A 1VQ8T 2YHTA 4IUPA 4L59A 1VQLA 3PMIA 4NL2A 1FWZA 1N9RA 5LJ5j 4E7JA 2E10A 1TBRR 2DVEA 5GAOl 2DTHA 3S3OA 1JB0E 3EFRA 3JCMg 1I5LA 2GFAA 1SSFA 2OD1A 1IW4A 4JRQA 2IG0A 5DLQE 2ERWA 4M77B 2OTLA 1Q82U 1N9SA 2QQCA 4E1PA 3GOXA 2CGHA 2V8IA 3QSUA 2E6ZA 4F7UF 3CCVT 4M77E 4JS4A 3I55A 4II1A 1M1FA 4PL6A 2SGQI 3CCMA 2LCLA 3Q1JA 5GAOr 4J6XA 2P0PA 5GANh 5GMKh 4M7DA 3QO3A 4J5YA 3NTKA 3HHTB 3V7RA 2MMPA 2WCYA 2VXFA 4ZN1A 2RJDA 1HXDA 2QNFA 3WXMB 1CSOI 4PLIA 2KMRA 2KMTA 4BACA 1B34B 2Y90A 2P4TA 2VRWB 2QA4A 3L2WA 3CMEA 2JTFA 5KCOA 1RL2A 2JW6A 3PDNA 3UGDA 4FSXA 2J87A 2LQ8A 3CBMA 3ME9A 5HK0A 5GAOp 5FUVA 4Q5WA 2VGMA 5J26A 1G3SA 1SGRI 1TIHA 5IN1A 1QW1A 1TBNA 1YJWT 1VQ6A 5AYFA 1G3TA 5DY9A 3QTLD 2EKOA 2RK1A 1OI1A 1O9SA 2L8EA 2RJEA 5GAMf 3JCMb 1M1GA 3VU3C 1FXXA 5GMKm 4QW2A 1U8RA 1QVFA 2JYYA 3LGFA 4BE0A 1QVGA 3VJPA 1KD1U 5D6WA 2WACA 5GANd 1RFHA 2PVDB 2I2LA 1VIEA 1FX7A 4J83A 3HRSA 2QDYB 3E2IA 2MF2A 1LR7A 5GMKl 5KE3A 3L2UA 3OS5A 2XI9A 4X9CA 4NS5A 3ZFJA 3CPWA 2O4XA 1UUCA 2JA1A 3QKJA 3JCMX 5CKBA 1VQLT 5FU6C 1IY5A 5CR2A 1LOJA 1YJNT 4MDXA 1LJOA 1WQ7A 1I8FA 3JB9D 3QZ5B 5HKCA 3QPHA 2ROWA 1BI0A 3EAEA 4QQGA 3PNWC 5CQYA 3OYGA 4EMKB 1I4K1 2RHXA 3NTIA 4ZGJB 2N52A 1KQ2A 1BI3A 3JB9I 3FRNA 3HKSA 1IREB 1WNLA 4PJOB 2DIGA 1KQ1A 2OTLT 3MEAA 5J39A 3CCRT 3PIOA 2L7XA 5CIUA 3CBOA 4JDSA 1K8AU 5EG2A 4PJOE 1UEBA 2KQWA 3RUXA 4M7AE 2BUSA 1OMUA 2F5KA 1VQ9A 3NFCA 1BKBA 3BY7A 2QQ9A 5LJ3j 1U1TA 3M56A 3M4GA 3G71A 3G6ET 4C0FA 2BIVA 2DTIA 5D6XA 4HT9A 3OSSC 3INZA 3C95A 2DO3A 1XNIA 4MZPA 4QVCA 3ASKA 2SGDI 3RU0A 2EWNA 3J80E 1M1KC 2MI6A 3HRUA 4KT0E 4J7IA 2K9HA 3TEEA 3H6ZA 2ELIA 1PCEA 3A8OB 4BY6C 3RERA 1WQWA 3CMET 2DK3A 2N71A 5GAMh 2GF7A 2RA2A 5FRMA 3MEWA 2DXTA 4M78B 5FLXE 1VQ5T 1JJ2A 3RESA 3E1SA 1OVOA 1Y8FA 2VGNA 4M75B 3OYDA 2EJGA 3LX7A 4RKUE 1Y71A 4R55A 4XU0A 4M78E 3V7CA 2HAXA 2ORVA 4IUVA 3URGA 4M75E 3ZEHA 5LJ3e 5L8RE 5HI7A 3TJQA 3P8HA 5GAN8 1FYBA 1UVFA 4MZTA 3CCQT 1SGYI 2X35A 4P5NA 2NLUA 1TOTA 3JCMJ 3BDLA 4A24A 4DQ2A 3OYMA 2K2VA 1SGNI 4A4GA 3OYNA 3HPWA 3FDRA 5KE2A 1CT0I 2DIPA 3TREA 3GP8A 1KC8U 2RI3A 1WPYA 2KDSA 3CC2T 1Y7XA 1ZHIA 2XK0A 2CJSC 4B9WA 4M77A 4BUGA 2HQEA 2QNCA 4C92D 2DZ9A 1M8CA 5GAMd 2XU8A 2DZCA 3H8ZA 3L2ZA 3MO8A 3OMCA 5CCLA 2FB7A 3OYJA 2V53A 2CZ6B 3MEKA 2E70A 3I56A 5GAN7 2GVIA 2D9TA 4UXJA 4M7AD 3FLGA 3MEVA 2M16A 4M7DD 3OBWA 2P0QA 3OYIA 1YTPA 1KBFA 2KMPA 1FAQA 3JCMV 2CS7A 2DKGA 3S3MA 1PSFA 3E9GA 2ZPBB 2FL7A 2C06A 4OF1A 4ZGDB 3OYCA 1KMAA 1VQ7T 3QUIA 3JB9G 1OZ3A 2ZPHB 4JLGA 2MWPA 5GAN5 3A5ZB 2SGPI 2GKRI 1K73U 2LQKA 4A4EA 2ORWA 2X4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQS A;  3FDR A;  2G3R A;  2EFI A;  5KE2 A;  3OYB A;  2EQM A;  1XNI A;  3NTK A;  3OB9 A;  1MHN A;  3ASK A;  2EQJ A;  3UWN A;  5KE3 A;  3L2U A;  3QBY A;  3OA6 A;  1WJS A;  2RJD A;  3PMT A;  4BDZ A;  3QJ6 A;  4NS5 A;  2DIQ A;  2RI3 A;  4C5I A;  3H6Z A;  3LLR A;  2QNF A;  2JZ2 A;  2O4X A;  5FRN A;  2LVM A;  3QKJ A;  3LH0 A;  4PLI A;  4A4F A;  2GFU A;  3LGL A;  4QQD A;  3MET A;  2XK0 A;  4BAC A;  2R5A A;  4B9W A;  3OS0 A;  1WGS A;  4IUP A;  2EQK A;  2RI5 A;  4L59 A;  4C5G A;  3PMI A;  2HQE A;  4IUR A;  4FL6 A;  2CKK A;  4Z02 A;  3OS1 A;  2QNC A;  2X4Y A;  3OYE A;  2P0K A;  2R57 A;  3SD4 A;  4E7J A;  3FC3 A;  4E7L A;  3NTH A;  3L2W A;  2JTF A;  3H8Z A;  3MO8 A;  3OMC A;  5KH6 A;  3C4S A;  3MEU A;  3OY9 A;  3OYJ A;  3L2Q A;  2GF7 A;  5KCO A;  5FRM A;  3EAE A;  2BKD N;  2LTO A;  4QQG A;  3MEW A;  3S3O A;  2R58 A;  3PNW C;  4A4H A;  3OS2 A;  3OYG A;  4E7K A;  4B9X A;  3P8D A;  2E5Q A;  5C0M A;  3M9Q A;  3L42 A;  3F70 A;  3OYA A;  4OVA A;  2D9T A;  2RHX A;  3NTI A;  4IUU A;  4BE1 A;  3ME9 A;  2BUD A;  3OYD A;  5C6S A;  4N4I A;  3LX7 A;  1H3Z A;  2RI2 A;  3FLG A;  4E7I A;  3MP1 A;  2GFA A;  5M9O A;  3S3N A;  1G5V A;  3MEV A;  1EN7 A;  2E6N A;  4EDU A;  1SSF A;  2M16 A;  2M0O A;  2K3X A;  4Q5W A;  4RG2 A;  3OYK A;  2O4X B;  4LD6 A;  5J26 A;  3OYH A;  2LDM A;  3QII A;  2RHI A;  2DIG A;  2R5M A;  4QVZ A;  3OMG A;  5IN1 A;  4C5E A;  3OYI A;  3UT1 A;  2IG0 A;  2MWO A;  3DB3 A;  4HCZ A;  4N4H A;  3MEA A;  3E9F A;  5IAY A;  3OYL A;  2RJF A;  3MP6 A;  4UC4 A;  5J39 A;  4IUT A;  2L3R A;  3FEO A;  4IUV A;  5D6Y A;  2RHU A;  5CIU A;  3OYF A;  2XDP A;  3KUF A;  3OQ5 A;  5KCH A;  3LYI A;  1E7D A;  4N4G A;  2B8A A;  3GOX A;  3ZEH A;  2QQR A;  4GY5 A;  3S6W A;  4C5H A;  2EQU A;  2PQW A;  2FHD A;  4CRI A;  5FRO A;  4BDY A;  4IUQ A;  1RI0 A;  1WJR A;  2EKO A;  3S3M A;  1OI1 A;  2RHY A;  3E9G A;  2VYT A;  3P8H A;  2RJC A;  2K3Y A;  2RO0 A;  2RJE A;  3MP8 A;  4PLL A;  3OYC A;  4QW2 A;  3DLM A;  2DAQ A;  4X34 A;  2F5K A;  4II1 A;  2LRQ A;  3PFS A;  2LCC A;  1OZ3 A;  2YRV A;  2L89 A;  2X35 A;  4PL6 A;  4BD3 A;  2NLU A;  2X4X A;  4BE2 A;  3LGF A;  4E7H A;  3DB4 A;  4BE0 A;  4ZTJ A;  3BDL A;  1OZ2 A;  2M1H A;  1N27 A;  2MWP A;  3Q1J A;  3OYM A;  3O8V A;  3L2V A;  2RHZ A;  1WJQ A;  3CEY A;  5D6W A;  2BIV A;  2WAC A;  4ZTF A;  5D6X A;  1E7L A;  4QQ6 A;  4A4G A;  1KHC A;  3L2R A;  4FU6 A;  2HQX A;  3OYN A;  2L8D A;  4A4E A;  2X4W A;  1OYX A;  4IKF A; 
