3GOXA

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i in the absence of edta
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease Hpy99I
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3goxA01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3goxA02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3goxA03
4N4IA 3DLMA 2R5AA 4HCZA 2CKKA 2LDMA 3OYKA 4A4HA 4QQDA 3O8VA 3S3NA 3LX7A 2DIQA 3EAEA 4BD3A 5FRNA 2RHUA 3QIIA 2M1HA 3LGFA 3LGLA 2L89A 2RI2A 2BUDA 1MHNA 2WACA 4A4GA 2R5MA 3OYLA 1WGSA 2LRQA 2XK0A 3BDLA 3NTIA 4FU6A 1OI1A 2VYTA 4UC4A 3OMGA 3P8DA 4C5GA 1H3ZA 3ME9A 4ZTFA 4NS5A 2GFAA 1XNIA 5C0MA 4E7IA 2EFIA 2HQXA 2IG0A 4E7JA 3UWNA 2B8AA 3MEUA 4PLIA 2QQSA 3Q1JA 5CIUA 3MEWA 2RHYA 3FEOA 3DB3A 4Z02A 4CRIA 3L2QA 4EDUA 2XDPA 3PNWC 3PMIA 4A4EA 1EN7A 2P0KA 5C6SA 3NTHA 2JZ2A 4A4FA 4L59A 3OS2A 4N4HA 4FL6A 2E5QA 4LD6A 2RJDA 4E7LA 2DIGA 2BKDN 3KUFA 3OB9A 2YRVA 1N27A 2RJCA 1WJQA 3MP8A 4Q5WA 2O4XA 3OQ5A 2EQJA 2FHDA 4IUTA 3OS1A 4QW2A 3OS0A 2GFUA 2O4XB 3MEAA 2PQWA 5J39A 2X4YA 3OYBA 4PLLA 2HQEA 4E7KA 1RI0A 3FC3A 4BDYA 2RHXA 3PMTA 4RG2A 4X34A 3OYAA 2QQRA 5D6WA 2L8DA 3UT1A 4OVAA 5IN1A 3SD4A 5KH6A 5KCHA 3L2UA 3GOXA 2RHZA 1E7LA 3H6ZA 2RI3A 3OYJA 4GY5A 4BE0A 3M9QA 3META 3L2VA 1G5VA 2BIVA 3QBYA 3QKJA 3NTKA 2L3RA 3ZEHA 2RJEA 2D9TA 5IAYA 3MP6A 2JTFA 4C5HA 1KHCA 1OZ2A 2EQKA 3PFSA 2RO0A 4C5EA 2E6NA 2M16A 3ASKA 1WJSA 3E9GA 3E9FA 4B9XA 3OA6A 3S3MA 4BDZA 2QNCA 3OYEA 2G3RA 4IUUA 5FRMA 2X4XA 2K3XA 3CEYA 4QQ6A 5KCOA 3OYIA 4C5IA 4BE2A 4IUPA 2GF7A 4E7HA 3P8HA 4PL6A 1E7DA 5FROA 5KE2A 3OYCA 1OZ3A 3OYMA 1WJRA 3S6WA 3MO8A 2EKOA 4BACA 2LVMA 3FDRA 4QQGA 2LTOA 2X4WA 2MWPA 3OY9A 3OYHA 3S3OA 4IKFA 2F5KA 2RJFA 3MP1A 3OYFA 2RI5A 5M9OA 3F70A 3LYIA 2R58A 3H8ZA 3L2WA 4IUQA 2QNFA 3LH0A 2EQMA 3C4SA 2M0OA 2LCCA 2EQUA 2K3YA 4BE1A 4N4GA 4QVZA 3OMCA 2MWOA 3OYGA 5KE3A 3L2RA 3FLGA 3LLRA 3OYDA 3MEVA 4B9WA 4IURA 5D6YA 2NLUA 4II1A 1SSFA 2RHIA 1OYXA 3DB4A 3L42A 3QJ6A 4IUVA 2R57A 5D6XA 5J26A 3OYNA 4ZTJA 2X35A 2DAQA
chains in the Genus database with same CATH superfamily
3EG0A 3VKIA 4N4IA 1OVOA 3OXLA 4A4HA 4ZGEB 2L7XA 3B4VC 1TG0A 2ZZDA 1RUWA 2MYSA 2JJ9A 2FB7A 1W2BS 2NUPA 2DF6A 2MCNA 2P84A 2V8IA 2CP7A 2YRCA 2RH2A 4Y91A 4F17A 2COYA 5CAIA 4L5GA 1B07A 2ZGWA 3OMGA 4FM4B 4BB7A 1QP2A 2RM4A 5GAMg 3JCMQ 3FRNA 2NU2I 1ZBJA 3CMEA 2B8AA 4RKUE 2OTLT 3MEUA 1VUBA 4PLIA 2QQSA 3Q1JA 3C12A 4BUGA 3MEWA 3EG2A 2LT4A 3L2QA 2GIVA 1QCOA 1JQQA 5LJ3h 3OVOA 2K2VA 4C0ZA 2E5QA 5FUVA 3X20B 4JZ4A 2OTJQ 3H0IA 1M90R 1D09B 2AK5A 2FHDA 4F14A 5HCKA 3BFMA 1NG2A 4P5NA 1M1KC 5CKBA 3VU3C 4FYVB 2DL4A 2VV5A 1YJ9Q 1BUSA 1BMOA 2NU4I 2IVWA 1VQ7A 2BIVA 4FYXB 2HD0A 4C92D 3DLLA 2EAYA 2GNCA 5GAOq 2JS2A 2RQTA 1G3SA 3CPFA 4B9XA 2DD4A 2D8HA 1WKXA 1SHGA 1M2OA 3V7SA 3GP8A 1XJWB 1C0MA 3VS6A 2ECZA 2K5FA 1Y0MA 1E6GA 4RTYA 1JB0E 1VIFA 3EH2A 3LYIA 4XK8E 1AZEA 1E6HA 1TUDA 2L2PA 2OTLQ 1NPRA 1MJAA 3BDUA 3FLGA 3KBGA 2KMPA 1Y57A 3M58A 4B9WA 1SGRI 3M56A 2DZCA 4JRIA 4M7AF 2ODDA 3OYNA 4AFSC 2DE0X 4ZTJA 2DAQA 2DMOA 2CWHA 2R5AA 4EMHA 1Q81U 1PRLC 4PJMA 1M5Q1 2M51A 4J9DA 5CQXA 2KMRA 3OYLA 2NUPB 2OU2A 3UEJA 3QG1A 3TU4K 1X6BA 3E2UA 3BY7A 4M77E 3D00A 3R5BA 4JPBW 3DB3A 1E7OA 2O01E 3TO7A 2XDPA 5DAEA 2Y4XA 2E70A 4KGZB 1NLOC 2HSEB 2YRVA 3JCMg 3OBYA 3MP8A 2BE9B 2LQ8A 3I5RA 1NE8A 2E5RA 4PJOG 1RI0A 2QASA 4M77C 3RU0A 9WGAA 2QQAA 1VYVA 1VQ4T 5I21A 2L8DA 5J3BA 4L6V5 3SD4A 4E2FB 4HVWA 2RQRA 2CYZB 2MF2A 3META 1YWPA 4HT9A 1G5VA 1PPFI 2BZYA 2O88A 1VQLA 1FYBA 2JTFA 2QQCA 2ZPBB 1Q7YU 3E9FA 1YHQT 1K8AC 2LZ6B 1FMVA 3OYEA 1PM3A 4B6DA 4ZN1A 2UVOA 1CSKA 2QAZA 1X2KA 2EKOA 3FDRA 3S3OA 4HT8A 3EHRA 1MJBA 3M0TA 1M3BA 3H41A 4C92E 1HYOA 1K9MR 2H8HA 3EG3A 2QEXQ 1ZA1B 1UECA 1ZUUA 2KMQA 1VQ9A 3SGBI 2BZXA 2X35A 4J7FA 3OL0A 3M59A 3V8KA 4HCZA 1G83A 4QQDA 3CCMA 2QA4T 4JUVA 1WGTA 1Q82C 3JB9F 1QWEA 2AZVA 4M77B 1SGQI 4UC4A 4M7AG 2DILA 2A0FB 2RQVA 2MIOA 4RG8A 4FW2A 2O2OA 4RMOA 3L2ZA 1JXMA 2Y0MA 4RUGA 3FEOA 3TQ7P 1YHQQ 1EN7A 5C6SA 1K1ZA 3OXFA 4FKDA 2AT1B 1M90C 1QVGP 1LVKA 3ZL7C 2EJFA 3CBOA 4XU2A 3OSSC 3OS0A 1ZUKA 2FG0A 1S1NA 4PLLA 3G6EA 1N5ZA 4OF1A 5D6WA 1M27C 1U3OA 5IN1A 3UA6A 1VQOT 9ATCB 7AT1B 1SGDI 4V2SA 1QVFP 1K73R 1SGYI 3QO3A 4O6JA 1JBMA 4C5EA 2MOXA 3VS0A 2XI9A 1VQ8T 1YBYA 2XU8A 1PD0A 3NGPA 1UGVA 1NYFA 2P4TA 2RD1A 4OB1B 4ZNXA 2EWNA 2DJZA 2X9HA 3CCUT 3X25B 2VXFA 4F16A 2ED1A 4M77F 2CZ0B 4ELZC 2WSEE 1CSOI 2PVOB 4MMKA 2W0TA 3L2WA 3UF4A 1GL5A 4LDXA 3UOEA 4ORZA 2YSQA 3HFNA 1ZSZA 3G71T 1M2VA 3CC4T 4JRQA 4KGXB 3LWIA 1UJYA 1VQPA 1B3QA 5FU6C 2DNUA 5KYNA 1PTQA 3CBMA 1VQKQ 1TBNA 3LH5A 2JXBA 2LDMA 1WYXA 2HBWA 3UPUA 1TURA 2JN0A 2OJ2A 1B7TA 2F5TX 4JDSA 1MUZA 1WTJA 3QPHA 3CC7T 2E3HA 5GAOp 3X24B 2A37A 2DVEA 1VQOQ 2CUDA 3CCST 3CCET 2J05A 2LJ3A 2HQXA 3UWNA 2ROWA 4OVOA 1WPYA 2VC8A 1UUEA 2ZPGB 3M0QA 4LDVA 5FUWA 3JCMX 3I5SA 5GANg 1M4ZA 3MCAB 3D7SB 4GLMA 3JB9G 2DIGA 2MK5A 3OBWA 2RA2A 4M75D 4RTWA 3SWNA 3QSUA 4C92F 1KK7A 1SKUB 1M9SA 5J39A 2E65A 3QJYA 3X28B 1PKTA 1CHOI 3VS7A 3E19A 3G71Q 1Y7XA 1WX6A 1AWWA 2VKNA 2FO0A 1GCPA 2EYQA 2L3RA 3M0UA 1V1HA 5FU6B 1Q86R 1WXTA 1OZ2A 2D0NA 5JHWC 2ORVA 1WJSA 3OA6A 3I55Q 1K76A 3S3MA 3CD6A 1N9RA 2LJ1A 2FPFA 2K3XA 3GLXA 3RKXA 1SGEI 1FYNA 2KYMA 4E7SA 5KE2A 2KRMA 5LJ3g 5ECAA 3CC7Q 3J7AF 2LX7A 1M1FA 3QYHB 1X69A 1Y1CA 3CCEQ 3TJQA 1S72T 2R58A 4IUQA 1QW1A 1VQ6A 1IGUA 4QVZA 2RK1A 4JZ3A 3CMEQ 2CS7A 1M2VB 4FYWB 4GI3C 4J83A 1J3TA 2QQ0A 5CR2A 1RABB 1IHVA 3L42A 5I11A 3PIPA 3JCMJ 4M77G 1ZA2B 2K9GA 2DYBA 2JTEA 2DXBA 1VQNA 1YIJT 3KFVA 2EYWA 4FIBA 3T9NA 3LX7A 3GBQA 2JM9A 1WIEA 4BD3A 4EMKA 1KQSA 2M02A 3CCLA 2LRQA 2GTJA 1KQSP 1OI1A 4HVUA 4F04B 4C5GA 5A0GA 3G4SA 3C0CA 4LUEA 2GKRI 3CCJT 3QWYA 3L1AA 5DY9A 3R5DA 3BE3A 2QYZA 4X9CA 5IHIA 4QKUA 3PDNA 2FRWA 5CIUA 1NJIU 3CMAT 1CT0I 2A7YA 4CRIA 3EG1A 1X27A 1VQ5T 3OS5A 2OZUA 3M4GA 2KMOA 1P9ZA 1RAGB 1TS9A 3SWNB 1K7TA 5KYYA 3MEAA 2J6FA 2PQWA 4BI3A 1RAFB 1S72Q 1BI3A 3VUZA 4MZPA 2FZGB 4LDUA 4C8QE 1WHJA 4FT4A 5A2QE 1WQWA 1CT2I 4M7AA 2QPOA 1E7LA 3A1PA 3L2VA 2MMPA 3ZEHA 3R5AA 2D9TA 4C92G 5IAYA 1Q95G 1XQHA 2V8JA 3AT1B 4M75E 2K3BA 5L23A 2WSCE 1TBOA 1PSEA 4DQ2A 1YIJQ 3UDCA 3FJ5A 2LJ0A 4DBQA 1BIBA 4DA4A 3M54A 3ULRB 1VQMA 5FROA 2KQWA 1WJRA 1TIHA 2COWA 1KD1R 4FSSA 3CCQA 3MP1A 3H8ZA 3R5CA 4M75C 4DEXA 2CP6A 2M0OA 3AHUA 1UGPB 2QDLA 2JUFA 1N8RR 1TTHB 1YJNA 3OYGA 3CMAQ 4M7AC 4DOWA 3FSYA 2QDYB 5D6YA 4II1A 5D6XA 1K8AR 5I22A 3R6OA 3MHXA 1NLPC 1X6OA 1B34A 5GAOn 2ZCFB 1QKWA 1D0ZA 3HRSA 3CXCS 5FRNA 1P9GA 4KULA 4EMKB 1S20A 1PJUA 3JAME 8AT1B 2YHTA 3P8DA 4ZTFA 2GTOA 4AFUC 2FNFX 1Y07A 1I8FA 3UATA 1YI2T 1AOJA 3RDVA 2ENMA 1VQLQ 2VGMA 3I56A 3PNWC 5FUYA 4Z8AA 2KT8A 4O5VA 2KY9A 1R77A 1WI7A 3CPWS 2BKDN 2E4HA 1WFWA 2X3TA 2EQJA 3GNGA 1LJOA 1Q82R 1GCQA 5KYYB 2DBKA 4RTXA 1OPLA 1UDLA 1Y1BA 5E3RA 1V1CA 1N6AA 4QVDA 3UFFA 5AYFA 4JS4A 2LUYA 1V76A 1MJ9A 2Y90A 3A8OB 3M9QA 4M7AB 1Q86C 2DIPA 5A0DA 3GIBA 3OW2S 5GJWB 2YXYA 2F2WA 1TBQR 3G1JA 1ZSGA 2LT1A 4HXJA 5CKFA 1CKAA 3VS3A 1TWBA 2BUSA 1QVPA 1QMCA 2DZ9A 3NMZC 4J9EA 1GCQC 2MWPA 1DJ7B 3UGDA 1RAAB 2PUOB 1LR7A 5GAN7 1YI2Q 2DL7A 3SHWA 5KE3A 4PJLA 4LDWA 1ULNA 3CBPA 2E6ZA 2CT4A 5GMKe 2HKNA 3CC2A 2MPXC 5J26A 3NHNA 1TUCA 1VYTA 3QAHA 4J9GA 3NPFA 2YUNA 2EQIA 1B34B 4C8QF 3RKYA 4IIOA 2A20A 2WSFE 5CCLA 3GNFB 2BZ8A 3OYYA 1SGPI 4M75F 1YJWA 2DXUA 4E1RA 1WZOA 4E7JA 2ELIA 2E41A 2A28A 2ABLA 1TSFA 4XU3A 4MMLA 2L0AA 4A54A 1U8RA 3RMQA 5LJ5j 1OX8A 4M77A 1MNEA 5GJVB 4Q5WA 1AVZC 2RNAA 3JCMV 1KC8U 3UGLA 1QWFA 2DM1A 1D3BA 1W4SA 3JSCA 4KH0B 1TXQA 1PZWA 2QQRA 3UEYA 5GAN8 4WP4A 2EYXA 1WXUA 1FXXA 5CKHA 2QEXT 4EIKA 3TO6A 4D8DA 4CI0C 5EX0A 3NTKA 5IXFA 1VQPQ 2YUOA 2SGEI 2DYIA 1AHJB 1UEBA 2I2LA 1LNXA 3DKMA 3VS1A 2VVKA 2CT3A 