#chains in the Genus database with same CATH topology
 1H64 1;  2CH4 A;  3CPF A;  2XIC A;  3VS4 A;  5GAN 2;  1HDL A;  3G7Z A;  4LDU A;  1ZBX A;  2P6A C;  4FIB A;  2MPX C;  1D0Z A;  1Q86 U;  5GAM g;  4E1R A;  2YUU A;  4PFZ A;  3JCM Q;  4PK4 A;  2I0N A;  5GJV B;  3EGU A;  1NZ9 A;  2RI5 A;  1VYT A;  2LJ1 A;  5GJW B;  3V8K A;  1JJ2 P;  3R6N A;  3EHQ A;  1AHJ B;  2X4Y A;  1GRI A;  1UJ0 A;  3CCL A;  2RC4 A;  3FC3 A;  5IHK A;  3JB9 F;  2EGA A;  1UB4 A;  1XOV A;  1QCN A;  3X20 B;  3L2Q A;  4TVR A;  4XTX A;  1X6G A;  1KC8 R;  2OAW A;  1U06 A;  1K9M U;  1DJ7 B;  2RD1 A;  1QKW A;  2KT1 A;  2VUB A;  3M5A A;  4LUD A;  2MAM A;  3R5C A;  1AD5 A;  2YUN A;  4E7I A;  4J9I A;  3MP1 A;  2QQB A;  4EDU A;  1YU6 C;  2KXD A;  3OYK A;  1OU8 A;  5FU7 C;  1JQQ A;  1IHW A;  4JJD A;  4BI8 B;  4HVU A;  2O9V A;  1SGP I;  3HRT A;  1CHO I;  2COY A;  2OU2 A;  4OMF B;  1UGR B;  2FNF X;  2E3I A;  1K1Z A;  2GKV A;  2J6K A;  3G1J A;  4WTO B;  1JU5 C;  2O01 E;  4KRT A;  3VS6 A;  4IUQ A;  4BDY A;  1UHA A;  1MNE A;  4C8Q B;  5LJ3 f;  4OMQ A;  3WVD B;  1SRM A;  2DRK A;  1BIB A;  3JCM e;  3RIR A;  4KGV B;  3FIF A;  2SGF I;  1R0B G;  3A8G B;  3PFS A;  1TSF A;  2ATC B;  3EGD B;  3OXF A;  1NM7 A;  3TVT A;  2K4Y A;  4C8Q E;  5CQX A;  3L2V A;  4J9G A;  2QK0 A;  1VQL Q;  4QQ6 A;  1KSW A;  3VUZ A;  1AN1 I;  4R56 A;  1R79 A;  4JJN K;  4C92 A;  1YJN Q;  2FRY A;  2QQS A;  2F5T X;  3CCS A;  4EMK A;  3SGB I;  1N8R C;  3OB9 A;  1E6G A;  1FMK A;  1I1J A;  1V29 B;  3L1A A;  5CKF A;  3EG1 A;  3VS1 A;  1S72 A;  1JXO A;  4C92 C;  4PJO A;  1K73 R;  4M7A A;  5I2M A;  4C5G A;  1K7V A;  3CC7 A;  1NJI U;  1IHV A;  3CD6 A;  1HEV A;  1KFZ A;  1QP2 A;  5GAN 3;  2R57 A;  2OTJ T;  1IZ6 A;  2KMO A;  1P92 A;  4RTV A;  1Q86 R;  3NPF A;  1VQP A;  2MIO A;  3FSX A;  2ZAE A;  5LJ5 e;  5I11 A;  3QDF A;  4KUL A;  3CCR Q;  3H0F A;  1OX9 A;  1Y0M A;  4M7A C;  3OS2 A;  4XTZ A;  2RQR A;  1YCY A;  3D00 A;  3QAH A;  1SHG A;  3OYA A;  1M1K R;  4M7D C;  4IUU A;  1CT4 I;  3SHW A;  1TUC A;  1MMD A;  1NE8 A;  5HY6 A;  3VYG A;  4F16 A;  2DFU A;  2RM4 A;  1VA7 A;  4JRI A;  1M5Q 1;  2PVO B;  1K4U S;  1VOM A;  2K3B A;  1YHQ Q;  2RHI A;  1ZSZ A;  2F3C I;  5FUX A;  3LWI A;  2A7Y A;  1VQ4 T;  3UFF A;  2ENN A;  1QQJ A;  2EJF A;  3VE5 A;  1VYU A;  3MP6 A;  1FMW A;  1BBZ A;  3HP9 A;  3SDZ A;  2M02 A;  3V7S A;  4F7U B;  2DTO A;  1GBQ A;  4J9H A;  2JUF A;  1O75 A;  4PJM A;  3G6E Q;  3VDU A;  4RTW A;  1W2B P;  4QT7 A;  2KRO A;  1PTR A;  3FSY A;  1RI0 A;  1WJR A;  3M0P A;  2L5Q A;  2VYT A;  2FZC B;  5E3P A;  2XHC A;  4C92 G;  3AT1 B;  3QDR B;  1KBE A;  1C0M A;  4B6M A;  2QQD A;  2EIF A;  4X9D A;  1YJ9 A;  4DOV A;  2H3E B;  2LRQ A;  4F7U E;  3VYH B;  2CP5 A;  2V26 A;  1VUB A;  1SKU B;  3M55 A;  4E2F B;  3FJ5 A;  4O6J A;  1N27 A;  1BUS A;  1WHH A;  2DXU A;  2DX1 A;  2OVO A;  3VS7 A;  3SB2 A;  4MMK A;  2RMO A;  1JO8 A;  2HQX A;  2X4J A;  2L8D A;  4M7A G;  5J8F A;  5FW9 A;  1VQM T;  4M78 A;  4M7D G;  1D1A A;  2CZ1 B;  3OXG A;  1X01 A;  2EYY A;  4M75 A;  4VUB A;  4DEX A;  1PM3 A;  1Q7Y U;  4JJB A;  3QBY A;  2O2O A;  4DBH A;  2NU0 I;  3C12 A;  1Y1C A;  3UDC A;  2KK4 A;  4C5I A;  1VQ5 Q;  9ATC B;  3AHU A;  3SWN A;  2H3J A;  2JVV A;  1MV3 A;  1PNJ A;  2QEX A;  3GNF B;  4XU2 A;  2NUP A;  2XG8 D;  1EFN A;  3OS1 A;  2F2W A;  2DXB A;  4C92 F;  3DKM A;  5KYW B;  1YIT A;  2YXY A;  4JCV E;  3TQ7 P;  4OMN A;  2KRM A;  1W4S A;  2CRE A;  4ATO A;  4NOY A;  2DL8 A;  3NTH A;  5LJ3 h;  3RMQ A;  3V8L A;  2RQT A;  3SWN C;  2X52 A;  2LTO A;  1T0H A;  3E19 A;  2QG9 B;  3PVL A;  1M90 U;  1RLQ C;  2QGG A;  2CP3 A;  2KDP A;  1D1C A;  4OVO A;  4CC7 A;  5CKH A;  3CMA A;  4M7A F;  4XU3 A;  4A63 B;  4GBQ A;  2NUZ A;  2DRM A;  2E6N A;  4M7D F;  2E41 A;  1QWF A;  5JHW C;  2VWF A;  2B8T A;  3CCQ Q;  2MWO A;  3OYL A;  4OP0 A;  2ZPE B;  3QWP A;  1KHI A;  1R0R I;  2L3R A;  1YI2 A;  2RHU A;  2CWH A;  3LYI A;  4N4G A;  1KQS S;  4RCC A;  4GY5 A;  4E47 A;  2LZ6 B;  2EQU A;  5EC7 A;  4FT4 A;  1YWO A;  2PU9 B;  1Q81 C;  2DM1 A;  3I9Q A;  1Y1B A;  4M77 D;  3G4S A;  2CZ7 B;  1NUB A;  3M0U A;  2MOX A;  4XK8 E;  1AOJ A;  2IVW A;  1UVG A;  3FB9 A;  2L89 A;  4M75 G;  1U3O A;  1NG2 A;  1AZG B;  5KYU A;  1ZX6 A;  3CC2 Q;  3H41 A;  2CWG A;  2LNH B;  5GAN g;  1YIJ A;  4SGB I;  3UA6 A;  2W0T A;  1HYO A;  4HCB A;  2O9S A;  4LN2 A;  2EFI A;  3I55 T;  4AFS C;  2EQM A;  4YTL A;  2V1C A;  1OV3 A;  2GTJ A;  2Y0M A;  3KFV A;  3OA6 A;  3C94 A;  1S72 T;  4RCB A;  2QQ0 A;  3CCM T;  2ABL A;  2EPD A;  2EVR A;  3BFM A;  2EQK A;  2LX7 A;  4E7Z A;  1G3W A;  1TG0 A;  3RKX A;  3CD6 T;  3CCE A;  3OYE A;  4LDV