2HCKA 1OU9A 2EVRA 4NOYA 4E7HA 1OZ3A 4R55A 1KD1C 3KXTA 3VDPA 1QQJA 1NEGA 3CCRA 1FWZA 2CZ6B 5GMKj 1JJ2A 1TBRR 2L3QA 1JJ2P 5GAOr 1N8RC 3LH0A 3BJIA 2EQMA 3C4SA 2L3SA 2YLBA 2YRDA 4SGBI 1LCKA 1K7UA 1T3LA 1JO8A 1M30A 1NBEB 2P0QA 3M0PA 1ZLMA 3CQTA 4IUVA 2V1QA 4C92A 1PWTA 2HEQA 4ME7A 1WHKA 2LQNA 2GKTI 2CWFA 2JVVA 2CKKA 3MPUB 4OMOA 3ER0A 1KBEA 2KEAA 3VS5A 4HCCA 1GFDA 1KFZA 2M1HA 4AMLA 4PJNA 1XX6A 1KMAA 2LQWA 1ACMB 4OMMA 3EGUA 5HI7A 2B86A 1Q81R 2XKOC 5C0MA 3EH1A 3QXEB 2PUKB 1W3SA 2F1LA 4PKCC 4C8QG 1TOTA 4HVVA 3JCMP 4F7UE 5GAMj 2P0KA 2JZ2A 2OX7A 4L59A 1YP5A 2JOYA 2Z0WA 4J7IA 4C92C 3CD6Q 2RJDA 1IY6A 1R0BG 1HJAI 1LR8A 2QI2A 4M75G 3WVEB 4Y28E 3WXMB 1BI2A 1H8KA 4IUTA 2ENNA 2GFUA 1HEVA 1M8CA 2ZAEA 1PC0A 4Z89A 2OTJA 2KDPA 2CSQA 1D3BB 2RHXA 4X34A 3OYAA 1QCFA 1SPKA 1VIEA 3CXLA 1VQ6Q 1GBRA 2HMAA 2RI3A 2V8KA 2CP3A 2YUPA 1YJ9A 1QVGA 1G3WA 1AEYA 3CCVA 1X74A 1OULA 1VQKT 2ZPFB 4Y92A 2RQUA 2M16A 3E59A 2PVDB 4KT0E 1XA6A 1KBFA 3P8HA 1UJ0A 3HH2C 3QTLD 1ARKA 3OYHA 3C95A 4IKFA 2W0ZA 1Q7YR 3CCLQ 3RERA 2DTOA 3OYFA 1WGCA 1QVFA 4J9HA 2HAXA 2DKVA 3G4SQ 1IRXA 2UZ3A 5IH2A 2LCCA 2EQUA 2JXDA 1EIFA 2ENZA 1V29B 1IREB 2MWOA 5HK0A 1AT1B 3SEKC 3OYDA 4C0FA 1ZX6A 1YWOA 2EPDA 2OTLA 1SSFA 1SGNI 1YU6C 4LE9A 4CC4B 4XTYA 4C92B 5HKCA 2V53A 1SG5A 4PNOA 4ELYC 2B0UC 5HQ8A 5A0LA 3LWHA 5GANd 3FJPA 5IHNA 2SEMA 3JB9I 2DO3A 2L89A 2XK0A 2PNIA 1X4SA 1T0HA 2FRYA 3TVTA 4ESRA 1YTPA 2DTHA 1JRIA 1NYGA 2FZKB 2AIRB 2J87A 2QTXA 2N1UA 1H641 1YITT 4KBMB 3CXCP 4JJBA 1UHFA 4J6YA 2DEQA 4XTWA 3RR6A 1BKBA 2RHYA 3I55T 4LNPA 2DX1A 3PMIA 2F69A 2LCSA 1A0NB 2KCXA 2D0QB 1NUBA 1M1KU 1ZBXA 5D7UA 2D6FA 1OMUA 3M53A 2SGDI 2KE9A 1VQMQ 4M7DD 2DERA 1MMNA 1N13A 2DTIA 2A08A 3EFSA 2CWGA 2E73A 1W2BA 4OB3B 2XG8D 2VB6A 1GFCA 4OVAA 3CMET 4C8QD 5LJ3d 4KRTA 1W2BP 4M78E 2PTKA 3VV0A 3ZFJA 1YJNQ 2J7IA 2KK4A 1RLQC 3PGGA 2DBMA 1V1IA 2K4YA 4C5HA 2EQKA 2E12A 1HDLA 1IY5A 1RI9A 4FYYB 3H0HA 1WHGA 3CEYA 2XD0A 2HZYA 1BIAA 4BACA 3EFOA 4JJCA 2X4WA 3N5BB 1N9SA 2GGRA 3SB2A 2X52A 1TUSA 1VYUA 5M9OA 3TSZA 1K0SA 4F7UF 2CZ1B 4DBRA 2J6OA 2O31A 1YITQ 1VQ7T 1AN1I 3GPLA 1K9AA 4LN2A 1FARA 2AZSA 4HCBA 2OAWA 4TVRA 2B8TA 1JXOA 2CH4A 2RHIA 1Y96B 1NPPA 4XTVA 1D0XA 3OYMA 3TO9A 3TREA 2K79A 1JU5C 2QK0A 1EX4A 1NEBA 3TSWA 2DEUA 1PCEA 2DL3A 2DETA 2L5QA 2LNVA 1Q81C 1UVGA 2WCYA 1VQ4A 3M4YA 2GBQA 2X51A 1BCMA 1QKXA 5LJ5d 3U23A 2KMTA 1UHAA 2L8EA 2NU1I 4DBFA 4EDUA 1MT1A 5GAN2 1F1BB 2EGAA 1YHQA 2J6KA 5FW9A 2EJ9A 5GMKm 5KYXA 2N52A 4WCIA 1H92A 2YLCA 2X4YA 4PJOE 3KY9A 3RBBB 2EYYA 2JZMA 1XTDA 3RUXA 1VQ7Q 1LR9A 4WF2A 2QQEA 4YTLA 1QLYA 4MZTA 1DS2I 1IO6A 2K57A 2JMAA 3QBYA 5GANe 5EG2A 2C0IA 1CGII 2XDBA 2EBPA 4OMPA 1KHCA 2DKGA 4C8QA 3CC2Q 1D1BA 2P4RA 3VJPA 4DBHA 4M7DE 5CKEA 2IPOB 4EMGA 2QQBA 1Y71A 4LUDA 5KCOA 1HJDA 2O9SA 3QZ9B 4J8OA 4M75A 3SDZA 1Q7YC 5GAN6 2QA4A 3EFOB 4HA8A 2BTTA 1VA7A 4JS5A 1UTIA 2QXFA 1YJWQ 1IXDA 4E1PA 3V8LA 1UG1A 4M7DC 2M5XA 3OMCA 1OQKA 1VQLT 3LLRA 3OXGA 2F2XA 2KAFA 1I07A 2AKKA 1QVGS 5GAN4 2D1XA 4UXJA 1HD3A 2XRCA 3I9QA 4IIMA 4C8QC 2QGGA 3C94A 1NXUA 2PQ8A 2CREA 3A8LB 4F7UG 4J6WA 5LJ3e 3O8VA 3S3NA 4M78F 3HRTA 3LGLA 4A4GA 2BUDA 4XTUA 4JCVE 3NTIA 2ROLA 3QUIA 1PRMC 3JCMb 1DS3I 1TOVA 4NS5A 3HP9A 3PTAA 3RNJA 5GAMd 1VQOA 1I0CA 1I5OB 1M90U 2YT6A 3LW5E 4JRPA 3JCMc 2I0NA 4Z02A 2E3IA 2KNBB 3WVDB 1PCXA 3OS2A 4FL6A 4E7LA 2LC4A 3OB9A 1VQ8A 5GAOl 3CCMT 2CZ7B 3JCMW 5GANj 2K2MA 1PG5B 2ZPHB 5KYXB 1NJIR 3CCUA 2HQEA 3CCRQ 2OVOA 2KR3A 1D1CA 3A8MB 2J9RA 4BI4A 3H6ZA 1T3SA 1C6VX 1XOVA 3G71A 3CC4A 2KI7A 4CC2A 1ZUYA 3EFRA 4J6XA 4J9BA 3PFSA 1TH7A 2RO0A 5IT9E 4J5YA 1QP3A 1BI0A 4C8QB 2JNGA 2G3RA 4IUUA 4PK4A 2X4XA 2ORWA 5E3PA 1U5KA 1IZ6A 4ATOA 3G6ET 2V26A 1VOMA 2LVMA 1O75A 4M75B 5LJ5e 4AG1C 2RN8A 5FUXA 2HL3A 3CC7A 1MMDA 2KDSA 3THKA 3H0FA 2FL7A 1Y8FA 1U06A 1AWXA 3VRZA 4DOVA 4BE1A 4N4GA 3CCSA 3CCEA 5LJ3j 1R8OB 1VQ9Q 3QWXX 1XBTA 2E5KA 2X3WD 1OV3A 2KT1A 3JV3A 4PJOF 2A36A 3CCMQ 5GAN3 4C0GA 2P6AC 1IGQA 1D0YA 3EAEA 2LNHB 4A4KA 2R5MA 3VUBA 3BDLA 2NUTA 2OAUA 1Z9QA 2VYTA 2SGFI 3PE0A 3EGXA 1LPLA 4M7DF 3V7CA 1SF9A 1VQPT 3ZBDA 1SHFA 2LQKA 2YDLA 5KYWA 4FW1A 1HK9A 1YFNA 3CCVQ 4M78G 3SFMA 5J8CA 5LJ5f 2FVUA 4EPCA 2K9HA 7WGAA 2RC4A 1R79A 1X2QA 3G6EQ 2WVJA 1UUCA 3JCMd 4PFOA 1RAIB 2DB6A 4KUDK 2WGCA 1KJWA 3FSXA 1MV0B 3UGIA 5DLQE 4VUBA 2FPDA 3JB9H 4HCKA 1S72A 3SEMA 3HTRA 2KROA 2RHZA 4OB0B 1CKBA 1M1GA 1WDXA 3X26B 2NU3I 1U1TA 2H3JA 4PFPA 1PTRA 5I2MA 3J80E 3H9NA 1SEMA 2RJEA 2ZPIB 2F2VA 1NM7A 3MP6A 1EZZB 2CP2A 5FU7C 5CK9A 1H3HA 4OMLA 2F3CI 4LXCA 1RAHB 2C0OA 2GQIA 4UXIA 1K9MU 1KQSS 1RLPC 2GF7A 2VASA 1YIJA 5GMKi 5GAMe 3P8BB 3MO8A 1KHIA 1AWJA 5LJ5h 2VRWB 2FYKA 5FWCA 2MI6A 1I4K1 2RI5A 2V1CA 2RIJA 3UA7A 2QNFA 4N0AA 3QHSA 5FLXE 4R56A 2LP5A 1PD1A 4OGEA 1AZGB 3MJXA 2RF0A 1ULMA 3CCJA 2CDTA 5HK3A 3HL8A 2LX9A 1WHMA 2VXEA 3G7ZA 2RMOA 1M3AA 3E1SA 4KGVB 1TGSI 3CMAA 3CD6T 2R57A 4LD6A 3INZA 1RAEB 1W70A 4K11A 1VQ5A 2ESWA 2LB7A 2DK3A 3M0SA 3M5AA 2VUBA 1JEGA 4XTZA 2DIQA 1UGRB 2HQHA 2JS0A 3QIIA 2CH4W 3LGFA 1KG1A 3HFOA 2EGEA 1PHTA 2X4JA 4XTXA 4OB2B 1VQ6T 2NUTB 2V1CC 4FSXA 4GLKA 1BU1A 4N0AC 4CC3A 3URGA 5GMKh 4QVCA 2EFIA 2IG0A 3EGXB 1G3TA 2E64A 3RMSA 2YUQA 4OMFB 2CJSC 1IW4A 5GAMf 2NYSA 2DRKA 5KYWB 1X43A 4OGCA 5FU7B 4A4EA 5EX3A 3SGQI 4AFQC 3NTHA 4JJNK 1VQNT 1HXDA 1X6GA 1BI1A 5CKDA 3KUFA 3JRZA 1WJQA 1NJIC 3HRUA 3BW1A 2JYYA 2O4XA 3OQ5A 4M7DG 4QW2A 5AT1B 1KQ2A 4F7UA 3CCLT 1K73U 3PVLA 2XHCA 1CE3A 4XQ3A 1VDDA 4MPIA 3G4ST 1FY7A 3PMTA 4OMNA 2SGPI 2JM8A 3VE5A 5KH6A 1Q9BA 3QYGB 4M78D 5CCAA 4J9FA 4J9CA 4XAXB 1RADB 2O9VA 1KC8R 2NWMA 3I35A 3A8HB 2DL5A 1RFHA 1KIKA 2KBTA 1FMKA 4QT7A 2QNCA 4RCCA 1UVFA 4QQ6A 2V1RA 4BE2A 4PL6A 5GAMh 1W4RA 1E7DA 4PFZA 2XICA 1ZHIA 3J81E 1O9SA 3HKSA 2F5KA 2RJFA 1IHWA 3RESA 2PU9B 4OP0A 1W1FA 5L8RE 1OEBA 1VQ4Q 2YQPA 3FIFA 3MEKA 4OMQA 3MKDA 4D8KA 2CP5A 3VS2A 1GXIE 3MEVA 4WTOB 5IHKA 4IURA 3JCMe 2NLUA 1YI2A 4L9MA 4KH1B 3IQLA 1K4US 1KSWA 1VQNQ 2AHJB 2H3EB 2ED0A 1BB9A 2YWWA 2JTMA 2QGFB 4JLIA 1VQMT 1CGJI 2KRNA 3V7RA 3OYKA 2FPEA 3EHQA 4MZMA 5CO7A 3CCQT 1ABQA 2RI2A 2GQVA 2EW3A 1LOJA 1PNJA 1H3ZA 3ME9A 3JB9J 3QDRB 1YJNT 1Y96A 3VS4A 3QWPA 1C1AA 1PKSA 2FZCB 1TUGB 4FCYA 1FX7A 1RL2A 5J8FA 1I81A 2HL5C 2KYBA 1K7VA 4A4FA 5FWBA 1MGQA 1MNDA 4N4HA 5I2SA 2DVJA 1OU8A 2FEIA 1N27A 2EJGA 3VYGA 2J06A 2JW4A 5IXBA 2YUUA 2O4XB 2PVGB 2N71A 1BK2A 4F7UB 3JCMf 2IIMA 1Q86U 4E7KA 4PJOD 2HKQB 1TU0B 2QA4Q 3CXCA 1Z7KB 4RG2A 1WHLA 4E6RA 4PJJA 2QQ9A 3L2UA 1R0CB 1MV3A 3OYJA 4BE0A 1U1SA 4A63B 1WQ7A 2SRCA 3I56T 3R6NA 1T0JA 2GCXA 2JT4A 2K7AA 4E47A 4BY6C 1AWOA 2KXCA 3E9GA 3TOAA 4M78A 1SRMA 5FRMA 2C06A 1YCYA 4C5IA 3CPWA 3A98A 4BI8B 3CCQQ 3CPWP 4KUIA 1BYMA 2LTOA 4B6MA 3OY9A 2VWFA 3TEEA 4XU0A 2SGQI 3RKWA 2QQDA 2HBPA 1BBZA 3L2RA 2L3PA 1U5SA 3JCMh 2D8JA 2HSPA 2CGHA 1FAQA 2M9UA 2CUBA 2K6DA 1Z2IA 3DB4A 4AT1B 3QJ6A 1ZSZC 2DJQA 4RTZA 3A8GB 4UXHA 4R0KA 3OW2A 4M78C 1VQ8Q 2DA9A 3OW2P 1RACB 1GRIA 2RHUA 3PVQA 3EGDA 1IB8A 2RK2A 1M8VA 4ZN3A 1I5LA 3CCUQ 1WLPB 2NUZA 3M55A 4FU6A 8ATCB 4M7AD 2OI3A 2ROTA 4ZGDB 1BCOA 2GFAA 4FT2A 2BE7D 1XNIA 1G3YA 4E7IA 3I56Q 4NL2A 2QEXA 3CC4Q 3CC2T 2JW6A 3VYHB 3RIRA 4BY6B 2JMCA 1EFNA 2ZPEB 2KSSA 4D6WA 3EG9A 3GF5A 3TOBA 2N1AB 1PSFA 1W6XA 4J9IA 2RJCA 3HPWA 4M4ZA 1G2BA 1JJ2S 2NU0I 3OS1A 2XIDA 1OMTA 2C0TA 3OYBA 2GKVA 2RQWA 1ULKA 3SWNC 2AKLA 3FC3A 1YJWT 1R0RI 1D1AA 4JJDA 3OSVA 3PIOA 1M1KR 3UT1A 2OD1A 5KCHA 1KC8C 2LMJA 2EKHA 1CT4I 3CCSQ 4GY5A 4PJOA 2KXDA 2DD5A 1K9MC 3QKJA 5GMKl 5KYUA 2LCLA 2XMFA 4LDYA 2JA1A 1MMGA 1KD1U 2EYZA 1ZSZB 1WA7A 4JRKA 4LD9K 3REAB 2EGCA 1HPTA 3TCJA 2M0YA 4M78B 4AFZC 4IUPA 1N8RU 1NZ9A 5E3QA 2ARPF 1WXBA 4HGUA 4MDWA 1Z9ZA 4M7DA 2DXCA 1UB4A 2G6FX 1YNZA 1ABOA 1K8AU 5HY6A 3F70A 1UGSB 3O5ZA 4C0DC 3HHTB 1WNLA 1KQ1A 4RTVA 4RCBA 4RTTA 1SSHA 2XDDA 2CP0A 4PJOC 2KVQG 2DLPA 2DRMA 2LEOA 1OYXA 2ATCB 5EC7A 2K5LA 6AT1B 1OOTA 3DLMA 2W10A 3REBB 4A53A 1ZQ1A 4CC7A 2E1HA 5CVIA 3CCRT 2MAMA 1X01A 2X3XD 2RPNA 5LL6S 3EGDB 1MHNA 2WACA 5DLOA 1WGSA 4MDXA 1UGQB 4EMKC 1OX9A 5LJ5g 2HDAA 1M8BA 1M8MA 1Q82U 1UFFA 4DNCA 1K73C 2VGNA 2ERWA 5GAN5 3JB9D 1VQKA 1WHHA 1G8XA 3VDUA 1UE9A 3FB9A 5GANf 4A24A 2KGTA 3EG9B 1YN8A 1I1JA 2QTVA 4ANJA 4M7AE 1QVFS 1K0XA 2DFUA 2A3LA 4BDYA 1GBQA 1UHCA 4ZGJB 3E2IA 1X75C 2HNIA 1VQ9T 4C0DB 3GOXA 2DL8A 5CQYA 3CCJQ 2COZA 4JLGA 4DEYA 4PJOB 2RB6A 1MMAA 5KYUB 2P0PA 2E6NA 2N17A 3ASKA 1QCNA 3A5ZB 1YCSB 4BDZA 3HSBA 1VQ5Q 2Y4YA 1P92A 4HKEA 3QZ5B 3OYIA 3OYCA 2OTJT 3S6WA 2KRSA 2QG9B 4QQGA 3VRYA 1SRLA 2DPPB 1HSQA 4Z88A 4M7DB 1OPKA 4X1VA 2CSIA 4NL3A 3V8JA 4X9DA 1M3CA 5GANh 3QDFA 2K5IA 3NFCA 5LJ3f 5DM7R 3M57A 1H0ZA 2PZ1A 2E10A 2K3YA 1YJ9T 1FMWA 5GAOm 3CCVT 4XU1A 1AD5A 3M0RA 2EIFA 4GBQA 1YITA 4AG2C 3PT9A 4RTUA 4E7ZA 1OYVI 2DXTA 2GVIA 5CCMA 4AMCA 3I55A 4M77D
chains in the Genus database with same CATH topology
3VKIA 4N4IA 1OVOA 3OXLA 4A4HA 4ZGEB 2L7XA 3B4VC 2ZZDA 1W2BS 2FB7A 4Y91A 2V8IA 2RH2A 5CAIA 4L5GA 2ZGWA 3OMGA 4FM4B 4BB7A 1QP2A 2RM4A 5GAMg 3JCMQ 3FRNA 2NU2I 3CMEA 2B8AA 4RKUE 2OTLT 3MEUA 1VUBA 4PLIA 2QQSA 3Q1JA 3C12A 4BUGA 3MEWA 2LT4A 3L2QA 5LJ3h 3OVOA 2K2VA 4C0ZA 2E5QA 5FUVA 3X20B 2FHDA 3BFMA 4P5NA 1M1KC 5CKBA 3VU3C 2VV5A 1BUSA 1BMOA 2NU4I 2IVWA 1VQ7A 2BIVA 2HD0A 4C92D 3DLLA 2EAYA 5GAOq 1G3SA 3CPFA 4B9XA 2DD4A 3V7SA 3GP8A 2K5FA 1JB0E 1VIFA 3LYIA 4XK8E 1NPRA 3BDUA 3FLGA 3KBGA 2KMPA 3M58A 4B9WA 1SGRI 3M56A 2DZCA 4JRIA 4M7AF 2ODDA 3OYNA 4ZTJA 2DAQA 2R5AA 4EMHA 1Q81U 1M5Q1 5CQXA 2KMRA 3OYLA 3UEJA 3QG1A 3TU4K 3BY7A 4M77E 3D00A 3DB3A 2O01E 2XDPA 5DAEA 2Y4XA 2E70A 2YRVA 3JCMg 3OBYA 3MP8A 2LQ8A 1NE8A 2E5RA 4PJOG 1RI0A 4M77C 3RU0A 2QQAA 1VQ4T 5I21A 2L8DA 5J3BA 4L6V5 3SD4A 2CYZB 2MF2A 3META 4HT9A 1G5VA 1PPFI 1FYBA 1VQLA 2JTFA 2QQCA 2ZPBB 1Q7YU 3E9FA 1YHQT 1K8AC 3OYEA 4B6DA 4ZN1A 2EKOA 3FDRA 3S3OA 4HT8A 4C92E 2KMQA 1VQ9A 3SGBI 2X35A 4J7FA 3OL0A 3M59A 3V8KA 4HCZA 4QQDA 3CCMA 2QA4T 4JUVA 1Q82C 3JB9F 4M77B 1SGQI 4UC4A 4M7AG 4RG8A 4RMOA 3L2ZA 3FEOA 1EN7A 5C6SA 3OXFA 4FKDA 1M90C 2EJFA 3CBOA 4XU2A 3OSSC 3OS0A 4PLLA 3G6EA 4OF1A 5D6WA 5IN1A 1VQOT 1SGDI 4V2SA 1SGYI 3QO3A 4O6JA 1JBMA 4C5EA 2XI9A 1VQ8T 1YBYA 2XU8A 4OB1B 2RD1A 2P4TA 2EWNA 2DJZA 3CCUT 3X25B 2VXFA 4M77F 2CZ0B 4ELZC 2WSEE 1CSOI 2PVOB 4MMKA 2W0TA 3L2WA 4LDXA 3HFNA 3G71T 3CC4T 4JRQA 3LWIA 1VQPA 5FU6C 1PTQA 3CBMA 1TBNA 2LDMA 3UPUA 1TURA 2JN0A 4JDSA 2F5TX 3QPHA 3CC7T 5GAOp 3X24B 2DVEA 3CCST 3CCET 2HQXA 3UWNA 2ROWA 4OVOA 1WPYA 2VC8A 2ZPGB 5FUWA 4LDVA 3JCMX 5GANg 1M4ZA 3MCAB 3JB9G 2DIGA 3OBWA 2RA2A 4M75D 3SWNA 3QSUA 4C92F 1M9SA 5J39A 2E65A 3QJYA 3X28B 1CHOI 3E19A 1Y7XA 2EYQA 2L3RA 1V1HA 5FU6B 1OZ2A 5JHWC 2ORVA 1WJSA 3OA6A 3S3MA 3CD6A 1N9RA 2K3XA 3GLXA 3RKXA 1SGEI 5KE2A 5LJ3g 3J7AF 1M1FA 3QYHB 1Y1CA 3TJQA 1S72T 2R58A 4IUQA 1QW1A 1VQ6A 4QVZA 2RK1A 2CS7A 4GI3C 4J83A 2QQ0A 5CR2A 3L42A 3PIPA 3JCMJ 4M77G 2DXBA 1VQNA 1YIJT 4FIBA 3T9NA 3LX7A 4BD3A 4EMKA 1KQSA 3CCLA 2LRQA 1OI1A 5A0GA 4C5GA 3G4SA 2GKRI 3CCJT 3L1AA 5DY9A 4X9CA 3PDNA 5CIUA 3CMAT 1NJIU 1CT0I 2A7YA 4CRIA 1VQ5T 3OS5A 3M4GA 2KMOA 3SWNB 3MEAA 2PQWA 4BI3A 1BI3A 3VUZA 4MZPA 4LDUA 4C8QE 4FT4A 5A2QE 1WQWA 1CT2I 4M7AA 2QPOA 1E7LA 3L2VA 2MMPA 3ZEHA 2D9TA 4C92G 5IAYA 2V8JA 1XQHA 4M75E 2WSCE 1TBOA 1PSEA 4DQ2A 3UDCA 1BIBA 4DA4A 3M54A 1VQMA 5FROA 2KQWA 1WJRA 1TIHA 3CCQA 3MP1A 3H8ZA 4M75C 2M0OA 3AHUA 1UGPB 2JUFA 1YJNA 3OYGA 4M7AC 4DOWA 2QDYB 5D6YA 4II1A 5D6XA 3R6OA 3MHXA 1X6OA 1B34A 5GAOn 2ZCFB 3HRSA 3CXCS 5FRNA 4KULA 4EMKB 1PJUA 3JAME 2YHTA 3P8DA 4ZTFA 2FNFX 1Y07A 1I8FA 1YI2T 2VGMA 3I56A 3PNWC 5FUYA 4O5VA 2KY9A 3CPWS 2BKDN 2EQJA 3GNGA 1LJOA 1Y1BA 3UFFA 1N6AA 4QVDA 5AYFA 4JS4A 2LUYA 2Y90A 3A8OB 3M9QA 4M7AB 1Q86C 2DIPA 5A0DA 3GIBA 3OW2S 1TBQR 2LT1A 5CKFA 2BUSA 1QVPA 2DZ9A 2MWPA 1DJ7B 3UGDA 2PUOB 1LR7A 5GAN7 5KE3A 4LDWA 3CBPA 2E6ZA 5GMKe 3CC2A 5J26A 1B34B 4C8QF 3RKYA 2A20A 2WSFE 5CCLA 3GNFB 3OYYA 1SGPI 4M75F 1YJWA 2DXUA 4E1RA 4E7JA 2ELIA 2E41A 4XU3A 4MMLA 4A54A 1U8RA 3RMQA 5LJ5j 4M77A 4Q5WA 3JCMV 1KC8U 3UGLA 1D3BA 1W4SA 3JSCA 2QQRA 3UEYA 5GAN8 1FXXA 5CKHA 2QEXT 4CI0C 5EX0A 3NTKA 2SGEI 1AHJB 1UEBA 2I2LA 1LNXA 3DKMA 4E7HA 4NOYA 1OZ3A 4R55A 1KD1C 3KXTA 3VDPA 3CCRA 1FWZA 2CZ6B 5GMKj 1JJ2A 1TBRR 5GAOr 1N8RC 3LH0A 3BJIA 2EQMA 3C4SA 2YLBA 4SGBI 2P0QA 4IUVA 4C92A 4ME7A 2GKTI 2JVVA 2CKKA 3ER0A 1KBEA 4HCCA 2M1HA 1XX6A 1KMAA 5HI7A 2XKOC 5C0MA 3QXEB 2PUKB 1W3SA 4PKCC 4C8QG 1TOTA 3JCMP 4F7UE 5GAMj 2P0KA 2JZ2A 4L59A 2JOYA 4C92C 4J7IA 1IY6A 2RJDA 1HJAI 1LR8A 2QI2A 4M75G 3WVEB 4Y28E 3WXMB 1BI2A 4IUTA 2ENNA 2GFUA 1M8CA 2OTJA 1D3BB 2RHXA 4X34A 3OYAA 1VIEA 3CXLA 2RI3A 2V8KA 1YJ9A 1QVGA 1G3WA 3CCVA 1X74A 1VQKT 2ZPFB 2M16A 3E59A 2PVDB 4KT0E 1XA6A 1KBFA 3P8HA 3HH2C 3QTLD 3OYHA 3C95A 4IKFA 3RERA 2DTOA 3OYFA 1QVFA 2HAXA 2UZ3A 2LCCA 2EQUA 2JXDA 1EIFA 2ENZA 1V29B 1IREB 2MWOA 5HK0A 3SEKC 3OYDA 4C0FA 2OTLA 1SSFA 1SGNI 1YU6C 4XTYA 4C92B 5HKCA 2V53A 4PNOA 4ELYC 2B0UC 5HQ8A 5A0LA 3LWHA 5GANd 3FJPA 3JB9I 2DO3A 2L89A 2XK0A 1X4SA 1YTPA 2DTHA 1JRIA 2J87A 2QTXA 1H641 1YITT 4KBMB 4J6YA 2DEQA 4XTWA 1BKBA 2RHYA 3I55T 3PMIA 2F69A 2KCXA 2D0QB 1NUBA 1M1KU 1ZBXA 2D6FA 1OMUA 3M53A 2SGDI 4M7DD 1N13A 2DTIA 3EFSA 2E73A 1W2BA 4OB3B 2XG8D 4OVAA 3CMET 4C8QD 5LJ3d 4M78E 3VV0A 3ZFJA 2KK4A 3PGGA 1V1IA 2K4YA 4C5HA 2EQKA 2E12A 1HDLA 1IY5A 3CEYA 2XD0A 1BIAA 4BACA 2X4WA 3N5BB 1N9SA 3SB2A 1TUSA 5M9OA 4F7UF 2CZ1B 1VQ7T 1AN1I 3GPLA 1FARA 4HCBA 4TVRA 2B8TA 2RHIA 1Y96B 1NPPA 4XTVA 3OYMA 3TREA 1PCEA 2L5QA 2LNVA 1Q81C 1UVGA 2WCYA 1VQ4A 3M4YA 5LJ5d 2KMTA 2L8EA 2NU1I 4EDUA 1MT1A 5GAN2 1YHQA 2EJ9A 5GMKm 2N52A 2YLCA 2X4YA 4PJOE 3KY9A 2JZMA 1XTDA 3RUXA 1LR9A 4WF2A 2QQEA 4YTLA 4MZTA 1DS2I 2K57A 3QBYA 5GANe 5EG2A 1CGII 2XDBA 1KHCA 2DKGA 4C8QA 4M7DE 3VJPA 5CKEA 4EMGA 2QQBA 1Y71A 5KCOA 3QZ9B 4J8OA 4M75A 3SDZA 1Q7YC 5GAN6 2QA4A 4HA8A 4JS5A 2QXFA 4E1PA 3V8LA 4M7DC 2M5XA 3OMCA 1VQLT 3LLRA 3OXGA 2KAFA 1QVGS 5GAN4 4UXJA 2XRCA 4C8QC 3C94A 3A8LB 4F7UG 4J6WA 5LJ3e 3O8VA 3S3NA 4M78F 3HRTA 3LGLA 4A4GA 2BUDA 4XTUA 4JCVE 3NTIA 3QUIA 3JCMb 1DS3I 4NS5A 3HP9A 3PTAA 5GAMd 1VQOA 1M90U 3LW5E 4JRPA 3JCMc 4Z02A 3WVDB 3OS2A 4FL6A 4E7LA 2LC4A 3OB9A 1VQ8A 5GAOl 3CCMT 2CZ7B 3JCMW 5GANj 2ZPHB 3CCUA 2HQEA 2OVOA 3A8MB 2J9RA 4BI4A 3H6ZA 1XOVA 3G71A 3CC4A 3EFRA 4J6XA 3PFSA 2RO0A 1TH7A 5IT9E 4J5YA 1QP3A 1BI0A 4C8QB 2JNGA 2G3RA 4IUUA 2X4XA 2ORWA 1U5KA 1IZ6A 4ATOA 3G6ET 2LVMA 1O75A 4M75B 5LJ5e 5FUXA 3CC7A 2KDSA 2FL7A 1Y8FA 4DOVA 4BE1A 3CCSA 4N4GA 3CCEA 5LJ3j 1R8OB 1XBTA 4PJOF 5GAN3 4C0GA 2P6AC 3EAEA 4A4KA 2R5MA 3VUBA 3BDLA 2OAUA 2VYTA 2SGFI 4M7DF 3V7CA 1VQPT 3ZBDA 2LQKA 1HK9A 4M78G 3SFMA 5LJ5f 2FVUA 4EPCA 2K9HA 1R79A 2WVJA 1UUCA 3JCMd 2DB6A 4KUDK 3UGIA 5DLQE 4VUBA 3JB9H 1S72A 2RHZA 4OB0B 1M1GA 3X26B 2NU3I 1U1TA 2H3JA 1PTRA 5I2MA 3J80E 2RJEA 2ZPIB 3MP6A 5FU7C 5CK9A 2F3CI 4UXIA 1K9MU 1KQSS 2GF7A 1YIJA 5GMKi 5GAMe 3P8BB 3MO8A 1KHIA 5LJ5h 2VRWB 2FYKA 2MI6A 1I4K1 2RI5A 2V1CA 2QNFA 4N0AA 3QHSA 5FLXE 4R56A 4OGEA 3CCJA 5HK3A 3HL8A 2LX9A 2VXEA 3G7ZA 3E1SA 1TGSI 3CMAA 3CD6T 2R57A 4LD6A 3INZA 1VQ5A 2DK3A 3M5AA 2VUBA 4XTZA 2DIQA 1UGRB 3QIIA 3LGFA 1KG1A 3HFOA 2X4JA 4XTXA 4OB2B 1VQ6T 2V1CC 4FSXA 4GLKA 4N0AC 3URGA 5GMKh 4QVCA 2EFIA 2IG0A 1G3TA 2E64A 3RMSA 4OMFB 2CJSC 1IW4A 5GAMf 4OGCA 5FU7B 4A4EA 5EX3A 3SGQI 3NTHA 4JJNK 1VQNT 1HXDA 1BI1A 5CKDA 3KUFA 3JRZA 1WJQA 1NJIC 3HRUA 3BW1A 2JYYA 2O4XA 3OQ5A 4M7DG 4QW2A 1KQ2A 4F7UA 3CCLT 1K73U 2XHCA 1CE3A 4XQ3A 1VDDA 3G4ST 3PMTA 2SGPI 3VE5A 5KH6A 3QYGB 4M78D 5CCAA 4XAXB 3A8HB 