A;  5LJ3 d;  4E7L A;  1VQP T;  4OB2 B;  5KH6 A;  4OB0 B;  3BW1 A;  3OXL A;  1ZBJ A;  1N13 A;  1PSE A;  3KXT A;  5LJ5 f;  2WSC E;  1J3T A;  1PPF I;  4LNP A;  3JB9 H;  3T9N A;  1H8K A;  3QJY A;  3EG0 A;  2E5R A;  3X28 B;  4B6D A;  2ZZD A;  1EN7 A;  1VQO A;  2KVQ G;  3JSC A;  3VDP A;  2LCS A;  3CC4 A;  2YLB A;  2CP0 A;  2QA4 T;  4C0D C;  1RAD B;  1VQ7 Q;  3M0Q A;  2FVU A;  1S20 A;  1UJY A;  2YRC A;  1RAH B;  3RDV A;  5A0G A;  2XDP A;  3REB B;  4PNO A;  2PUK B;  2DA9 A;  2JMA A;  4EMG A;  1FAR A;  2DJZ A;  3QHS A;  4BI3 A;  3MP8 A;  5GAN 6;  1RAA B;  1K9M C;  4XTU A;  2CZ0 B;  1A0N B;  2M9U A;  3KBG A;  2YRV A;  3M59 A;  1Y96 A;  4LD9 K;  3JAM E;  1VQ6 T;  1BMO A;  2GCX A;  3CEY A;  3U23 A;  1U1S A;  2L2P A;  1E6H A;  1N5Z A;  1RI9 A;  1TUS A;  1NEB A;  4OB3 B;  1VQ8 A;  2RK2 A;  3VV0 A;  1QVG P;  1MGQ A;  1UGV A;  3GF5 A;  5I2S A;  2DB6 A;  2KRS A;  1M3C A;  1Z7K B;  3UWN A;  3V8J A;  1RAB B;  1TBQ R;  1QVP A;  3LLR A;  5FU6 B;  2JNG A;  3J7A F;  1D3B B;  4N0A A;  4QQD A;  4IIO A;  4HT8 A;  2R5A A;  1OPL A;  2KBT A;  3RKW A;  1YIT T;  2YLC A;  1Q82 C;  2K9G A;  1VQK A;  4L5G A;  3QYH B;  4GLK A;  4XQ3 A;  5AT1 B;  1WIE A;  1ARK A;  1Z9Z A;  1ABO A;  2GBQ A;  2OZU A;  3LWH A;  1N8R R;  4J9C A;  4A4H A;  2HDA A;  2YDL A;  4B9X A;  5DM7 R;  3L42 A;  4JRP A;  3JCM h;  3CMA T;  4JRK A;  4J9B A;  4DBF A;  5I22 A;  1XQH A;  3S3N A;  3EFO B;  2XDD A;  1MMG A;  3QII A;  3CCV A;  2R5M A;  2E1H A;  1LNX A;  5CAI A;  1YI2 T;  5GAM j;  2DLP A;  4RTX A;  4L6V 5;  5D6Y A;  4M77 C;  1E7D A;  4RG8 A;  4PJO D;  4JLI A;  5KYX B;  3GNG A;  2KAF A;  2DD4 A;  1SSH A;  1TUD A;  4HCC A;  2E64 A;  4JS5 A;  2DAQ A;  5L23 A;  1UGS B;  4HVW A;  1TTH B;  3QG1 A;  1V1I A;  1DS3 I;  2ROT A;  3DB4 A;  3M57 A;  2RQU A;  1SGE I;  1V1C A;  3OW2 A;  2IPO B;  2LT1 A;  3UEY A;  1PJU A;  4V2S A;  1AWW A;  2JT4 A;  1YIJ T;  3L2R A;  1M8B A;  2AT1 B;  4FU6 A;  3TO6 A;  5LJ5 h;  3KY9 A;  4IKF A;  2HBP A;  2KXC A;  2E73 A;  2OTJ Q;  1I81 A;  2LC4 A;  4HXJ A;  2UZ3 A;  1VQ9 T;  1MHN A;  2DEQ A;  2EQJ A;  1YNZ A;  2ENZ A;  3ZBD A;  4CI0 C;  1B34 A;  4D8D A;  2J6F A;  1W6X A;  3G71 T;  4PJJ A;  5FRN A;  4WP4 A;  4LDX A;  4PFP A;  5IT9 E;  2B86 A;  4BY6 B;  4KH0 B;  2QPO A;  5GAN 4;  1BYM A;  2LNV A;  3MKD A;  1KG1 A;  2O88 A;  2CKK A;  1X6O A;  2BE7 D;  4M77 G;  4F7U A;  1W1F A;  1W4R A;  2YSQ A;  2QAZ A;  5A0D A;  1VQ4 Q;  3I35 A;  2K6D A;  2DPP B;  3EFS A;  3UPU A;  2GIV A;  3JCM d;  2RH2 A;  1SGQ I;  2C0T A;  1PTQ A;  3X24 B;  4BE1 A;  3UGL A;  4BI4 A;  4A4K A;  1M1K U;  2BUD A;  1XX6 A;  1VQO T;  1H3Z A;  2CT3 A;  1VQN A;  2M0O A;  3SEK C;  4M78 D;  4A54 A;  3OW2 S;  4KUD K;  1PKT A;  1Y57 A;  3RMS A;  3EG9 B;  1KD1 C;  3HFO A;  4KBM B;  4KH1 B;  3UT1 A;  1M8V A;  2Z0W A;  1BU1 A;  2GNC A;  2KMQ A;  4M75 D;  1ULM A;  2KCX A;  5IHI A;  4Y92 A;  2D8H A;  1BIA A;  4BB7 A;  1CE3 A;  2JN0 A;  4XTV A;  5KCH A;  1YJW Q;  2CH4 W;  2FHD A;  3OVO A;  2CSI A;  2PNI A;  2NUT B;  1I0C A;  4DBR A;  4M77 F;  1NPR A;  1VQM Q;  2NU4 I;  2X51 A;  5CO7 A;  1H92 A;  5GAO m;  1CGJ I;  4PFO A;  3X26 B;  1BCM A;  1XBT A;  3DLM A;  4J6Y A;  3DLL A;  1N6A A;  3VS3 A;  2ED1 A;  2YWW A;  1SPK A;  2X4X A;  4JUV A;  3CCU A;  4BE2 A;  4LXC A;  4FYY B;  1B07 A;  2VC8 A;  5KYW A;  2YQP A;  1OQK A;  1W2B S;  1HJA I;  1E7L A;  5LJ5 d;  1KHC A;  2A3L A;  2RB6 A;  1QP3 A;  1YN8 A;  1YBY A;  2A37 A;  4FKD A;  1YJN A;  4FSS A;  4F7U G;  1I07 A;  1Q81 R;  2KNB B;  5EX3 A;  1JRI A;  4AG2 C;  5CVI A;  1OPK A;  1JEG A;  1B3Q A;  3GIB A;  2V1R A;  2Y4X A;  2FO0 A;  2HCK A;  2D0Q B;  4XU1 A;  1G2B A;  3GLX A;  2P4R A;  1FY7 A;  1RAE B;  1P9Z A;  3A8L B;  1WGS A;  1IXD A;  3OL0 A;  4IUR A;  1RLP C;  1VQK T;  5CCM A;  3TO7 A;  4Y91 A;  2KY9 A;  4RTY A;  1T3S A;  2EBP A;  2KSS A;  2GTO A;  1K8A C;  3OY9 A;  1FYN A;  1YWP A;  8ATC B;  1CT2 I;  4A53 A;  2ODD A;  1M27 C;  3CCR A;  2EQI A;  4KGX B;  2D6F A;  3M9Q A;  4OVA A;  1WFW A;  4HKE A;  3PIP A;  4XTW A;  4EMK C;  4FYX B;  1LR9 A;  1U5K A;  2AKL A;  3HFN A;  3UAT A;  1V1H A;  4QVD A;  1YHQ A;  4C5E A;  1R8O B;  2H8H A;  2HL5 C;  2HNI A;  3OYY A;  2GQI A;  4HCZ A;  2BE9 B;  4XAX B;  3CCJ A;  2OTL Q;  4PJO C;  1HK9 A;  3I56 T;  1HD3 A;  4PKC C;  3JRZ A;  3OQ5 A;  2V1Q A;  1H3H A;  3GBQ A;  2QQE A;  2HEQ A;  3G6E A;  4C5H A;  1XTD A;  5A0L A;  8AT1 B;  2LEO A;  2FPF A;  3PVQ A;  3H9N A;  5LJ5 g;  2NU2 I;  3CQT A;  3GPL A;  2RJC A;  2LQN A;  1FMV A;  3PGG A;  3NHN A;  1IB8 A;  3EHR A;  3I55 Q;  4PLL A;  2XDB A;  5GMK i;  1X43 A;  4ZNX A;  1TWB A;  1W3S A;  2JZM A;  2ED0 A;  1XA6 A;  4JPB W;  5CKD A;  3RKY A;  3CCM Q;  1K76 A;  2N1A B;  2L3Q A;  2K5F A;  4FW2 A;  3H0I A;  2P84 A;  4PJN A;  5IXF A;  3M54 A;  1GXI E;  1ZSZ C;  3JCM P;  2ROL A;  2PUO B;  1PD1 A;  4AML A;  1UHC A;  