1RFHA 2QNCA 4RCCA 1UVFA 4QQ6A 4BE2A 4PL6A 5GAMh 1W4RA 1E7DA 2XICA 1ZHIA 3J81E 1O9SA 3HKSA 2F5KA 2RJFA 3RESA 2PU9B 4OP0A 5L8RE 2YQPA 3FIFA 3MEKA 1GXIE 3MEVA 3JCMe 4IURA 1YI2A 2NLUA 4L9MA 2AHJB 2JTMA 4JLIA 1CGJI 1VQMT 3V7RA 3OYKA 4MZMA 5CO7A 3CCQT 2RI2A 2GQVA 1LOJA 1H3ZA 3ME9A 3JB9J 3QDRB 1YJNT 1Y96A 3QWPA 1FX7A 1RL2A 1I81A 4A4FA 1MGQA 4N4HA 5I2SA 1N27A 2EJGA 3VYGA 2YUUA 2O4XB 2PVGB 2N71A 4F7UB 3JCMf 1Q86U 4PJOD 4E7KA 3CXCA 1Z7KB 4RG2A 2QQ9A 3L2UA 3OYJA 4BE0A 1U1SA 1WQ7A 3I56T 2GCXA 4E47A 4BY6C 3E9GA 4M78A 5FRMA 2C06A 1YCYA 4C5IA 3CPWA 4BI8B 4KUIA 1BYMA 2LTOA 3OY9A 3TEEA 4XU0A 2SGQI 3RKWA 2QQDA 2HBPA 3L2RA 3JCMh 2CGHA 1FAQA 2M9UA 3DB4A 3QJ6A 3A8GB 4UXHA 3OW2A 4M78C 2RHUA 2RK2A 1M8VA 4ZN3A 1I5LA 3M55A 4FU6A 4M7AD 4ZGDB 2GFAA 4FT2A 1XNIA 1G3YA 4E7IA 4NL2A 2QEXA 3CC2T 2JW6A 3VYHB 3RIRA 4BY6B 2ZPEB 2KSSA 4D6WA 3GF5A 2N1AB 1PSFA 2RJCA 3HPWA 1JJ2S 2NU0I 3OS1A 2XIDA 1OMTA 3OYBA 2GKVA 3SWNC 3FC3A 1YJWT 1R0RI 3OSVA 3PIOA 3UT1A 2OD1A 5KCHA 1KC8C 1CT4I 4GY5A 4PJOA 1K9MC 2DD5A 3QKJA 5GMKl 2LCLA 4LDYA 2JA1A 1KD1U 4JRKA 4LD9K 1HPTA 3TCJA 4M78B 4IUPA 1N8RU 1NZ9A 2ARPF 4HGUA 4MDWA 4M7DA 2DXCA 1UB4A 1K8AU 5HY6A 3F70A 1UGSB 4C0DC 3HHTB 1WNLA 1KQ1A 4RCBA 2XDDA 4PJOC 2KVQG 2LEOA 1OYXA 2K5LA 3DLMA 4A53A 1ZQ1A 2E1HA 5CVIA 3CCRT 2MAMA 1X01A 5LL6S 1MHNA 2WACA 5DLOA 1WGSA 4MDXA 1UGQB 4EMKC 5LJ5g 1M8BA 1Q82U 1K73C 2VGNA 2ERWA 5GAN5 3JB9D 1VQKA 3VDUA 3FB9A 5GANf 4A24A 4M7AE 1QVFS 2A3LA 4BDYA 4ZGJB 3E2IA 1X75C 2HNIA 1VQ9T 4C0DB 3GOXA 5CQYA 4JLGA 4PJOB 2RB6A 2P0PA 2E6NA 2N17A 3ASKA 3A5ZB 4BDZA 3HSBA 2Y4YA 1P92A 4HKEA 3QZ5B 3OYIA 3OYCA 2OTJT 3S6WA 4QQGA 2DPPB 4M7DB 4NL3A 3V8JA 4X9DA 5GANh 5DM7R 2K5IA 3NFCA 5LJ3f 3M57A 1H0ZA 2E10A 2K3YA 1YJ9T 5GAOm 3CCVT 4XU1A 2EIFA 1YITA 3PT9A 1OYVI 2DXTA 2GVIA 5CCMA 3I55A 4M77D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4I A;  3DLM A;  2R5A A;  4HCZ A;  2CKK A;  2LDM A;  3OYK A;  4A4H A;  4QQD A;  3O8V A;  3S3N A;  3LX7 A;  2DIQ A;  3EAE A;  4BD3 A;  5FRN A;  2RHU A;  3QII A;  2M1H A;  3LGF A;  3LGL A;  2L89 A;  2RI2 A;  2BUD A;  1MHN A;  2WAC A;  4A4G A;  2R5M A;  3OYL A;  1WGS A;  2LRQ A;  2XK0 A;  3BDL A;  3NTI A;  4FU6 A;  1OI1 A;  2VYT A;  4UC4 A;  3OMG A;  3P8D A;  4C5G A;  1H3Z A;  3ME9 A;  4ZTF A;  4NS5 A;  2GFA A;  1XNI A;  5C0M A;  4E7I A;  2EFI A;  2HQX A;  2IG0 A;  4E7J A;  3UWN A;  2B8A A;  3MEU A;  4PLI A;  2QQS A;  3Q1J A;  5CIU A;  3MEW A;  2RHY A;  3FEO A;  3DB3 A;  4Z02 A;  4CRI A;  3L2Q A;  4EDU A;  2XDP A;  3PNW C;  3PMI A;  4A4E A;  1EN7 A;  2P0K A;  5C6S A;  3NTH A;  2JZ2 A;  4A4F A;  4L59 A;  3OS2 A;  4N4H A;  4FL6 A;  2E5Q A;  4LD6 A;  2RJD A;  4E7L A;  2DIG A;  2BKD N;  3KUF A;  3OB9 A;  2YRV A;  1N27 A;  2RJC A;  1WJQ A;  3MP8 A;  4Q5W A;  2O4X A;  3OQ5 A;  2EQJ A;  2FHD A;  4IUT A;  3OS1 A;  4QW2 A;  3OS0 A;  2GFU A;  2O4X B;  3MEA A;  2PQW A;  5J39 A;  2X4Y A;  3OYB A;  4PLL A;  2HQE A;  4E7K A;  1RI0 A;  3FC3 A;  4BDY A;  2RHX A;  3PMT A;  4RG2 A;  4X34 A;  3OYA A;  2QQR A;  5D6W A;  2L8D A;  3UT1 A;  4OVA A;  5IN1 A;  3SD4 A;  5KH6 A;  5KCH A;  3L2U A;  3GOX A;  2RHZ A;  1E7L A;  3H6Z A;  2RI3 A;  3OYJ A;  4GY5 A;  4BE0 A;  3M9Q A;  3MET A;  3L2V A;  1G5V A;  2BIV A;  3QBY A;  3QKJ A;  3NTK A;  2L3R A;  3ZEH A;  2RJE A;  2D9T A;  5IAY A;  3MP6 A;  2JTF A;  4C5H A;  1KHC A;  1OZ2 A;  2EQK A;  3PFS A;  2RO0 A;  4C5E A;  2E6N A;  2M16 A;  3ASK A;  1WJS A;  3E9G A;  3E9F A;  4B9X A;  3OA6 A;  3S3M A;  4BDZ A;  2QNC A;  3OYE A;  2G3R A;  4IUU A;  5FRM A;  2X4X A;  2K3X A;  3CEY A;  4QQ6 A;  5KCO A;  3OYI A;  4C5I A;  4BE2 A;  4IUP A;  2GF7 A;  4E7H A;  3P8H A;  4PL6 A;  1E7D A;  5FRO A;  5KE2 A;  3OYC A;  1OZ3 A;  3OYM A;  1WJR A;  3S6W A;  3MO8 A;  2EKO A;  4BAC A;  2LVM A;  3FDR A;  4QQG A;  2LTO A;  2X4W A;  2MWP A;  3OY9 A;  3OYH A;  3S3O A;  4IKF A;  2F5K A;  2RJF A;  3MP1 A;  3OYF A;  2RI5 A;  5M9O A;  3F70 A;  3LYI A;  2R58 A;  3H8Z A;  3L2W A;  4IUQ A;  2QNF A;  3LH0 A;  2EQM A;  3C4S A;  2M0O A;  2LCC A;  2EQU A;  2K3Y A;  4BE1 A;  4N4G A;  4QVZ A;  3OMC A;  2MWO A;  3OYG A;  5KE3 A;  3L2R A;  3FLG A;  3LLR A;  3OYD A;  3MEV A;  4B9W A;  4IUR A;  5D6Y A;  2NLU A;  4II1 A;  1SSF A;  2RHI A;  1OYX A;  3DB4 A;  3L42 A;  3QJ6 A;  4IUV A;  2R57 A;  5D6X A;  5J26 A;  3OYN A;  4ZTJ A;  2X35 A;  2DAQ A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  3VKI A;  4N4I A;  1OVO A;  3OXL A;  4A4H A;  4ZGE B;  2L7X A;  3B4V C;  1TG0 A;  2ZZD A;  1RUW A;  2MYS A;  2JJ9 A;  2FB7 A;  1W2B S;  2NUP A;  2DF6 A;  2MCN A;  2P84 A;  2V8I A;  2CP7 A;  2YRC A;  2RH2 A;  4Y91 A;  4F17 A;  2COY A;  5CAI A;  4L5G A;  1B07 A;  2ZGW A;  3OMG A;  4FM4 B;  4BB7 A;  1QP2 A;  2RM4 A;  5GAM g;  3JCM Q;  3FRN A;  2NU2 I;  1ZBJ A;  3CME A;  2B8A A;  4RKU E;  2OTL T;  3MEU A;  1VUB A;  4PLI A;  2QQS A;  3Q1J A;  3C12 A;  4BUG A;  3MEW A;  3EG2 A;  2LT4 A;  3L2Q A;  2GIV A;  1QCO A;  1JQQ A;  5LJ3 h;  3OVO A;  2K2V A;  4C0Z A;  2E5Q A;  5FUV A;  3X20 B;  4JZ4 A;  2OTJ Q;  3H0I A;  1M90 R;  1D09 B;  2AK5 A;  2FHD A;  4F14 A;  5HCK A;  3BFM A;  1NG2 A;  4P5N A;  1M1K C;  5CKB A;  3VU3 C;  4FYV B;  2DL4 A;  2VV5 A;  1YJ9 Q;  1BUS A;  1BMO A;  2NU4 I;  2IVW A;  1VQ7 A;  2BIV A;  4FYX B;  2HD0 A;  4C92 D;  3DLL A;  2EAY A;  2GNC A;  5GAO q;  2JS2 A;  2RQT A;  1G3S A;  3CPF A;  4B9X A;  2DD4 A;  2D8H A;  1WKX A;  1SHG A;  1M2O A;  3V7S A;  3GP8 A;  1XJW B;  1C0M A;  3VS6 A;  2ECZ A;  2K5F A;  1Y0M A;  1E6G A;  4RTY A;  1JB0 E;  1VIF A;  3EH2 A;  3LYI A;  4XK8 E;  1AZE A;  1E6H A;  1TUD A;  2L2P A;  2OTL Q;  1NPR A;  1MJA A;  3BDU A;  3FLG A;  3KBG A;  2KMP A;  1Y57 A;  3M58 A;  4B9W A;  1SGR I;  3M56 A;  2DZC A;  4JRI A;  4M7A F;  2ODD A;  3OYN A;  4AFS C;  2DE0 X;  4ZTJ A;  2DAQ A;  2DMO A;  2CWH A;  2R5A A;  4EMH A;  1Q81 U;  1PRL C;  4PJM A;  1M5Q 1;  2M51 A;  4J9D A;  5CQX A;  2KMR A;  3OYL A;  2NUP B;  2OU2 A;  3UEJ A;  3QG1 A;  3TU4 K;  1X6B A;  3E2U A;  3BY7 A;  4M77 E;  3D00 A;  3R5B A;  4JPB W;  3DB3 A;  1E7O A;  2O01 E;  3TO7 A;  2XDP A;  5DAE A;  2Y4X A;  2E70 A;  4KGZ B;  1NLO C;  2HSE B;  2YRV A;  3JCM g;  3OBY A;  3MP8 A;  2BE9 B;  2LQ8 A;  3I5R A;  1NE8 A;  2E5R A;  4PJO G;  1RI0 A;  2QAS A;  4M77 C;  3RU0 A;  9WGA A;  2QQA A;  1VYV A;  1VQ4 T;  5I21 A;  2L8D A;  5J3B A;  4L6V 5;  3SD4 A;  4E2F B;  4HVW A;  2RQR A;  2CYZ B;  2MF2 A;  3MET A;  1YWP A;  4HT9 A;  1G5V A;  1PPF I;  2BZY A;  2O88 A;  1VQL A;  1FYB A;  2JTF A;  2QQC A;  2ZPB B;  1Q7Y U;  3E9F A;  1YHQ T;  1K8A C;  2LZ6 B;  1FMV A;  3OYE A;  1PM3 A;  4B6D A;  4ZN1 A;  2UVO A;  1CSK A;  2QAZ A;  1X2K A;  2EKO A;  3FDR A;  3S3O A;  4HT8 A;  3EHR A;  1MJB A;  3M0T A;  1M3B A;  3H41 A;  4C92 E;  1HYO A;  1K9M R;  2H8H A;  3EG3 A;  2QEX Q;  1ZA1 B;  1UEC A;  1ZUU A;  2KMQ A;  1VQ9 A;  3SGB I;  2BZX A;  2X35 A;  4J7F A;  3OL0 A;  3M59 A;  3V8K A;  4HCZ A;  1G83 A;  4QQD A;  3CCM A;  2QA4 T;  4JUV A;  1WGT A;  1Q82 C;  3JB9 F;  1QWE A;  2AZV A;  4M77 B;  1SGQ I;  4UC4 A;  4M7A G;  2DIL A;  2A0F B;  2RQV A;  2MIO A;  4RG8 A;  4FW2 A;  2O2O A;  4RMO A;  3L2Z A;  1JXM A;  2Y0M A;  4RUG A;  3FEO A;  3TQ7 P;  1YHQ Q;  1EN7 A;  5C6S A;  1K1Z A;  3OXF A;  4FKD A;  2AT1 B;  1M90 C;  1QVG P;  1LVK A;  3ZL7 C;  2EJF A;  3CBO A;  4XU2 A;  3OSS C;  3OS0 A;  1ZUK A;  2FG0 A;  1S1N A;  4PLL A;  3G6E A;  1N5Z A;  4OF1 A;  5D6W A;  1M27 C;  1U3O A;  5IN1 A;  3UA6 A;  1VQO T;  9ATC B;  7AT1 B;  1SGD I;  4V2S A;  1QVF P;  1K73 R;  1SGY I;  3QO3 A;  4O6J A;  1JBM A;  4C5E A;  2MOX A;  3VS0 A;  2XI9 A;  1VQ8 T;  