3TCJ A;  3PT9 A;  2CP7 A;  1F1B B;  1OYV I;  4M4Z A;  1PWT A;  2NYS A;  2EJ9 A;  1KIK A;  2L0A A;  2ECZ A;  1WJS A;  3QJ6 A;  1UG1 A;  5FWC A;  1VQ5 A;  1WLP B;  1GFD A;  5A2Q E;  3CXL A;  4PJO G;  3VKI A;  2JW4 A;  3PTA A;  2HBW A;  2KYM A;  3WVE B;  2KT8 A;  1TS9 A;  2CWF A;  1NPP A;  2K2M A;  2N17 A;  2XKO C;  2DXC A;  2QA4 Q;  3CME Q;  1KQS A;  2FYK A;  5E3R A;  1BI1 A;  4D8K A;  3B4V C;  2R58 A;  3QZ9 B;  2LJ0 A;  2E5Q A;  5C0M A;  1SEM A;  3HSB A;  4LDW A;  4M78 C;  3M4Y A;  2F69 A;  2JOY A;  4N4I A;  4EMH A;  1VQN T;  2RI2 A;  1Y07 A;  5FU7 B;  1G5V A;  4AMC A;  3A8M B;  5GAN j;  3CCL T;  2K3X A;  4M75 C;  4QKU A;  5GMK j;  3X25 B;  2OAU A;  2QI2 A;  3SGQ I;  4J8O A;  1Q82 R;  3CCQ A;  4N4H A;  1EIF A;  1HJD A;  3OBY A;  2PZ1 A;  1MV0 B;  4KGZ B;  1WHG A;  2JXD A;  4IUT A;  4X1V A;  2LX9 A;  3FEO A;  4OMM A;  1WI7 A;  2VB6 A;  3KUF A;  1OU9 A;  1VQ6 Q;  1GFC A;  2QQR A;  1TBO A;  4PJO F;  1WGT A;  2W0Z A;  2QTV A;  1WKX A;  1UGQ B;  4OMO A;  2RHY A;  1VDD A;  2E65 A;  4UXH A;  4ZN3 A;  2EYQ A;  1KC8 C;  4RTU A;  1NBE B;  2XID A;  2YRD A;  1D3B A;  2VXE A;  3EG2 A;  3PE0 A;  2M5X A;  1M2O A;  3CCU T;  4RUG A;  5KYN A;  2E4H A;  4C8Q D;  4E7H A;  1U5S A;  2QTX A;  4ZTJ A;  2RQW A;  1IGU A;  3CC2 A;  4HGU A;  1LR8 A;  4RMO A;  2XD0 A;  2WSF E;  3JCM c;  2DBK A;  3HL8 A;  2G3R A;  1AWX A;  3OYB A;  4M78 G;  3A8H B;  2HQH A;  2JTE A;  1RAI B;  2A20 A;  3UEJ A;  2FEI A;  4FYV B;  4C92 B;  1CKA A;  2CP2 A;  3JCM f;  3HTR A;  2GKT I;  4UXI A;  1D1B A;  3EFO A;  2DIL A;  5HQ8 A;  3LH0 A;  1AZE A;  1QVF S;  4AFU C;  1H0Z A;  2ZCF B;  3MET A;  2JM9 A;  4J6W A;  1X74 A;  1NLP C;  4OGE A;  2UVO A;  4XTY A;  3CCS T;  1QVG S;  2AIR B;  1G83 A;  2P0K A;  5D7U A;  4C92 E;  1Z2I A;  5KYY A;  2ZGW A;  4M7A B;  2RNA A;  1WXT A;  3MEU A;  3VUB A;  5GAN e;  5GMK e;  1YI2 Q;  2HSP A;  4M7D B;  3MCA B;  4ELY C;  1G3Y A;  2BKD N;  1CGI I;  2L3P A;  1N8R U;  3P8D A;  2J9R A;  3F70 A;  2V8J A;  3CC7 T;  4KUI A;  2NU3 I;  1NEG A;  3CPW S;  2MK5 A;  2VV5 A;  2V1C C;  4RG2 A;  2Y4Y A;  4M78 F;  3CBP A;  2QXF A;  3TU4 K;  1YHQ T;  1WYX A;  2LDM A;  3CCJ T;  4M7D E;  1VQ7 A;  5GAO n;  1M4Z A;  5IAY A;  4M75 F;  1IGQ A;  3CXC A;  2RJF A;  1K73 C;  1X4S A;  3M58 A;  2B8A A;  2ZPF B;  1NYG A;  2J06 A;  1MMN A;  2PQW A;  1YIJ Q;  1Q86 C;  1P9G A;  2K3Y A;  4O5V A;  5HK3 A;  3JB9 J;  1VQ9 Q;  1BI2 A;  1C1A A;  1ZQ1 A;  3G71 Q;  1KD1 R;  1OZ2 A;  2M1H A;  4K11 A;  4ME7 A;  3O8V A;  2RHZ A;  2NU1 I;  4C0G A;  1LPL A;  1DS2 I;  1M3B A;  1NLO C;  4DOW A;  3TOB A;  1LCK A;  1QMC A;  1OYX A;  2EW3 A;  4AT1 B;  1YJ9 T;  4MZM A;  2O31 A;  2QQA A;  2VKN A;  3MJX A;  2DEU A;  5DAE A;  3UGI A;  1OUL A;  5LL6 S;  3UOE A;  2L3S A;  1ABQ A;  1PZW A;  1KQS P;  2JZ2 A;  2LVM A;  2CYZ B;  4A4F A;  1OOT A;  4D6W A;  4ZGE B;  3THK A;  4DA4 A;  3CXC S;  3QXE B;  4FL6 A;  4Z02 A;  3QYG B;  1UUE A;  3SWN B;  4HCK A;  3SD4 A;  3ER0 A;  5LJ3 g;  1ULK A;  4EPC A;  2FRW A;  1WZO A;  3N5B B;  4OB1 B;  1RAC B;  1X75 C;  1Z9Q A;  7WGA A;  1IRX A;  2QEX T;  2KEA A;  4FT2 A;  1NYF A;  2LMJ A;  3J81 E;  1PRM C;  2F2X A;  3P8B B;  5M9O A;  1M9S A;  2O4X B;  2CUB A;  4LD6 A;  3O5Z A;  4AFQ C;  3R6O A;  5CCA A;  3OMG A;  4J7F A;  2HD0 A;  3DB3 A;  3E9F A;  3VRY A;  4UC4 A;  5CK9 A;  4C8Q A;  4N0A C;  1ZA1 B;  3OYF A;  3BJI A;  2DMO A;  2DL4 A;  3LW5 E;  4MML A;  3S6W A;  3NGP A;  4CRI A;  1E7O A;  2VAS A;  5FUY A;  3EGD A;  2DD5 A;  1JJ2 S;  3M53 A;  1GCP A;  3QWY A;  5ECA A;  4C8Q C;  2RQV A;  5EX0 A;  2C0O A;  4C0Z A;  2EGC A;  1NJI C;  1C6V X;  1AEY A;  4J9D A;  2EAY A;  2E12 A;  5FUW A;  1WJQ A;  3FJP A;  3MPU B;  4GI3 C;  2K5I A;  5GAO q;  3SFM A;  3HH2 C;  2EYW A;  3G4S T;  1VQK Q;  4HA8 A;  1PCX A;  1M30 A;  5FWB A;  2HMA A;  1WXB A;  1B7T A;  4MDW A;  3MHX A;  2KRN A;  1SGD I;  1QCO A;  2OTJ A;  1JXM A;  1Q81 U;  2WVJ A;  1TUG B;  2RPN A;  2WSE E;  1GL5 A;  3EH2 A;  3PMT A;  1PHT A;  2A0F B;  3TSZ A;  4E6R A;  2AZV A;  1HPT A;  2LUY A;  2A36 A;  2CT4 A;  3LGL A;  2XRC A;  1TGS I;  4L9M A;  1TH7 A;  2ZPI B;  2CP6 A;  2COZ A;  4EIK A;  2ARP F;  1UGP B;  2DKV A;  3C4S A;  1VQ4 A;  1JBM A;  2LT4 A;  2DET A;  2V8K A;  2BTT A;  4C8Q G;  3I56 Q;  5GAN f;  4E7K A;  1ZUK A;  2FZK B;  4ELZ C;  2PVG B;  1SHF A;  1TUR A;  4DNC A;  5C6S A;  4Y28 E;  4C0D B;  3CCE T;  4Z89 A;  3OYH A;  1M2V B;  4QVZ A;  1W2B A;  4JJC A;  4ORZ A;  2J6O A;  2K57 A;  2K5L A;  5J3B A;  1MT1 A;  2ZPG B;  1YJW A;  2JTM A;  5FRO A;  5GAM e;  2DNU A;  1Q7Y C;  3VS5 A;  3CC4 T;  2RO0 A;  1UTI A;  1VQM A;  4CC4 B;  2FG0 A;  1RUW A;  1G8X A;  4X34 A;  5DLO A;  3JCM W;  2LCC A;  4NL3 A;  4BD3 A;  4C8Q F;  2B0U C;  1VIF A;  4FM4 B;  4FYW B;  1T0J A;  3OSV A;  1EZZ B;  5J8C A;  3R5B A;  2KYB A;  3RR6 A;  5CKE A;  4ZTF A;  2SGE I;  