1YBY A;  2XU8 A;  1PD0 A;  3NGP A;  1UGV A;  1NYF A;  2P4T A;  2RD1 A;  4OB1 B;  4ZNX A;  2EWN A;  2DJZ A;  2X9H A;  3CCU T;  3X25 B;  2VXF A;  4F16 A;  2ED1 A;  4M77 F;  2CZ0 B;  4ELZ C;  2WSE E;  1CSO I;  2PVO B;  4MMK A;  2W0T A;  3L2W A;  3UF4 A;  1GL5 A;  4LDX A;  3UOE A;  4ORZ A;  2YSQ A;  3HFN A;  1ZSZ A;  3G71 T;  1M2V A;  3CC4 T;  4JRQ A;  4KGX B;  3LWI A;  1UJY A;  1VQP A;  1B3Q A;  5FU6 C;  2DNU A;  5KYN A;  1PTQ A;  3CBM A;  1VQK Q;  1TBN A;  3LH5 A;  2JXB A;  2LDM A;  1WYX A;  2HBW A;  3UPU A;  1TUR A;  2JN0 A;  2OJ2 A;  1B7T A;  2F5T X;  4JDS A;  1MUZ A;  1WTJ A;  3QPH A;  3CC7 T;  2E3H A;  5GAO p;  3X24 B;  2A37 A;  2DVE A;  1VQO Q;  2CUD A;  3CCS T;  3CCE T;  2J05 A;  2LJ3 A;  2HQX A;  3UWN A;  2ROW A;  4OVO A;  1WPY A;  2VC8 A;  1UUE A;  2ZPG B;  3M0Q A;  4LDV A;  5FUW A;  3JCM X;  3I5S A;  5GAN g;  1M4Z A;  3MCA B;  3D7S B;  4GLM A;  3JB9 G;  2DIG A;  2MK5 A;  3OBW A;  2RA2 A;  4M75 D;  4RTW A;  3SWN A;  3QSU A;  4C92 F;  1KK7 A;  1SKU B;  1M9S A;  5J39 A;  2E65 A;  3QJY A;  3X28 B;  1PKT A;  1CHO I;  3VS7 A;  3E19 A;  3G71 Q;  1Y7X A;  1WX6 A;  1AWW A;  2VKN A;  2FO0 A;  1GCP A;  2EYQ A;  2L3R A;  3M0U A;  1V1H A;  5FU6 B;  1Q86 R;  1WXT A;  1OZ2 A;  2D0N A;  5JHW C;  2ORV A;  1WJS A;  3OA6 A;  3I55 Q;  1K76 A;  3S3M A;  3CD6 A;  1N9R A;  2LJ1 A;  2FPF A;  2K3X A;  3GLX A;  3RKX A;  1SGE I;  1FYN A;  2KYM A;  4E7S A;  5KE2 A;  2KRM A;  5LJ3 g;  5ECA A;  3CC7 Q;  3J7A F;  2LX7 A;  1M1F A;  3QYH B;  1X69 A;  1Y1C A;  3CCE Q;  3TJQ A;  1S72 T;  2R58 A;  4IUQ A;  1QW1 A;  1VQ6 A;  1IGU A;  4QVZ A;  2RK1 A;  4JZ3 A;  3CME Q;  2CS7 A;  1M2V B;  4FYW B;  4GI3 C;  4J83 A;  1J3T A;  2QQ0 A;  5CR2 A;  1RAB B;  1IHV A;  3L42 A;  5I11 A;  3PIP A;  3JCM J;  4M77 G;  1ZA2 B;  2K9G A;  2DYB A;  2JTE A;  2DXB A;  1VQN A;  1YIJ T;  3KFV A;  2EYW A;  4FIB A;  3T9N A;  3LX7 A;  3GBQ A;  2JM9 A;  1WIE A;  4BD3 A;  4EMK A;  1KQS A;  2M02 A;  3CCL A;  2LRQ A;  2GTJ A;  1KQS P;  1OI1 A;  4HVU A;  4F04 B;  4C5G A;  5A0G A;  3G4S A;  3C0C A;  4LUE A;  2GKR I;  3CCJ T;  3QWY A;  3L1A A;  5DY9 A;  3R5D A;  3BE3 A;  2QYZ A;  4X9C A;  5IHI A;  4QKU A;  3PDN A;  2FRW A;  5CIU A;  1NJI U;  3CMA T;  1CT0 I;  2A7Y A;  4CRI A;  3EG1 A;  1X27 A;  1VQ5 T;  3OS5 A;  2OZU A;  3M4G A;  2KMO A;  1P9Z A;  1RAG B;  1TS9 A;  3SWN B;  1K7T A;  5KYY A;  3MEA A;  2J6F A;  2PQW A;  4BI3 A;  1RAF B;  1S72 Q;  1BI3 A;  3VUZ A;  4MZP A;  2FZG B;  4LDU A;  4C8Q E;  1WHJ A;  4FT4 A;  5A2Q E;  1WQW A;  1CT2 I;  4M7A A;  2QPO A;  1E7L A;  3A1P A;  3L2V A;  2MMP A;  3ZEH A;  3R5A A;  2D9T A;  4C92 G;  5IAY A;  1Q95 G;  1XQH A;  2V8J A;  3AT1 B;  4M75 E;  2K3B A;  5L23 A;  2WSC E;  1TBO A;  1PSE A;  4DQ2 A;  1YIJ Q;  3UDC A;  3FJ5 A;  2LJ0 A;  4DBQ A;  1BIB A;  4DA4 A;  3M54 A;  3ULR B;  1VQM A;  5FRO A;  2KQW A;  1WJR A;  1TIH A;  2COW A;  1KD1 R;  4FSS A;  3CCQ A;  3MP1 A;  3H8Z A;  3R5C A;  4M75 C;  4DEX A;  2CP6 A;  2M0O A;  3AHU A;  1UGP B;  2QDL A;  2JUF A;  1N8R R;  1TTH B;  1YJN A;  3OYG A;  3CMA Q;  4M7A C;  4DOW A;  3FSY A;  2QDY B;  5D6Y A;  4II1 A;  5D6X A;  1K8A R;  5I22 A;  3R6O A;  3MHX A;  1NLP C;  1X6O A;  1B34 A;  5GAO n;  2ZCF B;  1QKW A;  1D0Z A;  3HRS A;  3CXC S;  5FRN A;  1P9G A;  4KUL A;  4EMK B;  1S20 A;  1PJU A;  3JAM E;  8AT1 B;  2YHT A;  3P8D A;  4ZTF A;  2GTO A;  4AFU C;  2FNF X;  1Y07 A;  1I8F A;  3UAT A;  1YI2 T;  1AOJ A;  3RDV A;  2ENM A;  1VQL Q;  2VGM A;  3I56 A;  3PNW C;  5FUY A;  4Z8A A;  2KT8 A;  4O5V A;  2KY9 A;  1R77 A;  1WI7 A;  3CPW S;  2BKD N;  2E4H A;  1WFW A;  2X3T A;  2EQJ A;  3GNG A;  1LJO A;  1Q82 R;  1GCQ A;  5KYY B;  2DBK A;  4RTX A;  1OPL A;  1UDL A;  1Y1B A;  5E3R A;  1V1C A;  1N6A A;  4QVD A;  3UFF A;  5AYF A;  4JS4 A;  2LUY A;  1V76 A;  1MJ9 A;  2Y90 A;  3A8O B;  3M9Q A;  4M7A B;  1Q86 C;  2DIP A;  5A0D A;  3GIB A;  3OW2 S;  5GJW B;  2YXY A;  2F2W A;  1TBQ R;  3G1J A;  1ZSG A;  2LT1 A;  4HXJ A;  5CKF A;  1CKA A;  3VS3 A;  1TWB A;  2BUS A;  1QVP A;  1QMC A;  2DZ9 A;  3NMZ C;  4J9E A;  1GCQ C;  2MWP A;  1DJ7 B;  3UGD A;  1RAA B;  2PUO B;  1LR7 A;  5GAN 7;  1YI2 Q;  2DL7 A;  3SHW A;  5KE3 A;  4PJL A;  4LDW A;  1ULN A;  3CBP A;  2E6Z A;  2CT4 A;  5GMK e;  2HKN A;  3CC2 A;  2MPX C;  5J26 A;  3NHN A;  1TUC A;  1VYT A;  3QAH A;  4J9G A;  3NPF A;  2YUN A;  2EQI A;  1B34 B;  4C8Q F;  3RKY A;  4IIO A;  2A20 A;  2WSF E;  5CCL A;  3GNF B;  2BZ8 A;  3OYY A;  1SGP I;  4M75 F;  1YJW A;  2DXU A;  4E1R A;  1WZO A;  4E7J A;  2ELI A;  2E41 A;  2A28 A;  2ABL A;  1TSF A;  4XU3 A;  4MML A;  2L0A A;  4A54 A;  1U8R A;  3RMQ A;  5LJ5 j;  1OX8 A;  4M77 A;  1MNE A;  5GJV B;  4Q5W A;  1AVZ C;  2RNA A;  3JCM V;  1KC8 U;  3UGL A;  1QWF A;  2DM1 A;  1D3B A;  1W4S A;  3JSC A;  4KH0 B;  1TXQ A;  1PZW A;  2QQR A;  3UEY A;  5GAN 8;  4WP4 A;  2EYX A;  1WXU A;  1FXX A;  5CKH A;  2QEX T;  4EIK A;  3TO6 A;  4D8D A;  4CI0 C;  5EX0 A;  3NTK A;  5IXF A;  1VQP Q;  2YUO A;  2SGE I;  2DYI A;  1AHJ B;  1UEB A;  2I2L A;  1LNX A;  3DKM A;  3VS1 A;  2VVK A;  2CT3 A;  2HCK A;  1OU9 A;  2EVR A;  4NOY A;  4E7H A;  1OZ3 A;  4R55 A;  1KD1 C;  3KXT A;  3VDP A;  1QQJ A;  1NEG A;  3CCR A;  1FWZ A;  2CZ6 B;  5GMK j;  1JJ2 A;  1TBR R;  2L3Q A;  1JJ2 P;  5GAO r;  1N8R C;  3LH0 A;  3BJI A;  2EQM A;  3C4S A;  2L3S A;  2YLB A;  2YRD A;  4SGB I;  1LCK A;  1K7U A;  1T3L A;  1JO8 A;  1M30 A;  1NBE B;  2P0Q A;  3M0P A;  1ZLM A;  3CQT A;  4IUV A;  2V1Q A;  4C92 A;  1PWT A;  2HEQ A;  4ME7 A;  1WHK A;  2LQN A;  2GKT I;  2CWF A;  2JVV A;  2CKK A;  3MPU B;  4OMO A;  3ER0 A;  1KBE A;  2KEA A;  3VS5 A;  4HCC A;  1GFD A;  1KFZ A;  2M1H A;  4AML A;  4PJN A;  1XX6 A;  1KMA A;  2LQW A;  1ACM B;  4OMM A;  3EGU A;  5HI7 A;  2B86 A;  1Q81 R;  2XKO C;  5C0M A;  3EH1 A;  3QXE B;  2PUK B;  1W3S A;  2F1L A;  4PKC C;  4C8Q G;  1TOT A;  4HVV A;  3JCM P;  4F7U E;  5GAM j;  2P0K A;  2JZ2 A;  2OX7 A;  4L59 A;  1YP5 A;  2JOY A;  2Z0W A;  4J7I A;  4C92 C;  3CD6 Q;  2RJD A;  1IY6 A;  1R0B G;  1HJA I;  1LR8 A;  2QI2 A;  4M75 G;  3WVE B;  4Y28 E;  3WXM B;  1BI2 A;  1H8K A;  4IUT A;  2ENN A;  2GFU A;  1HEV A;  1M8C A;  2ZAE A;  1PC0 A;  4Z89 A;  2OTJ A;  2KDP A;  2CSQ A;  1D3B B;  2RHX A;  4X34 A;  3OYA A;  1QCF A;  1SPK A;  1VIE A;  3CXL A;  1VQ6 Q;  1GBR A;  2HMA A;  2RI3 A;  2V8K A;  2CP3 A;  2YUP A;  1YJ9 A;  1QVG A;  1G3W A;  1AEY A;  3CCV A;  1X74 A;  1OUL A;  1VQK T;  2ZPF B;  4Y92 A;  2RQU A;  2M16 A;  3E59 A;  2PVD B;  4KT0 E;  1XA6 A;  1KBF A;  3P8H A;  1UJ0 A;  3HH2 C;  3QTL D;  1ARK A;  3OYH A;  3C95 A;  4IKF A;  2W0Z A;  1Q7Y R;  3CCL Q;  3RER A;  2DTO A;  3OYF A;  1WGC A;  1QVF A;  4J9H A;  2HAX A;  2DKV A;  3G4S Q;  1IRX A;  2UZ3 A;  5IH2 A;  2LCC A;  2EQU A;  2JXD A;  1EIF A;  2ENZ A;  1V29 B;  1IRE B;  2MWO A;  5HK0 A;  1AT1 B;  3SEK C;  3OYD A;  4C0F A;  1ZX6 A;  1YWO A;  2EPD A;  2OTL A;  1SSF A;  1SGN I;  1YU6 C;  4LE9 A;  4CC4 B;  4XTY A;  4C92 B;  5HKC A;  2V53 A;  1SG5 A;  4PNO A;  4ELY C;  2B0U C;  5HQ8 A;  5A0L A;  3LWH A;  5GAN d;  3FJP A;  5IHN A;  2SEM A;  3JB9 I;  2DO3 A;  2L89 A;  2XK0 A;  2PNI A;  1X4S A;  1T0H A;  2FRY A;  3TVT A;  4ESR A;  1YTP A;  2DTH A;  1JRI A;  1NYG A;  2FZK B;  2AIR B;  2J87 A;  2QTX A;  2N1U A;  1H64 1;  1YIT T;  4KBM B;  3CXC P;  4JJB A;  1UHF A;  4J6Y A;  2DEQ A;  4XTW A;  3RR6 A;  1BKB A;  2RHY A;  3I55 T;  4LNP A;  2DX1 A;  3PMI A;  2F69 A;  2LCS A;  1A0N B;  2KCX A;  2D0Q B;  1NUB A;  1M1K U;  1ZBX A;  5D7U A;  2D6F A;  1OMU A;  3M53 A;  2SGD I;  2KE9 A;  1VQM Q;  4M7D D;  2DER A;  1MMN A;  1N13 A;  2DTI A;  2A08 A;  3EFS A;  2CWG A;  2E73 A;  1W2B A;  4OB3 B;  2XG8 D;  2VB6 A;  1GFC A;  4OVA A;  3CME T;  4C8Q D;  5LJ3 d;  4KRT A;  1W2B P;  4M78 E;  2PTK A;  3VV0 A;  3ZFJ A;  1YJN Q;  2J7I A;  2KK4 A;  1RLQ C;  3PGG A;  2DBM A;  1V1I A;  2K4Y A;  4C5H A;  2EQK A;  2E12 A;  1HDL A;  1IY5 A;  1RI9 A;  4FYY B;  3H0H A;  1WHG A;  3CEY A;  2XD0 A;  2HZY A;  1BIA A;  4BAC A;  3EFO A;  4JJC A;  2X4W A;  3N5B B;  1N9S A;  2GGR A;  3SB2 A;  2X52 A;  1TUS A;  1VYU A;  5M9O A;  3TSZ A;  1K0S A;  4F7U F;  2CZ1 B;  4DBR A;  2J6O A;  2O31 A;  1YIT Q;  1VQ7 T;  1AN1 I;  3GPL A;  1K9A A;  4LN2 A;  1FAR A;  2AZS A;  4HCB A;  2OAW A;  4TVR A;  2B8T A;  1JXO A;  2CH4 A;  2RHI A;  1Y96 B;  1NPP A;  4XTV A;  1D0X A;  3OYM A;  3TO9 A;  3TRE A;  2K79 A;  1JU5 C;  2QK0 A;  1EX4 A;  1NEB A;  3TSW A;  2DEU A;  1PCE A;  2DL3 A;  2DET A;  2L5Q A;  2LNV A;  1Q81 C;  1UVG A;  2WCY A;  1VQ4 A;  3M4Y A;  2GBQ A;  2X51 A;  1BCM A;  1QKX A;  5LJ5 d;  3U23 A;  2KMT A;  1UHA A;  2L8E A;  2NU1 I;  4DBF A;  4EDU A;  1MT1 A;  5GAN 2;  1F1B B;  2EGA A;  1YHQ A;  2J6K A;  5FW9 A;  2EJ9 A;  5GMK m;  5KYX A;  2N52 A;  4WCI A;  1H92 A;  2YLC A;  2X4Y A;  4PJO E;  3KY9 A;  3RBB B;  2EYY A;  2JZM A;  1XTD A;  3RUX A;  1VQ7 Q;  1LR9 A;  4WF2 A;  2QQE A;  4YTL A;  1QLY A;  4MZT A;  1DS2 I;  1IO6 A;  2K57 A;  2JMA A;  3QBY A;  5GAN e;  5EG2 A;  2C0I A;  1CGI I;  2XDB A;  2EBP A;  4OMP A;  1KHC A;  2DKG A;  4C8Q A;  3CC2 Q;  1D1B A;  2P4R A;  3VJP A;  4DBH A;  4M7D E;  5CKE A;  2IPO B;  4EMG A;  2QQB A;  1Y71 A;  4LUD A;  5KCO A;  1HJD A;  2O9S A;  3QZ9 B;  4J8O A;  4M75 A;  3SDZ A;  1Q7Y C;  5GAN 6;  2QA4 A;  3EFO B;  4HA8 A;  2BTT A;  1VA7 A;  4JS5 A;  1UTI A;  2QXF A;  1YJW Q;  1IXD A;  4E1P A;  3V8L A;  1UG1 A;  4M7D C;  2M5X A;  3OMC A;  1OQK A;  1VQL T;  3LLR A;  3OXG A;  2F2X A;  2KAF A;  1I07 A;  2AKK A;  1QVG S;  5GAN 4;  2D1X A;  4UXJ A;  1HD3 A;  2XRC A;  3I9Q A;  4IIM A;  4C8Q C;  2QGG A;  3C94 A;  1NXU A;  2PQ8 A;  2CRE A;  3A8L B;  4F7U G;  4J6W A;  5LJ3 e;  3O8V A;  3S3N A;  4M78 F;  3HRT A;  3LGL A;  4A4G A;  2BUD A;  4XTU A;  4JCV E;  3NTI A;  2ROL A;  3QUI A;  1PRM C;  3JCM b;  1DS3 I;  1TOV A;  4NS5 A;  3HP9 A;  3PTA A;  3RNJ A;  5GAM d;  1VQO A;  1I0C A;  1I5O B;  1M90 U;  2YT6 A;  3LW5 E;  4JRP A;  3JCM c;  2I0N A;  4Z02 A;  2E3I A;  2KNB B;  3WVD B;  1PCX A;  3OS2 A;  4FL6 A;  4E7L A;  2LC4 A;  3OB9 A;  1VQ8 A;  5GAO l;  3CCM T;  2CZ7 B;  3JCM W;  5GAN j;  2K2M A;  1PG5 B;  2ZPH B;  5KYX B;  1NJI R;  3CCU A;  2HQE A;  3CCR Q;  2OVO A;  2KR3 A;  1D1C A;  3A8M B;  2J9R A;  4BI4 A;  3H6Z A;  1T3S A;  1C6V X;  1XOV A;  3G71 A;  3CC4 A;  2KI7 A;  4CC2 A;  1ZUY A;  3EFR A;  4J6X A;  4J9B A;  3PFS A;  1TH7 A;  2RO0 A;  5IT9 E;  4J5Y A;  1QP3 A;  1BI0 A;  4C8Q B;  2JNG A;  2G3R A;  4IUU A;  4PK4 A;  2X4X A;  2ORW A;  5E3P A;  1U5K A;  1IZ6 A;  4ATO A;  3G6E T;  2V26 A;  1VOM A;  2LVM A;  1O75 A;  4M75 B;  5LJ5 e;  4AG1 C;  2RN8 A;  5FUX A;  2HL3 A;  3CC7 A;  1MMD A;  2KDS A;  3THK A;  3H0F A;  2FL7 A;  1Y8F A;  1U06 A;  1AWX A;  3VRZ A;  4DOV A;  4BE1 A;  4N4G A;  3CCS A;  3CCE A;  5LJ3 j;  1R8O B;  1VQ9 Q;  3QWX X;  1XBT A;  2E5K A;  2X3W D;  1OV3 A;  2KT1 A;  3JV3 A;  4PJO F;  2A36 A;  3CCM Q;  5GAN 3;  4C0G A;  2P6A C;  1IGQ A;  1D0Y A;  3EAE A;  2LNH B;  4A4K A;  2R5M A;  3VUB A;  3BDL A;  2NUT A;  2OAU A;  1Z9Q A;  2VYT A;  2SGF I;  3PE0 A;  3EGX A;  1LPL A;  4M7D F;  3V7C A;  1SF9 A;  1VQP T;  3ZBD A;  1SHF A;  2LQK A;  2YDL A;  5KYW A;  4FW1 A;  1HK9 A;  1YFN A;  3CCV Q;  4M78 G;  3SFM A;  5J8C A;  5LJ5 f;  2FVU A;  4EPC A;  2K9H A;  7WGA A;  2RC4 A;  1R79 A;  1X2Q A;  3G6E Q;  2WVJ A;  1UUC A;  3JCM d;  4PFO A;  1RAI B;  2DB6 A;  4KUD K;  2WGC A;  1KJW A;  3FSX A;  1MV0 B;  3UGI A;  5DLQ E;  4VUB A;  2FPD A;  3JB9 H;  4HCK A;  1S72 A;  3SEM A;  3HTR A;  2KRO A;  2RHZ A;  4OB0 B;  1CKB A;  1M1G A;  1WDX A;  3X26 B;  2NU3 I;  1U1T A;  2H3J A;  4PFP A;  1PTR A;  5I2M A;  3J80 E;  3H9N A;  1SEM A;  2RJE A;  2ZPI B;  2F2V A;  1NM7 A;  3MP6 A;  1EZZ B;  2CP2 A;  5FU7 C;  5CK9 A;  1H3H A;  4OML A;  2F3C I;  4LXC A;  1RAH B;  2C0O A;  2GQI A;  4UXI A;  1K9M U;  1KQS S;  1RLP C;  2GF7 A;  2VAS A;  1YIJ A;  5GMK i;  5GAM e;  3P8B B;  3MO8 A;  1KHI A;  1AWJ A;  5LJ5 h;  2VRW B;  2FYK A;  5FWC A;  2MI6 A;  1I4K 1;  2RI5 A;  2V1C A;  2RIJ A;  3UA7 A;  2QNF A;  4N0A A;  3QHS A;  5FLX E;  4R56 A;  2LP5 A;  1PD1 A;  4OGE A;  1AZG B;  3MJX A;  2RF0 A;  1ULM A;  3CCJ A;  2CDT A;  5HK3 A;  3HL8 A;  2LX9 A;  1WHM A;  2VXE A;  3G7Z A;  2RMO A;  1M3A A;  3E1S A;  4KGV B;  1TGS I;  3CMA A;  3CD6 T;  2R57 A;  4LD6 A;  3INZ A;  1RAE B;  1W70 A;  4K11 A;  1VQ5 A;  2ESW A;  2LB7 A;  2DK3 A;  3M0S A;  3M5A A;  2VUB A;  1JEG A;  4XTZ A;  2DIQ A;  1UGR B;  2HQH A;  2JS0 A;  3QII A;  2CH4 W;  3LGF A;  1KG1 A;  3HFO A;  2EGE A;  1PHT A;  2X4J A;  4XTX A;  4OB2 B;  1VQ6 T;  2NUT B;  2V1C C;  4FSX A;  4GLK A;  1BU1 A;  4N0A C;  4CC3 A;  3URG A;  5GMK h;  4QVC A;  2EFI A;  2IG0 A;  3EGX B;  1G3T A;  2E64 A;  3RMS A;  2YUQ A;  4OMF B;  2CJS C;  1IW4 A;  5GAM f;  2NYS A;  2DRK A;  5KYW B;  1X43 A;  4OGC A;  5FU7 B;  4A4E A;  5EX3 A;  3SGQ I;  4AFQ C;  3NTH A;  4JJN K;  1VQN T;  1HXD A;  1X6G A;  1BI1 A;  5CKD A;  3KUF A;  3JRZ A;  1WJQ A;  1NJI C;  3HRU A;  3BW1 A;  2JYY A;  2O4X A;  3OQ5 A;  4M7D G;  4QW2 A;  5AT1 B;  1KQ2 A;  4F7U A;  3CCL T;  1K73 U;  3PVL A;  2XHC A;  1CE3 A;  4XQ3 A;  1VDD A;  4MPI A;  3G4S T;  1FY7 A;  3PMT A;  4OMN A;  2SGP I;  2JM8 A;  3VE5 A;  5KH6 A;  1Q9B A;  3QYG B;  4M78 D;  5CCA A;  4J9F A;  4J9C A;  4XAX B;  1RAD B;  2O9V A;  1KC8 R;  2NWM A;  3I35 A;  3A8H B;  2DL5 A;  1RFH A;  1KIK A;  2KBT A;  1FMK A;  4QT7 A;  2QNC A;  4RCC A;  1UVF A;  4QQ6 A;  2V1R A;  4BE2 A;  4PL6 A;  5GAM h;  1W4R A;  1E7D A;  4PFZ A;  2XIC A;  1ZHI A;  3J81 E;  1O9S A;  3HKS A;  2F5K A;  2RJF A;  1IHW A;  3RES A;  2PU9 B;  4OP0 A;  1W1F A;  5L8R E;  1OEB A;  1VQ4 Q;  2YQP A;  3FIF A;  3MEK A;  4OMQ A;  3MKD A;  4D8K A;  2CP5 A;  3VS2 A;  1GXI E;  3MEV A;  4WTO B;  5IHK A;  4IUR A;  3JCM e;  2NLU A;  1YI2 A;  4L9M A;  4KH1 B;  3IQL A;  1K4U S;  1KSW A;  1VQN Q;  2AHJ B;  2H3E B;  2ED0 A;  1BB9 A;  2YWW A;  2JTM A;  2QGF B;  4JLI A;  1VQM T;  1CGJ I;  2KRN A;  3V7R A;  3OYK A;  2FPE A;  3EHQ A;  4MZM A;  5CO7 A;  3CCQ T;  1ABQ A;  2RI2 A;  2GQV A;  2EW3 A;  1LOJ A;  1PNJ A;  1H3Z A;  3ME9 A;  3JB9 J;  3QDR B;  1YJN T;  1Y96 A;  3VS4 A;  3QWP A;  1C1A A;  1PKS A;  2FZC B;  1TUG B;  4FCY A;  1FX7 A;  1RL2 A;  5J8F A;  1I81 A;  2HL5 C;  2KYB A;  1K7V A;  4A4F A;  5FWB A;  1MGQ A;  1MND A;  4N4H A;  5I2S A;  2DVJ A;  1OU8 A;  2FEI A;  1N27 A;  2EJG A;  3VYG A;  2J06 A;  2JW4 A;  5IXB A;  2YUU A;  2O4X B;  2PVG B;  2N71 A;  1BK2 A;  4F7U B;  3JCM f;  2IIM A;  1Q86 U;  4E7K A;  4PJO D;  2HKQ B;  1TU0 B;  2QA4 Q;  3CXC A;  1Z7K B;  4RG2 A;  1WHL A;  4E6R A;  4PJJ A;  2QQ9 A;  3L2U A;  1R0C B;  1MV3 A;  3OYJ A;  4BE0 A;  1U1S A;  4A63 B;  1WQ7 A;  2SRC A;  3I56 T;  3R6N A;  1T0J A;  2GCX A;  2JT4 A;  2K7A A;  4E47 A;  4BY6 C;  1AWO A;  2KXC A;  3E9G A;  3TOA A;  4M78 A;  1SRM A;  5FRM A;  2C06 A;  1YCY A;  4C5I A;  3CPW A;  3A98 A;  4BI8 B;  3CCQ Q;  3CPW P;  4KUI A;  1BYM A;  2LTO A;  4B6M A;  3OY9 A;  2VWF A;  3TEE A;  4XU0 A;  2SGQ I;  3RKW A;  2QQD A;  2HBP A;  1BBZ A;  3L2R A;  2L3P A;  1U5S A;  3JCM h;  2D8J A;  2HSP A;  2CGH A;  1FAQ A;  2M9U A;  2CUB A;  2K6D A;  1Z2I A;  3DB4 A;  4AT1 B;  3QJ6 A;  1ZSZ C;  2DJQ A;  4RTZ A;  3A8G B;  4UXH A;  4R0K A;  3OW2 A;  4M78 C;  1VQ8 Q;  2DA9 A;  3OW2 P;  1RAC B;  1GRI A;  2RHU A;  3PVQ A;  3EGD A;  1IB8 A;  2RK2 A;  1M8V A;  4ZN3 A;  1I5L A;  3CCU Q;  1WLP B;  2NUZ A;  3M55 A;  4FU6 A;  8ATC B;  4M7A D;  2OI3 A;  2ROT A;  4ZGD B;  1BCO A;  2GFA A;  4FT2 A;  2BE7 D;  1XNI A;  1G3Y A;  4E7I A;  3I56 Q;  4NL2 A;  2QEX A;  3CC4 Q;  3CC2 T;  2JW6 A;  3VYH B;  3RIR A;  4BY6 B;  2JMC A;  1EFN A;  2ZPE B;  2KSS A;  4D6W A;  3EG9 A;  3GF5 A;  3TOB A;  2N1A B;  1PSF A;  1W6X A;  4J9I A;  2RJC A;  3HPW A;  4M4Z A;  1G2B A;  1JJ2 S;  2NU0 I;  3OS1 A;  2XID A;  1OMT A;  2C0T A;  3OYB A;  2GKV A;  2RQW A;  1ULK A;  3SWN C;  2AKL A;  3FC3 A;  1YJW T;  1R0R I;  1D1A A;  4JJD A;  3OSV A;  3PIO A;  1M1K R;  3UT1 A;  2OD1 A;  5KCH A;  1KC8 C;  2LMJ A;  2EKH A;  1CT4 I;  3CCS Q;  4GY5 A;  4PJO A;  2KXD A;  2DD5 A;  1K9M C;  3QKJ A;  5GMK l;  5KYU A;  2LCL A;  2XMF A;  4LDY A;  2JA1 A;  1MMG A;  1KD1 U;  2EYZ A;  1ZSZ B;  1WA7 A;  4JRK A;  4LD9 K;  3REA B;  2EGC A;  1HPT A;  3TCJ A;  2M0Y A;  4M78 B;  4AFZ C;  4IUP A;  1N8R U;  1NZ9 A;  5E3Q A;  2ARP F;  1WXB A;  4HGU A;  4MDW A;  1Z9Z A;  4M7D A;  2DXC A;  1UB4 A;  2G6F X;  1YNZ A;  1ABO A;  1K8A U;  5HY6 A;  3F70 A;  1UGS B;  3O5Z A;  4C0D C;  3HHT B;  1WNL A;  1KQ1 A;  4RTV A;  4RCB A;  4RTT A;  1SSH A;  2XDD A;  2CP0 A;  4PJO C;  2KVQ G;  2DLP A;  2DRM A;  2LEO A;  1OYX A;  2ATC B;  5EC7 A;  2K5L A;  6AT1 B;  1OOT A;  3DLM A;  2W10 A;  3REB B;  4A53 A;  1ZQ1 A;  4CC7 A;  2E1H A;  5CVI A;  3CCR T;  2MAM A;  1X01 A;  2X3X D;  2RPN A;  5LL6 S;  3EGD B;  1MHN A;  2WAC A;  5DLO A;  1WGS A;  4MDX A;  1UGQ B;  4EMK C;  1OX9 A;  5LJ5 g;  2HDA A;  1M8B A;  1M8M A;  1Q82 U;  1UFF A;  4DNC A;  1K73 C;  2VGN A;  2ERW A;  5GAN 5;  3JB9 D;  1VQK A;  1WHH A;  1G8X A;  3VDU A;  1UE9 A;  3FB9 A;  5GAN f;  4A24 A;  2KGT A;  3EG9 B;  1YN8 A;  1I1J A;  2QTV A;  4ANJ A;  4M7A E;  1QVF S;  1K0X A;  2DFU A;  2A3L A;  4BDY A;  1GBQ A;  1UHC A;  4ZGJ B;  3E2I A;  1X75 C;  2HNI A;  1VQ9 T;  4C0D B;  3GOX A;  2DL8 A;  5CQY A;  3CCJ Q;  2COZ A;  4JLG A;  4DEY A;  4PJO B;  2RB6 A;  1MMA A;  5KYU B;  2P0P A;  2E6N A;  2N17 A;  3ASK A;  1QCN A;  3A5Z B;  1YCS B;  4BDZ A;  3HSB A;  1VQ5 Q;  2Y4Y A;  1P92 A;  4HKE A;  3QZ5 B;  3OYI A;  3OYC A;  2OTJ T;  3S6W A;  2KRS A;  2QG9 B;  4QQG A;  3VRY A;  1SRL A;  2DPP B;  1HSQ A;  4Z88 A;  4M7D B;  1OPK A;  4X1V A;  2CSI A;  4NL3 A;  3V8J A;  4X9D A;  1M3C A;  5GAN h;  3QDF A;  2K5I A;  3NFC A;  5LJ3 f;  5DM7 R;  3M57 A;  1H0Z A;  2PZ1 A;  2E10 A;  2K3Y A;  1YJ9 T;  1FMW A;  5GAO m;  3CCV T;  4XU1 A;  1AD5 A;  3M0R A;  2EIF A;  4GBQ A;  1YIT A;  4AG2 C;  3PT9 A;  4RTU A;  4E7Z A;  1OYV I;  2DXT A;  2GVI A;  5CCM A;  4AMC A;  3I55 A;  4M77 D; 
#chains in the Genus database with same CATH homology
 3VKI A;  4N4I A;  1OVO A;  3OXL A;  4A4H A;  4ZGE B;  2L7X A;  3B4V C;  2ZZD A;  1W2B S;  2FB7 A;  4Y91 A;  2V8I A;  2RH2 A;  5CAI A;  4L5G A;  2ZGW A;  3OMG A;  4FM4 B;  4BB7 A;  1QP2 A;  2RM4 A;  5GAM g;  3JCM Q;  3FRN A;  2NU2 I;  3CME A;  2B8A A;  4RKU E;  2OTL T;  3MEU A;  1VUB A;  4PLI A;  2QQS A;  3Q1J A;  3C12 A;  4BUG A;  3MEW A;  2LT4 A;  3L2Q A;  5LJ3 h;  3OVO A;  2K2V A;  4C0Z A;  2E5Q A;  5FUV A;  3X20 B;  2FHD A;  3BFM A;  4P5N A;  1M1K C;  5CKB A;  3VU3 C;  2VV5 A;  1BUS A;  1BMO A;  2NU4 I;  2IVW A;  1VQ7 A;  2BIV A;  2HD0 A;  4C92 D;  3DLL A;  2EAY A;  5GAO q;  1G3S A;  3CPF A;  4B9X A;  2DD4 A;  3V7S A;  3GP8 A;  2K5F A;  1JB0 E;  1VIF A;  3LYI A;  4XK8 E;  1NPR A;  3BDU A;  3FLG A;  3KBG A;  2KMP A;  3M58 A;  4B9W A;  1SGR I;  3M56 A;  2DZC A;  4JRI A;  4M7A F;  2ODD A;  3OYN A;  4ZTJ A;  2DAQ A;  2R5A A;  4EMH A;  1Q81 U;  1M5Q 1;  5CQX A;  2KMR A;  3OYL A;  3UEJ A;  3QG1 A;  3TU4 K;  3BY7 A;  4M77 E;  3D00 A;  3DB3 A;  2O01 E;  2XDP A;  5DAE A;  2Y4X A;  2E70 A;  2YRV A;  3JCM g;  3OBY A;  3MP8 A;  2LQ8 A;  1NE8 A;  2E5R A;  4PJO G;  1RI0 A;  4M77 C;  3RU0 A;  2QQA A;  1VQ4 T;  5I21 A;  2L8D A;  5J3B A;  4L6V 5;  3SD4 A;  2CYZ B;  2MF2 A;  3MET A;  4HT9 A;  1G5V A;  1PPF I;  1FYB A;  1VQL A;  2JTF A;  2QQC A;  2ZPB B;  1Q7Y U;  3E9F A;  1YHQ T;  1K8A C;  3OYE A;  4B6D A;  4ZN1 A;  2EKO A;  3FDR A;  3S3O A;  4HT8 A;  4C92 E;  2KMQ A;  1VQ9 A;  3SGB I;  2X35 A;  4J7F A;  3OL0 A;  3M59 A;  3V8K A;  4HCZ A;  4QQD A;  3CCM A;  2QA4 T;  4JUV A;  1Q82 C;  3JB9 F;  4M77 B;  1SGQ I;  4UC4 A;  4M7A G;  4RG8 A;  4RMO A;  3L2Z A;  3FEO A;  1EN7 A;  5C6S A;  3OXF A;  4FKD A;  1M90 C;  2EJF A;  3CBO A;  4XU2 A;  3OSS C;  3OS0 A;  4PLL A;  3G6E A;  4OF1 A;  5D6W A;  5IN1 A;  1VQO T;  1SGD I;  4V2S A;  1SGY I;  3QO3 A;  4O6J A;  1JBM A;  4C5E A;  2XI9 A;  1VQ8 T;  1YBY A;  2XU8 A;  4OB1 B;  2RD1 A;  2P4T A;  2EWN A;  2DJZ A;  3CCU T;  3X25 B;  2VXF A;  4M77 F;  2CZ0 B;  4ELZ C;  2WSE E;  1CSO I;  2PVO B;  4MMK A;  2W0T A;  3L2W A;  4LDX A;  3HFN A;  3G71 T;  3CC4 T;  4JRQ A;  3LWI A;  1VQP A;  5FU6 C;  1PTQ A;  3CBM A;  1TBN A;  2LDM A;  3UPU A;  1TUR A;  2JN0 A;  4JDS A;  2F5T X;  3QPH A;  3CC7 T;  5GAO p;  3X24 B;  2DVE A;  3CCS T;  3CCE T;  2HQX A;  3UWN A;  2ROW A;  4OVO A;  1WPY A;  2VC8 A;  2ZPG B;  5FUW A;  4LDV A;  3JCM X;  5GAN g;  1M4Z A;  3MCA B;  3JB9 G;  2DIG A;  3OBW A;  2RA2 A;  4M75 D;  3SWN A;  3QSU A;  4C92 F;  1M9S A;  5J39 A;  2E65 A;  3QJY A;  3X28 B;  1CHO I;  3E19 A;  1Y7X A;  2EYQ A;  2L3R A;  1V1H A;  5FU6 B;  1OZ2 A;  5JHW C;  2ORV A;  1WJS A;  3OA6 A;  3S3M A;  3CD6 A;  1N9R A;  2K3X A;  3GLX A;  3RKX A;  1SGE I;  5KE2 A;  5LJ3 g;  3J7A F;  1M1F A;  3QYH B;  1Y1C A;  3TJQ A;  1S72 T;  2R58 A;  4IUQ A;  1QW1 A;  1VQ6 A;  4QVZ A;  2RK1 A;  2CS7 A;  4GI3 C;  4J83 A;  2QQ0 A;  5CR2 A;  3L42 A;  3PIP A;  3JCM J;  4M77 G;  2DXB A;  1VQN A;  1YIJ T;  4FIB A;  3T9N A;  3LX7 A;  4BD3 A;  4EMK A;  1KQS A;  3CCL A;  2LRQ A;  1OI1 A;  5A0G A;  4C5G A;  3G4S A;  2GKR I;  3CCJ T;  3L1A A;  5DY9 A;  4X9C A;  3PDN A;  5CIU A;  3CMA T;  1NJI U;  1CT0 I;  2A7Y A;  4CRI A;  1VQ5 T;  3OS5 A;  3M4G A;  2KMO A;  3SWN B;  3MEA A;  2PQW A;  4BI3 A;  1BI3 A;  3VUZ A;  4MZP A;  4LDU A;  4C8Q E;  4FT4 A;  5A2Q E;  1WQW A;  1CT2 I;  4M7A A;  2QPO A;  1E7L A;  3L2V A;  2MMP A;  3ZEH A;  2D9T A;  4C92 G;  5IAY A;  2V8J A;  1XQH A;  4M75 E;  2WSC E;  1TBO A;  1PSE A;  4DQ2 A;  3UDC A;  1BIB A;  4DA4 A;  3M54 A;  1VQM A;  5FRO A;  2KQW A;  1WJR A;  1TIH A;  3CCQ A;  3MP1 A;  3H8Z A;  4M75 C;  2M0O A;  3AHU A;  1UGP B;  2JUF A;  1YJN A;  3OYG A;  4M7A C;  4DOW A;  2QDY B;  5D6Y A;  4II1 A;  5D6X A;  3R6O A;  3MHX A;  1X6O A;  1B34 A;  5GAO n;  2ZCF B;  3HRS A;  3CXC S;  5FRN A;  4KUL A;  4EMK B;  1PJU A;  3JAM E;  2YHT A;  3P8D A;  4ZTF A;  2FNF X;  1Y07 A;  1I8F A;  1YI2 T;  2VGM A;  3I56 A;  3PNW C;  5FUY A;  4O5V A;  2KY9 A;  3CPW S;  2BKD N;  2EQJ A;  3GNG A;  1LJO A;  1Y1B A;  3UFF A;  1N6A A;  4QVD A;  5AYF A;  4JS4 A;  2LUY A;  2Y90 A;  3A8O B;  3M9Q A;  4M7A B;  1Q86 C;  2DIP A;  5A0D A;  3GIB A;  3OW2 S;  1TBQ R;  2LT1 A;  5CKF A;  2BUS A;  1QVP A;  2DZ9 A;  2MWP A;  1DJ7 B;  3UGD A;  2PUO B;  1LR7 A;  5GAN 7;  5KE3 A;  4LDW A;  3CBP A;  2E6Z A;  5GMK e;  3CC2 A;  5J26 A;  1B34 B;  4C8Q F;  3RKY A;  2A20 A;  2WSF E;  5CCL A;  3GNF B;  3OYY A;  1SGP I;  4M75 F;  1YJW A;  2DXU A;  4E1R A;  4E7J A;  2ELI A;  2E41 A;  4XU3 A;  4MML A;  4A54 A;  1U8R A;  3RMQ A;  5LJ5 j;  4M77 A;  4Q5W A;  3JCM V;  1KC8 U;  3UGL A;  1D3B A;  1W4S A;  3JSC A;  2QQR A;  3UEY A;  5GAN 8;  1FXX A;  5CKH A;  2QEX T;  