2J7I A;  1IO6 A;  4WF2 A;  2DL7 A;  1Y96 B;  4OGC A;  3BDU A;  5I21 A;  1M90 C;  1IY6 A;  4LDY A;  3E59 A;  4RTZ A;  1OMT A;  4CC3 A;  4BDZ A;  2D1X A;  3BE3 A;  2AHJ B;  1PG5 B;  2DIQ A;  2RN8 A;  4IIM A;  2X3X D;  2GQV A;  2AZS A;  2DL3 A;  2GFU A;  3M0R A;  1TU0 B;  3SEM A;  3OS0 A;  1VQ8 T;  2YHT A;  1WHJ A;  4IUP A;  4L59 A;  1VQN Q;  1VQL A;  3PMI A;  2WGC A;  2KGT A;  4NL2 A;  1FWZ A;  1N9R A;  3CCL Q;  5LJ5 j;  4E7J A;  3A98 A;  2E10 A;  2JJ9 A;  2M51 A;  3A1P A;  1TBR R;  3QWX X;  2DVE A;  2BZX A;  2W10 A;  3RNJ A;  5GAO l;  2DTH A;  1RAG B;  3S3O A;  1JB0 E;  1X69 A;  4DBQ A;  1GCQ A;  3EFR A;  3JCM g;  1I5L A;  2GFA A;  1WDX A;  1SSF A;  2OD1 A;  1IW4 A;  1UEC A;  2QGF B;  4JRQ A;  2IG0 A;  5DLQ E;  2ERW A;  3CCU Q;  2SRC A;  1X6B A;  4M77 B;  1GCQ C;  2OTL A;  1Q82 U;  2LQW A;  2XMF A;  2EKH A;  1N9S A;  4ESR A;  2QQC A;  4E1P A;  2KE9 A;  1X27 A;  3GOX A;  2CGH A;  2V8I A;  2M0Y A;  3I5S A;  3QSU A;  1WTJ A;  2DYB A;  2E6Z A;  4F7U F;  3CCV T;  4M77 E;  4JS4 A;  3I55 A;  1MJB A;  3REA B;  4F04 B;  4II1 A;  1M1F A;  2FZG B;  4JZ3 A;  1BB9 A;  4PL6 A;  2ENM A;  2SGQ I;  3CCM A;  2LCL A;  3Q1J A;  2PQ8 A;  5GAO r;  3EGX B;  4J6X A;  2P0P A;  5GAN h;  5GMK h;  4M7D A;  4MPI A;  1CKB A;  3CCS Q;  4J9F A;  3QO3 A;  4DEY A;  3OW2 P;  5IXB A;  4J5Y A;  3NTK A;  3HHT B;  3V7R A;  1BK2 A;  4Z8A A;  2MMP A;  2WCY A;  2DJQ A;  2VXF A;  3NMZ C;  4ZN1 A;  2RJD A;  1S72 Q;  1SG5 A;  1HXD A;  2QNF A;  3WXM B;  1CSO I;  4PLI A;  1BCO A;  1AVZ C;  1RAF B;  3M0T A;  2KMR A;  2KMT A;  4BAC A;  3CC7 Q;  1B34 B;  2JXB A;  2Y90 A;  1OX8 A;  3CD6 Q;  2P4T A;  5IH2 A;  1I5O B;  2HKQ B;  2LP5 A;  2MCN A;  2MYS A;  2VRW B;  3CCJ Q;  2QA4 A;  3L2W A;  3CME A;  2JTF A;  1VQP Q;  5KCO A;  1RL2 A;  2JW6 A;  1K9M R;  3PDN A;  3UGD A;  1ZA2 B;  1MJ9 A;  4FSX A;  2EYZ A;  2J87 A;  2LQ8 A;  1UDL A;  2F1L A;  3CBM A;  3ME9 A;  1M3A A;  2BZY A;  2C0I A;  5HK0 A;  5GAO p;  5FUV A;  2X3T A;  4Q5W A;  2DYI A;  2VGM A;  5J26 A;  1G3S A;  1SGR I;  1TIH A;  5IN1 A;  2CUD A;  2FPE A;  1QW1 A;  1TBN A;  2RIJ A;  1GBR A;  1YJW T;  1VQ6 A;  5AYF A;  3TSW A;  1G3T A;  5DY9 A;  3QTL D;  1WA7 A;  2QYZ A;  2EKO A;  2RK1 A;  1OI1 A;  3UA7 A;  1O9S A;  2DL5 A;  2L8E A;  1UFF A;  2RJE A;  5GAM f;  3JCM b;  1M1G A;  3VU3 C;  1FXX A;  5GMK m;  1YJ9 Q;  4QW2 A;  1U8R A;  1QVF A;  2JYY A;  1XJW B;  3LGF A;  2JM8 A;  4BE0 A;  1QVG A;  3VJP A;  1KD1 U;  5D6W A;  2WAC A;  5GAN d;  1RFH A;  4Z88 A;  2PVD B;  1VIE A;  2I2L A;  1FX7 A;  2JMC A;  4J83 A;  3HRS A;  2QDY B;  3E2I A;  1TOV A;  2MF2 A;  1LR7 A;  5GMK l;  4OMP A;  5KE3 A;  3L2U A;  1QWE A;  3OS5 A;  2XI9 A;  4X9C A;  4NS5 A;  3ZFJ A;  3CPW A;  2O4X A;  1UUC A;  2JA1 A;  3QKJ A;  2QEX Q;  3JCM X;  5CKB A;  1MJA A;  1VQL T;  5FU6 C;  3VS2 A;  1NJI R;  1IY5 A;  5CR2 A;  1LOJ A;  1YJN T;  3ZL7 C;  1YIT Q;  4MDX A;  1LJO A;  2DBM A;  1WQ7 A;  1I8F A;  3JB9 D;  3QZ5 B;  1ZLM A;  5HKC A;  3QPH A;  2ROW A;  1BI0 A;  2BZ8 A;  3EAE A;  4QQG A;  1CSK A;  5IHN A;  3PNW C;  5CQY A;  3OYG A;  1D0Y A;  4EMK B;  2KR3 A;  1I4K 1;  1QCF A;  2RHX A;  3NTI A;  4ZGJ B;  2N52 A;  3CMA Q;  1YP5 A;  1KQ2 A;  1BI3 A;  3JB9 I;  2A08 A;  3FRN A;  3HKS A;  1IRE B;  1S1N A;  1WNL A;  2LB7 A;  4PJO B;  1R77 A;  2DIG A;  1KQ1 A;  4LUE A;  2OTL T;  2FPD A;  3MEA A;  5KYX A;  5J39 A;  3CCR T;  3PIO A;  2COW A;  2L7X A;  5CIU A;  3CBO A;  4JDS A;  1VYV A;  1K8A U;  5EG2 A;  2DF6 A;  3G4S Q;  4PJO E;  1UEB A;  2KQW A;  2PTK A;  3RUX A;  2OI3 A;  4M7A E;  1PRL C;  2BUS A;  1OMU A;  2F5K A;  4HVV A;  1VQ9 A;  3NFC A;  1BKB A;  3BY7 A;  2QQ9 A;  5LJ3 j;  3ULR B;  3VRZ A;  1U1T A;  2YUP A;  3M56 A;  3M4G A;  3G71 A;  3G6E T;  4C0F A;  7AT1 B;  1ZSZ B;  2BIV A;  2DTI A;  5D6X A;  4HT9 A;  3OSS C;  2E5K A;  3INZ A;  1WHL A;  1EX4 A;  2CDT A;  2X9H A;  2SEM A;  2EYX A;  3C95 A;  1T3L A;  3RBB B;  2DO3 A;  4R0K A;  1XNI A;  4MZP A;  4QVC A;  1Q7Y R;  2HSE B;  2YT6 A;  1X2K A;  3ASK A;  2SGD I;  3RU0 A;  1HSQ A;  2EWN A;  3J80 E;  1M1K C;  2MI6 A;  1K0X A;  2ESW A;  2J05 A;  3HRU A;  4KT0 E;  4LE9 A;  1WHK A;  4GLM A;  4J7I A;  2K9H A;  3TEE A;  3H6Z A;  2OJ2 A;  2ELI A;  1M2V A;  1PCE A;  2K7A A;  1NXU A;  1KJW A;  2QDL A;  3A8O B;  4CC2 A;  2CSQ A;  3CCE Q;  4BY6 C;  4FCY A;  3IQL A;  2X3W D;  3H0H A;  3RER A;  1WQW A;  3CME T;  2DK3 A;  2AK5 A;  1AWJ A;  2N71 A;  1SRL A;  5GAM h;  4AG1 C;  3TOA A;  1M90 R;  2GF7 A;  2RA2 A;  5FRM A;  1W70 A;  3MEW A;  2DXT A;  4M78 B;  5FLX E;  1VQ5 T;  2K79 A;  1JJ2 A;  1TXQ A;  3RES A;  1ZUU A;  3EH1 A;  3E1S A;  3EG9 A;  3M0S A;  1OVO A;  1Y8F A;  2VGN A;  4M75 B;  3OYD A;  1WGC A;  2EJG A;  3LX7 A;  1VQO Q;  4RKU E;  3CC4 Q;  2HL3 A;  2VVK A;  1K9A A;  1Y71 A;  1SF9 A;  1QKX A;  4F17 A;  5HCK A;  3TO9 A;  2JS0 A;  6AT1 B;  4R55 A;  4XU0 A;  4M78 E;  2NUP B;  2NUT A;  3V7C A;  1ACM B;  4WCI A;  2HAX A;  2ORV A;  3UF4 A;  4IUV A;  3URG A;  3D7S B;  1QVF P;  3R5D A;  4M75 E;  1ULN A;  3ZEH A;  4AFZ C;  5LJ3 e;  5L8R E;  5HI7 A;  1Q9B A;  3TJQ A;  3P8H A;  1MUZ A;  5GAN 8;  2GGR A;  1UE9 A;  2RF0 A;  1FYB A;  1UVF A;  4MZT A;  2A28 A;  1MND A;  2HZY A;  1LVK A;  3CCQ T;  3EG3 A;  1SGY I;  2X35 A;  4P5N A;  2NLU A;  1M8M A;  1TOT A;  3JCM J;  4JZ4 A;  3BDL A;  4A24 A;  4DQ2 A;  3OYM A;  1K8A R;  2K2V A;  1K0S A;  1SGN I;  4A4G A;  1VQ8 Q;  3OYN A;  1PC0 A;  3CPW P;  1Q95 G;  4F14 A;  3HPW A;  1K7U A;  3FDR A;  5KE2 A;  2EGE A;  4OML A;  1PKS A;  1CT0 I;  2DIP A;  3C0C A;  2E3H A;  3VS0 A;  3I5R A;  3TRE A;  3GP8 A;  1KC8 U;  2RI3 A;  1WPY A;  2KDS A;  1D0X A;  3CC2 T;  1Y7X A;  1ZHI A;  2XK0 A;  2CJS C;  2YUO A;  4B9W A;  1YCS B;  4M77 A;  4BUG A;  2HQE A;  4RTT A;  2QNC A;  2D8J A;  4C92 D;  1OEB A;  2DZ9 A;  5KYU B;  2HKN A;  1M8C A;  5GAM d;  2XU8 A;  2DZC A;  3H8Z A;  3L2Z A;  3MO8 A;  3OMC A;  5CCL A;  1WXU A;  2FB7 A;  3OYJ A;  1PD0 A;  2V53 A;  2CZ6 B;  3MEK A;  1KK7 A;  2E70 A;  3I56 A;  3E2U A;  2IIM A;  5GAN 7;  5KYY B;  2GVI A;  2D9T A;  4UXJ A;  1D09 B;  4M7A D;  2N1U A;  3FLG A;  1WX6 A;  4J9E A;  4ANJ A;  3MEV A;  3LH5 A;  2F2V A;  2M16 A;  4M7D D;  3OBW A;  3CCV Q;  1R0C B;  2P0Q A;  2DE0 X;  3EGX A;  3OYI A;  1YTP A;  1KBF A;  1X2Q A;  2JS2 A;  2DVJ A;  1AT1 B;  4FW1 A;  2KMP A;  3JV3 A;  1FAQ A;  1UHF A;  3JCM V;  2CS7 A;  2OX7 A;  1QLY A;  2DKG A;  1V76 A;  1K7T A;  3CXC P;  3R5A A;  2AKK A;  2G6F X;  3S3M A;  1PSF A;  1ZSG A;  3E9G A;  2DER A;  2ZPB B;  2YUQ A;  2FL7 A;  2C06 A;  4OF1 A;  1YFN A;  4ZGD B;  2D0N A;  3OYC A;  1KMA A;  1AWO A;  4PJL A;  2QAS A;  2LJ3 A;  1VQ7 T;  3QUI A;  3JB9 G;  1OZ3 A;  5E3Q A;  2ZPH B;  4JLG A;  1ZUY A;  9WGA A;  2MWP A;  5GAN 5;  1WHM A;  3A5Z B;  2SGP I;  1MMA A;  2GKR I;  1K73 U;  2LQK A;  4E7S A;  4A4E A;  2NWM A;  2ORW A;  2X4W A;  2KI7 A; 
#chains in the Genus database with same CATH homology
 1H64 1;  3CPF A;  2XIC A;  5GAN 2;  1HDL A;  3G7Z A;  4LDU A;  1ZBX A;  2P6A C;  4FIB A;  1Q86 U;  5GAM g;  4E1R A;  2YUU A;  3JCM Q;  1NZ9 A;  2RI5 A;  3V8K A;  1AHJ B;  2X4Y A;  3CCL A;  3FC3 A;  3JB9 F;  1UB4 A;  1XOV A;  3X20 B;  3L2Q A;  4TVR A;  4XTX A;  1K9M U;  1DJ7 B;  2RD1 A;  2VUB A;  3M5A A;  2MAM A;  4E7I A;  3MP1 A;  2QQB A;  4EDU A;  3OYK A;  5FU7 C;  4BI8 B;  1SGP I;  3HRT A;  1CHO I;  4OMF B;  1UGR B;  2FNF X;  2GKV A;  1YU6 C;  2O01 E;  4BDY A;  4IUQ A;  4C8Q B;  5LJ3 f;  3WVD B;  1BIB A;  3JCM e;  3RIR A;  3FIF A;  2SGF I;  3A8G B;  3PFS A;  3OXF A;  2K4Y A;  4C8Q E;  5CQX A;  3L2V A;  4QQ6 A;  3VUZ A;  1AN1 I;  4R56 A;  1R79 A;  4JJN K;  4C92 A;  2QQS A;  2F5T X;  3CCS A;  4EMK A;  3SGB I;  1N8R C;  3OB9 A;  1V29 B;  3L1A A;  5CKF A;  1S72 A;  4C92 C;  4PJO A;  4M7A A;  5I2M A;  4C5G A;  3CC7 A;  1NJI U;  3CD6 A;  1QP2 A;  5GAN 3;  2R57 A;  2OTJ T;  1IZ6 A;  2KMO A;  1P92 A;  1VQP A;  5LJ5 e;  4KUL A;  4M7A C;  3OS2 A;  4XTZ A;  1YCY A;  3D00 A;  4M7D C;  3OYA A;  4IUU A;  1CT4 I;  1NE8 A;  3VYG A;  5HY6 A;  2RM4 A;  4JRI A;  1M5Q 1;  2PVO B;  2RHI A;  2F3C I;  5FUX A;  3LWI A;  2A7Y A;  1VQ4 T;  3UFF A;  2ENN A;  2EJF A;  3VE5 A;  3MP6 A;  3HP9 A;  3SDZ A;  3V7S A;  4F7U B;  2DTO A;  2JUF A;  1O75 A;  3VDU A;  1PTR A;  1RI0 A;  1WJR A;  2L5Q A;  2VYT A;  2XHC A;  4C92 G;  3QDR B;  1KBE A;  2QQD A;  2EIF A;  4X9D A;  1YJ9 A;  4DOV A;  2LRQ A;  4F7U E;  3VYH B;  1VUB A;  3M55 A;  4O6J A;  1N27 A;  1BUS A;  2DXU A;  2OVO A;  3SB2 A;  4MMK A;  2HQX A;  2X4J A;  2L8D A;  4M7A G;  1VQM T;  4M78 A;  4M7D G;  2CZ1 B;  3OXG A;  1X01 A;  4M75 A;  4VUB A;  1Q7Y U;  3QBY A;  2NU0 I;  3C12 A;  1Y1C A;  3UDC A;  2KK4 A;  4C5I A;  3AHU A;  3SWN A;  2H3J A;  2JVV A;  2QEX A;  3GNF B;  4XU2 A;  2XG8 D;  3OS1 A;  2DXB A;  4C92 F;  3DKM A;  1YIT A;  4JCV E;  1W4S A;  4ATO A;  4NOY A;  3NTH A;  5LJ3 h;  3RMQ A;  3V8L A;  3SWN C;  2LTO A;  3E19 A;  1M90 U;  4OVO A;  5CKH A;  3CMA A;  4M7A F;  4XU3 A;  2E6N A;  4M7D F;  2E41 A;  5JHW C;  2B8T A;  2MWO A;  3OYL A;  4OP0 A;  2ZPE B;  3QWP A;  1KHI A;  1R0R I;  2L3R A;  1YI2 A;  2RHU A;  3LYI A;  4N4G A;  1KQS S;  4RCC A;  4GY5 A;  4E47 A;  2EQU A;  4FT4 A;  2PU9 B;  1Q81 C;  1Y1B A;  4M77 D;  3G4S A;  2CZ7 B;  1NUB A;  4XK8 E;  2IVW A;  1UVG A;  3FB9 A;  2L89 A;  4M75 G;  5GAN g;  1YIJ A;  4SGB I;  2W0T A;  4HCB A;  2EFI A;  3I55 T;  2EQM A;  4YTL A;  2V1C A;  3OA6 A;  3C94 A;  1S72 T;  4RCB A;  2QQ0 A;  3CCM T;  3BFM A;  2EQK A;  1G3W A;  3RKX A;  3CD6 T;  3CCE A;  3OYE A;  4LDV A;  5LJ3 d;  4E7L A;  1VQP T;  4OB2 B;  5KH6 A;  4OB0 B;  3BW1 A;  3OXL A;  1N13 A;  1PSE A;  3KXT A;  5LJ5 f;  2WSC E;  1PPF I;  3JB9 H;  3T9N A;  3QJY A;  2E5R A;  3X28 B;  4B6D A;  2ZZD A;  1EN7 A;  1VQO A;  2KVQ G;  3JSC A;  3VDP A;  3CC4 A;  2YLB A;  2QA4 T;  4C0D C;  2FVU A;  5A0G A;  2XDP A;  4PNO A;  2PUK B;  4EMG A;  1FAR A;  2DJZ A;  3QHS A;  4BI3 A;  3MP8 A;  5GAN 6;  1K9M C;  4XTU A;  2CZ0 B;  2M9U A;  3KBG A;  2YRV A;  3M59 A;  1Y96 A;  4LD9 K;  3JAM E;  1VQ6 T;  1BMO A;  2GCX A;  3CEY A;  1U1S A;  1TUS A;  4OB3 B;  1VQ8 A;  2RK2 A;  3VV0 A;  1MGQ A;  3GF5 A;  5I2S A;  2DB6 A;  1Z7K B;  3UWN A;  3V8J A;  1TBQ R;  1QVP A;  3LLR A;  5FU6 B;  2JNG A;  3J7A F;  1D3B B;  4N0A A;  4QQD A;  4HT8 A;  2R5A A;  3RKW A;  1YIT T;  2YLC A;  1Q82 C;  1VQK A;  4L5G A;  3QYH B;  4GLK A;  4XQ3 A;  3LWH A;  4A4H A;  4B9X A;  5DM7 R;  3L42 A;  4JRP A;  3JCM h;  3CMA T;  4JRK A;  1XQH A;  3S3N A;  2XDD A;  3QII A;  3CCV A;  2R5M A;  2E1H A;  1LNX A;  5CAI A;  1YI2 T;  5GAM j;  5D6Y A;  4L6V 5;  4M77 C;  1E7D A;  4RG8 A;  4PJO D;  4JLI A;  3GNG A;  2KAF A;  2DD4 A;  4HCC A;  2E64 A;  4JS5 A;  2DAQ A;  1UGS B;  3QG1 A;  1V1I A;  1DS3 I;  3DB4 A;  3M57 A;  1SGE I;  3OW2 A;  2LT1 A;  3UEY A;  1PJU A;  4V2S A;  1YIJ T;  3L2R A;  1M8B A;  4FU6 A;  5LJ5 h;  3KY9 A;  4IKF A;  2HBP A;  2E73 A;  1I81 A;  2LC4 A;  2UZ3 A;  1VQ9 T;  1MHN A;  2DEQ A;  2EQJ A;  2ENZ A;  3ZBD A;  4CI0 C;  1B34 A;  3G71 T;  5FRN A;  4LDX A;  5IT9 E;  4BY6 B;  2QPO A;  5GAN 4;  1BYM A;  2LNV A;  1KG1 A;  2CKK A;  1X6O A;  4M77 G;  4F7U A;  1W4R A;  5A0D A;  2DPP B;  3EFS A;  3UPU A;  3JCM d;  2RH2 A;  1SGQ I;  1PTQ A;  3X24 B;  4BE1 A;  3UGL A;  4BI4 A;  4A4K A;  1M1K U;  2BUD A;  1XX6 A;  1VQO T;  1H3Z A;  1VQN A;  2M0O A;  3SEK C;  4M78 D;  4A54 A;  3OW2 S;  4KUD K;  3RMS A;  1KD1 C;  3HFO A;  4KBM B;  3UT1 A;  1M8V A;  2KMQ A;  4M75 D;  2KCX A;  1BIA A;  4BB7 A;  1CE3 A;  2JN0 A;  4XTV A;  5KCH A;  2FHD A;  3OVO A;  4M77 F;  1NPR A;  2NU4 I;  5CO7 A;  5GAO m;  1CGJ I;  3X26 B;  1XBT A;  3DLM A;  4J6Y A;  3DLL A;  1N6A A;  2X4X A;  4JUV A;  3CCU A;  4BE2 A;  2YQP A;  2VC8 A;  1W2B S;  1HJA I;  1E7L A;  5LJ5 d;  1KHC A;  2A3L A;  2RB6 A;  1QP3 A;  1YBY A;  4FKD A;  1YJN A;  4F7U G;  5EX3 A;  1JRI A;  5CVI A;  3GIB A;  2Y4X A;  2D0Q B;  4XU1 A;  3GLX A;  3A8L B;  1WGS A;  3OL0 A;  4IUR A;  1VQK T;  5CCM A;  4Y91 A;  2KY9 A;  2KSS A;  1K8A C;  3OY9 A;  1CT2 I;  4A53 A;  2ODD A;  3CCR A;  2D6F A;  3M9Q A;  4OVA A;  3PIP A;  4HKE A;  4XTW A;  4EMK C;  1LR9 A;  1U5K A;  3HFN A;  1V1H A;  4QVD A;  1YHQ A;  4C5E A;  1R8O B;  3OYY A;  2HNI A;  4HCZ A;  4XAX B;  3CCJ A;  4PJO C;  1HK9 A;  3I56 T;  4PKC C;  3JRZ A;  3OQ5 A;  2QQE A;  3G6E A;  4C5H A;  1XTD A;  5A0L A;  2LEO A;  5LJ5 g;  2NU2 I;  3GPL A;  2RJC A;  3PGG A;  4PLL A;  2XDB A;  5GMK i;  1W3S A;  2JZM A;  1XA6 A;  5CKD A;  3RKY A;  2N1A B;  2K5F A;  3M54 A;  1GXI E;  3JCM P;  2PUO B;  3TCJ A;  3PT9 A;  1OYV I;  2EJ9 A;  1WJS A;  3QJ6 A;  1VQ5 A;  5A2Q E;  3CXL A;  4PJO G;  3VKI A;  3PTA A;  3WVE B;  1NPP A;  2N17 A;  2XKO C;  2DXC A;  1KQS A;  2FYK A;  1BI1 A;  3B4V C;  2R58 A;  3QZ9 B;  2E5Q A;  5C0M A;  3HSB A;  4LDW A;  4M78 C;  3M4Y A;  2F69 A;  2JOY A;  4N4I A;  4EMH A;  1VQN T;  2RI2 A;  1Y07 A;  5FU7 B;  1G5V A;  3A8M B;  5GAN j;  3CCL T;  2K3X A;  4M75 C;  5GMK j;  3X25 B;  2OAU A;  2QI2 A;  3SGQ I;  4J8O A;  3CCQ A;  4N4H A;  1EIF A;  3OBY A;  2JXD A;  4IUT A;  2LX9 A;  3FEO A;  3KUF A;  2QQR A;  1TBO A;  4PJO F;  1UGQ B;  2RHY A;  1VDD A;  2E65 A;  4UXH A;  4ZN3 A;  2EYQ A;  1KC8 C;  2XID A;  1D3B A;  2VXE A;  2M5X A;  3CCU T;  4C8Q D;  4E7H A;  2QTX A;  4ZTJ A;  3CC2 A;  4HGU A;  1LR8 A;  4RMO A;  2XD0 A;  2WSF E;  3JCM c;  3HL8 A;  2G3R A;  3OYB A;  4M78 G;  3A8H B;  2A20 A;  3UEJ A;  4C92 B;  3JCM f;  2GKT I;  4UXI A;  5HQ8 A;  3LH0 A;  1QVF S;  1H0Z A;  2ZCF B;  3MET A;  4J6W A;  1X74 A;  4OGE A;  4XTY A;  3CCS T;  1QVG S;  2P0K A;  4C92 E;  2ZGW A;  4M7A B;  3MEU A;  3VUB A;  5GAN e;  5GMK e;  4M7D B;  3MCA B;  4ELY C;  1G3Y A;  2BKD N;  1CGI I;  1N8R U;  3P8D A;  2J9R A;  3F70 A;  2V8J A;  3CC7 T;  4KUI A;  2NU3 I;  3CPW S;  2VV5 A;  2V1C C;  4RG2 A;  2Y4Y A;  4M78 F;  3CBP A;  2QXF A;  3TU4 K;  1YHQ T;  2LDM A;  3CCJ T;  4M7D E;  1VQ7 A;  5GAO n;  1M4Z A;  5IAY A;  4M75 F;  3CXC A;  1K73 C;  2RJF A;  1X4S A;  3M58 A;  2B8A A;  2ZPF B;  2PQW A;  1Q86 C;  2K3Y A;  4O5V A;  5HK3 A;  3JB9 J;  1BI2 A;  1ZQ1 A;  1OZ2 A;  2M1H A;  4ME7 A;  3O8V A;  2RHZ A;  2NU1 I;  4C0G A;  1DS2 I;  4DOW A;  1OYX A;  1YJ9 T;  4MZM A;  2QQA A;  5DAE A;  3UGI A;  5LL6 S;  2JZ2 A;  2LVM A;  2CYZ B;  4A4F A;  4D6W A;  4ZGE B;  4DA4 A;  3CXC S;  3QXE B;  4FL6 A;  4Z02 A;  3QYG B;  3SWN B;  3SD4 A;  3ER0 A;  5LJ3 g;  4EPC A;  3N5B B;  4OB1 B;  1X75 C;  2QEX T;  4FT2 A;  3J81 E;  3P8B B;  5M9O A;  1M9S A;  2O4X B;  4LD6 A;  5CCA A;  3R6O A;  3OMG A;  4J7F A;  2HD0 A;  3DB3 A;  3E9F A;  4UC4 A;  5CK9 A;  4C8Q A;  4N0A C;  3OYF A;  3BJI A;  3LW5 E;  4MML A;  3S6W A;  4CRI A;  5FUY A;  2DD5 A;  1JJ2 S;  3M53 A;  4C8Q C;  5EX0 A;  4C0Z A;  1NJI C;  2EAY A;  2E12 A;  5FUW A;  1WJQ A;  3FJP A;  4GI3 C;  2K5I A;  5GAO q;  3SFM A;  3HH2 C;  3G4S T;  4HA8 A;  4MDW A;  3MHX A;  1SGD I;  2OTJ A;  1Q81 U;  2WVJ A;  2WSE E;  3PMT A;  1HPT A;  2LUY A;  3LGL A;  2XRC A;  1TGS I;  4L9M A;  1TH7 A;  2ZPI B;  2ARP F;  1UGP B;  3C4S A;  1VQ4 A;  1JBM A;  2LT4 A;  2V8K A;  4C8Q G;  5GAN f;  4E7K A;  4ELZ C;  2PVG B;  1TUR A;  5C6S A;  4Y28 E;  4C0D B;  3CCE T;  3OYH A;  4QVZ A;  1W2B A;  2K57 A;  2K5L A;  5J3B A;  1MT1 A;  2ZPG B;  1YJW A;  2JTM A;  5FRO A;  5GAM e;  1Q7Y C;  3CC4 T;  2RO0 A;  1VQM A;  4X34 A;  5DLO A;  3JCM W;  2LCC A;  4NL3 A;  4BD3 A;  4C8Q F;  2B0U C;  1VIF A;  4FM4 B;  3OSV A;  5CKE A;  4ZTF A;  2SGE I;  4WF2 A;  1Y96 B;  4OGC A;  3BDU A;  5I21 A;  1M90 C;  1IY6 A;  4LDY A;  3E59 A;  1OMT A;  4BDZ A;  2AHJ B;  2DIQ A;  2GQV A;  2GFU A;  3OS0 A;  1VQ8 T;  2YHT A;  4IUP A;  4L59 A;  1VQL A;  3PMI A;  4NL2 A;  1FWZ A;  1N9R A;  5LJ5 j;  4E7J A;  2E10 A;  1TBR R;  2DVE A;  5GAO l;  2DTH A;  3S3O A;  1JB0 E;  3EFR A;  3JCM g;  1I5L A;  2GFA A;  1SSF A;  2OD1 A;  1IW4 A;  4JRQ A;  2IG0 A;  5DLQ E;  2ERW A;  4M77 B;  2OTL A;  1Q82 U;  1N9S A;  2QQC A;  4E1P A;  3GOX A;  2CGH A;  2V8I A;  3QSU A;  2E6Z A;  4F7U F;  3CCV T;  4M77 E;  4JS4 A;  3I55 A;  4II1 A;  1M1F A;  4PL6 A;  2SGQ I;  3CCM A;  2LCL A;  3Q1J A;  5GAO r;  4J6X A;  2P0P A;  5GAN h;  5GMK h;  4M7D A;  3QO3 A;  4J5Y A;  3NTK A;  3HHT B;  3V7R A;  2MMP A;  2WCY A;  2VXF A;  4ZN1 A;  2RJD A;  1HXD A;  2QNF A;  3WXM B;  1CSO I;  4PLI A;  2KMR A;  2KMT A;  4BAC A;  1B34 B;  2Y90 A;  2P4T A;  2VRW B;  2QA4 A;  3L2W A;  3CME A;  2JTF A;  5KCO A;  1RL2 A;  2JW6 A;  3PDN A;  3UGD A;  4FSX A;  2J87 A;  2LQ8 A;  3CBM A;  3ME9 A;  5HK0 A;  5GAO p;  5FUV A;  4Q5W A;  2VGM A;  5J26 A;  1G3S A;  1SGR I;  1TIH A;  5IN1 A;  1QW1 A;  1TBN A;  1YJW T;  1VQ6 A;  5AYF A;  1G3T A;  5DY9 A;  3QTL D;  2EKO A;  2RK1 A;  1OI1 A;  1O9S A;  2L8E A;  2RJE A;  5GAM f;  3JCM b;  1M1G A;  3VU3 C;  1FXX A;  5GMK m;  4QW2 A;  1U8R A;  1QVF A;  2JYY A;  3LGF A;  4BE0 A;  1QVG A;  3VJP A;  1KD1 U;  5D6W A;  2WAC A;  5GAN d;  1RFH A;  2PVD B;  2I2L A;  1VIE A;  1FX7 A;  4J83 A;  3HRS A;  2QDY B;  3E2I A;  2MF2 A;  1LR7 A;  5GMK l;  5KE3 A;  3L2U A;  3OS5 A;  2XI9 A;  4X9C A;  4NS5 A;  3ZFJ A;  3CPW A;  2O4X A;  1UUC A;  2JA1 A;  3QKJ A;  3JCM X;  5CKB A;  1VQL T;  5FU6 C;  1IY5 A;  5CR2 A;  1LOJ A;  1YJN T;  4MDX A;  1LJO A;  1WQ7 A;  1I8F A;  3JB9 D;  3QZ5 B;  5HKC A;  3QPH A;  2ROW A;  1BI0 A;  3EAE A;  4QQG A;  3PNW C;  5CQY A;  3OYG A;  4EMK B;  1I4K 1;  2RHX A;  3NTI A;  4ZGJ B;  2N52 A;  1KQ2 A;  1BI3 A;  3JB9 I;  3FRN A;  3HKS A;  1IRE B;  1WNL A;  4PJO B;  2DIG A;  1KQ1 A;  2OTL T;  3MEA A;  5J39 A;  3CCR T;  3PIO A;  2L7X A;  5CIU A;  3CBO A;  4JDS A;  1K8A U;  5EG2 A;  4PJO E;  1UEB A;  2KQW A;  3RUX A;  4M7A E;  2BUS A;  1OMU A;  2F5K A;  1VQ9 A;  3NFC A;  1BKB A;  3BY7 A;  2QQ9 A;  5LJ3 j;  1U1T A;  3M56 A;  3M4G A;  3G71 A;  3G6E T;  4C0F A;  2BIV A;  2DTI A;  5D6X A;  4HT9 A;  3OSS C;  3INZ A;  3C95 A;  2DO3 A;  1XNI A;  4MZP A;  4QVC A;  3ASK A;  2SGD I;  3RU0 A;  2EWN A;  3J80 E;  1M1K C;  2MI6 A;  3HRU A;  4KT0 E;  4J7I A;  2K9H A;  3TEE A;  3H6Z A;  2ELI A;  1PCE A;  3A8O B;  4BY6 C;  3RER A;  1WQW A;  3CME T;  2DK3 A;  2N71 A;  5GAM h;  2GF7 A;  2RA2 A;  5FRM A;  3MEW A;  2DXT A;  4M78 B;  5FLX E;  1VQ5 T;  1JJ2 A;  3RES A;  3E1S A;  1OVO A;  1Y8F A;  2VGN A;  4M75 B;  3OYD A;  2EJG A;  3LX7 A;  4RKU E;  1Y71 A;  4R55 A;  4XU0 A;  4M78 E;  3V7C A;  2HAX A;  2ORV A;  4IUV A;  3URG A;  4M75 E;  3ZEH A;  5LJ3 e;  5L8R E;  5HI7 A;  3TJQ A;  3P8H A;  5GAN 8;  1FYB A;  1UVF A;  4MZT A;  3CCQ T;  1SGY I;  2X35 A;  4P5N A;  2NLU A;  1TOT A;  3JCM J;  3BDL A;  4A24 A;  4DQ2 A;  3OYM A;  2K2V A;  1SGN I;  4A4G A;  3OYN A;  3HPW A;  3FDR A;  5KE2 A;  1CT0 I;  2DIP A;  3TRE A;  3GP8 A;  1KC8 U;  2RI3 A;  1WPY A;  2KDS A;  3CC2 T;  1Y7X A;  1ZHI A;  2XK0 A;  2CJS C;  4B9W A;  4M77 A;  4BUG A;  2HQE A;  2QNC A;  4C92 D;  2DZ9 A;  1M8C A;  5GAM d;  2XU8 A;  2DZC A;  3H8Z A;  3L2Z A;  3MO8 A;  3OMC A;  5CCL A;  2FB7 A;  3OYJ A;  2V53 A;  2CZ6 B;  3MEK A;  2E70 A;  3I56 A;  5GAN 7;  2GVI A;  2D9T A;  4UXJ A;  4M7A D;  3FLG A;  3MEV A;  2M16 A;  4M7D D;  3OBW A;  2P0Q A;  3OYI A;  1YTP A;  1KBF A;  2KMP A;  1FAQ A;  3JCM V;  2CS7 A;  2DKG A;  3S3M A;  1PSF A;  3E9G A;  2ZPB B;  2FL7 A;  2C06 A;  4OF1 A;  4ZGD B;  3OYC A;  1KMA A;  1VQ7 T;  3QUI A;  3JB9 G;  1OZ3 A;  2ZPH B;  4JLG A;  2MWP A;  5GAN 5;  3A5Z B;  2SGP I;  2GKR I;  1K73 U;  2LQK A;  4A4E A;  2ORW A;  2X4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...