4CI0 C;  5EX0 A;  3NTK A;  2SGE I;  1AHJ B;  1UEB A;  2I2L A;  1LNX A;  3DKM A;  4E7H A;  4NOY A;  1OZ3 A;  4R55 A;  1KD1 C;  3KXT A;  3VDP A;  3CCR A;  1FWZ A;  2CZ6 B;  5GMK j;  1JJ2 A;  1TBR R;  5GAO r;  1N8R C;  3LH0 A;  3BJI A;  2EQM A;  3C4S A;  2YLB A;  4SGB I;  2P0Q A;  4IUV A;  4C92 A;  4ME7 A;  2GKT I;  2JVV A;  2CKK A;  3ER0 A;  1KBE A;  4HCC A;  2M1H A;  1XX6 A;  1KMA A;  5HI7 A;  2XKO C;  5C0M A;  3QXE B;  2PUK B;  1W3S A;  4PKC C;  4C8Q G;  1TOT A;  3JCM P;  4F7U E;  5GAM j;  2P0K A;  2JZ2 A;  4L59 A;  2JOY A;  4C92 C;  4J7I A;  1IY6 A;  2RJD A;  1HJA I;  1LR8 A;  2QI2 A;  4M75 G;  3WVE B;  4Y28 E;  3WXM B;  1BI2 A;  4IUT A;  2ENN A;  2GFU A;  1M8C A;  2OTJ A;  1D3B B;  2RHX A;  4X34 A;  3OYA A;  1VIE A;  3CXL A;  2RI3 A;  2V8K A;  1YJ9 A;  1QVG A;  1G3W A;  3CCV A;  1X74 A;  1VQK T;  2ZPF B;  2M16 A;  3E59 A;  2PVD B;  4KT0 E;  1XA6 A;  1KBF A;  3P8H A;  3HH2 C;  3QTL D;  3OYH A;  3C95 A;  4IKF A;  3RER A;  2DTO A;  3OYF A;  1QVF A;  2HAX A;  2UZ3 A;  2LCC A;  2EQU A;  2JXD A;  1EIF A;  2ENZ A;  1V29 B;  1IRE B;  2MWO A;  5HK0 A;  3SEK C;  3OYD A;  4C0F A;  2OTL A;  1SSF A;  1SGN I;  1YU6 C;  4XTY A;  4C92 B;  5HKC A;  2V53 A;  4PNO A;  4ELY C;  2B0U C;  5HQ8 A;  5A0L A;  3LWH A;  5GAN d;  3FJP A;  3JB9 I;  2DO3 A;  2L89 A;  2XK0 A;  1X4S A;  1YTP A;  2DTH A;  1JRI A;  2J87 A;  2QTX A;  1H64 1;  1YIT T;  4KBM B;  4J6Y A;  2DEQ A;  4XTW A;  1BKB A;  2RHY A;  3I55 T;  3PMI A;  2F69 A;  2KCX A;  2D0Q B;  1NUB A;  1M1K U;  1ZBX A;  2D6F A;  1OMU A;  3M53 A;  2SGD I;  4M7D D;  1N13 A;  2DTI A;  3EFS A;  2E73 A;  1W2B A;  4OB3 B;  2XG8 D;  4OVA A;  3CME T;  4C8Q D;  5LJ3 d;  4M78 E;  3VV0 A;  3ZFJ A;  2KK4 A;  3PGG A;  1V1I A;  2K4Y A;  4C5H A;  2EQK A;  2E12 A;  1HDL A;  1IY5 A;  3CEY A;  2XD0 A;  1BIA A;  4BAC A;  2X4W A;  3N5B B;  1N9S A;  3SB2 A;  1TUS A;  5M9O A;  4F7U F;  2CZ1 B;  1VQ7 T;  1AN1 I;  3GPL A;  1FAR A;  4HCB A;  4TVR A;  2B8T A;  2RHI A;  1Y96 B;  1NPP A;  4XTV A;  3OYM A;  3TRE A;  1PCE A;  2L5Q A;  2LNV A;  1Q81 C;  1UVG A;  2WCY A;  1VQ4 A;  3M4Y A;  5LJ5 d;  2KMT A;  2L8E A;  2NU1 I;  4EDU A;  1MT1 A;  5GAN 2;  1YHQ A;  2EJ9 A;  5GMK m;  2N52 A;  2YLC A;  2X4Y A;  4PJO E;  3KY9 A;  2JZM A;  1XTD A;  3RUX A;  1LR9 A;  4WF2 A;  2QQE A;  4YTL A;  4MZT A;  1DS2 I;  2K57 A;  3QBY A;  5GAN e;  5EG2 A;  1CGI I;  2XDB A;  1KHC A;  2DKG A;  4C8Q A;  4M7D E;  3VJP A;  5CKE A;  4EMG A;  2QQB A;  1Y71 A;  5KCO A;  3QZ9 B;  4J8O A;  4M75 A;  3SDZ A;  1Q7Y C;  5GAN 6;  2QA4 A;  4HA8 A;  4JS5 A;  2QXF A;  4E1P A;  3V8L A;  4M7D C;  2M5X A;  3OMC A;  1VQL T;  3LLR A;  3OXG A;  2KAF A;  1QVG S;  5GAN 4;  4UXJ A;  2XRC A;  4C8Q C;  3C94 A;  3A8L B;  4F7U G;  4J6W A;  5LJ3 e;  3O8V A;  3S3N A;  4M78 F;  3HRT A;  3LGL A;  4A4G A;  2BUD A;  4XTU A;  4JCV E;  3NTI A;  3QUI A;  3JCM b;  1DS3 I;  4NS5 A;  3HP9 A;  3PTA A;  5GAM d;  1VQO A;  1M90 U;  3LW5 E;  4JRP A;  3JCM c;  4Z02 A;  3WVD B;  3OS2 A;  4FL6 A;  4E7L A;  2LC4 A;  3OB9 A;  1VQ8 A;  5GAO l;  3CCM T;  2CZ7 B;  3JCM W;  5GAN j;  2ZPH B;  3CCU A;  2HQE A;  2OVO A;  3A8M B;  2J9R A;  4BI4 A;  3H6Z A;  1XOV A;  3G71 A;  3CC4 A;  3EFR A;  4J6X A;  3PFS A;  2RO0 A;  1TH7 A;  5IT9 E;  4J5Y A;  1QP3 A;  1BI0 A;  4C8Q B;  2JNG A;  2G3R A;  4IUU A;  2X4X A;  2ORW A;  1U5K A;  1IZ6 A;  4ATO A;  3G6E T;  2LVM A;  1O75 A;  4M75 B;  5LJ5 e;  5FUX A;  3CC7 A;  2KDS A;  2FL7 A;  1Y8F A;  4DOV A;  4BE1 A;  3CCS A;  4N4G A;  3CCE A;  5LJ3 j;  1R8O B;  1XBT A;  4PJO F;  5GAN 3;  4C0G A;  2P6A C;  3EAE A;  4A4K A;  2R5M A;  3VUB A;  3BDL A;  2OAU A;  2VYT A;  2SGF I;  4M7D F;  3V7C A;  1VQP T;  3ZBD A;  2LQK A;  1HK9 A;  4M78 G;  3SFM A;  5LJ5 f;  2FVU A;  4EPC A;  2K9H A;  1R79 A;  2WVJ A;  1UUC A;  3JCM d;  2DB6 A;  4KUD K;  3UGI A;  5DLQ E;  4VUB A;  3JB9 H;  1S72 A;  2RHZ A;  4OB0 B;  1M1G A;  3X26 B;  2NU3 I;  1U1T A;  2H3J A;  1PTR A;  5I2M A;  3J80 E;  2RJE A;  2ZPI B;  3MP6 A;  5FU7 C;  5CK9 A;  2F3C I;  4UXI A;  1K9M U;  1KQS S;  2GF7 A;  1YIJ A;  5GMK i;  5GAM e;  3P8B B;  3MO8 A;  1KHI A;  5LJ5 h;  2VRW B;  2FYK A;  2MI6 A;  1I4K 1;  2RI5 A;  2V1C A;  2QNF A;  4N0A A;  3QHS A;  5FLX E;  4R56 A;  4OGE A;  3CCJ A;  5HK3 A;  3HL8 A;  2LX9 A;  2VXE A;  3G7Z A;  3E1S A;  1TGS I;  3CMA A;  3CD6 T;  2R57 A;  4LD6 A;  3INZ A;  1VQ5 A;  2DK3 A;  3M5A A;  2VUB A;  4XTZ A;  2DIQ A;  1UGR B;  3QII A;  3LGF A;  1KG1 A;  3HFO A;  2X4J A;  4XTX A;  4OB2 B;  1VQ6 T;  2V1C C;  4FSX A;  4GLK A;  4N0A C;  3URG A;  5GMK h;  4QVC A;  2EFI A;  2IG0 A;  1G3T A;  2E64 A;  3RMS A;  4OMF B;  2CJS C;  1IW4 A;  5GAM f;  4OGC A;  5FU7 B;  4A4E A;  5EX3 A;  3SGQ I;  3NTH A;  4JJN K;  1VQN T;  1HXD A;  1BI1 A;  5CKD A;  3KUF A;  3JRZ A;  1WJQ A;  1NJI C;  3HRU A;  3BW1 A;  2JYY A;  2O4X A;  3OQ5 A;  4M7D G;  4QW2 A;  1KQ2 A;  4F7U A;  3CCL T;  1K73 U;  2XHC A;  1CE3 A;  4XQ3 A;  1VDD A;  3G4S T;  3PMT A;  2SGP I;  3VE5 A;  5KH6 A;  3QYG B;  4M78 D;  5CCA A;  4XAX B;  3A8H B;  1RFH A;  2QNC A;  4RCC A;  1UVF A;  4QQ6 A;  4BE2 A;  4PL6 A;  5GAM h;  1W4R A;  1E7D A;  2XIC A;  1ZHI A;  3J81 E;  1O9S A;  3HKS A;  2F5K A;  2RJF A;  3RES A;  2PU9 B;  4OP0 A;  5L8R E;  2YQP A;  3FIF A;  3MEK A;  1GXI E;  3MEV A;  3JCM e;  4IUR A;  1YI2 A;  2NLU A;  4L9M A;  2AHJ B;  2JTM A;  4JLI A;  1CGJ I;  1VQM T;  3V7R A;  3OYK A;  4MZM A;  5CO7 A;  3CCQ T;  2RI2 A;  2GQV A;  1LOJ A;  1H3Z A;  3ME9 A;  3JB9 J;  3QDR B;  1YJN T;  1Y96 A;  3QWP A;  1FX7 A;  1RL2 A;  1I81 A;  4A4F A;  1MGQ A;  4N4H A;  5I2S A;  1N27 A;  2EJG A;  3VYG A;  2YUU A;  2O4X B;  2PVG B;  2N71 A;  4F7U B;  3JCM f;  1Q86 U;  4PJO D;  4E7K A;  3CXC A;  1Z7K B;  4RG2 A;  2QQ9 A;  3L2U A;  3OYJ A;  4BE0 A;  1U1S A;  1WQ7 A;  3I56 T;  2GCX A;  4E47 A;  4BY6 C;  3E9G A;  4M78 A;  5FRM A;  2C06 A;  1YCY A;  4C5I A;  3CPW A;  4BI8 B;  4KUI A;  1BYM A;  2LTO A;  3OY9 A;  3TEE A;  4XU0 A;  2SGQ I;  3RKW A;  2QQD A;  2HBP A;  3L2R A;  3JCM h;  2CGH A;  1FAQ A;  2M9U A;  3DB4 A;  3QJ6 A;  3A8G B;  4UXH A;  3OW2 A;  4M78 C;  2RHU A;  2RK2 A;  1M8V A;  4ZN3 A;  1I5L A;  3M55 A;  4FU6 A;  4M7A D;  4ZGD B;  2GFA A;  4FT2 A;  1XNI A;  1G3Y A;  4E7I A;  4NL2 A;  2QEX A;  3CC2 T;  2JW6 A;  3VYH B;  3RIR A;  4BY6 B;  2ZPE B;  2KSS A;  4D6W A;  3GF5 A;  2N1A B;  1PSF A;  2RJC A;  3HPW A;  1JJ2 S;  2NU0 I;  3OS1 A;  2XID A;  1OMT A;  3OYB A;  2GKV A;  3SWN C;  3FC3 A;  1YJW T;  1R0R I;  3OSV A;  3PIO A;  3UT1 A;  2OD1 A;  5KCH A;  1KC8 C;  1CT4 I;  4GY5 A;  4PJO A;  1K9M C;  2DD5 A;  3QKJ A;  5GMK l;  2LCL A;  4LDY A;  2JA1 A;  1KD1 U;  4JRK A;  4LD9 K;  1HPT A;  3TCJ A;  4M78 B;  4IUP A;  1N8R U;  1NZ9 A;  2ARP F;  4HGU A;  4MDW A;  4M7D A;  2DXC A;  1UB4 A;  1K8A U;  5HY6 A;  3F70 A;  1UGS B;  4C0D C;  3HHT B;  1WNL A;  1KQ1 A;  4RCB A;  2XDD A;  4PJO C;  2KVQ G;  2LEO A;  1OYX A;  2K5L A;  3DLM A;  4A53 A;  1ZQ1 A;  2E1H A;  5CVI A;  3CCR T;  2MAM A;  1X01 A;  5LL6 S;  1MHN A;  2WAC A;  5DLO A;  1WGS A;  4MDX A;  1UGQ B;  4EMK C;  5LJ5 g;  1M8B A;  1Q82 U;  1K73 C;  2VGN A;  2ERW A;  5GAN 5;  3JB9 D;  1VQK A;  3VDU A;  3FB9 A;  5GAN f;  4A24 A;  4M7A E;  1QVF S;  2A3L A;  4BDY A;  4ZGJ B;  3E2I A;  1X75 C;  2HNI A;  1VQ9 T;  4C0D B;  3GOX A;  5CQY A;  4JLG A;  4PJO B;  2RB6 A;  2P0P A;  2E6N A;  2N17 A;  3ASK A;  3A5Z B;  4BDZ A;  3HSB A;  2Y4Y A;  1P92 A;  4HKE A;  3QZ5 B;  3OYI A;  3OYC A;  2OTJ T;  3S6W A;  4QQG A;  2DPP B;  4M7D B;  4NL3 A;  3V8J A;  4X9D A;  5GAN h;  5DM7 R;  2K5I A;  3NFC A;  5LJ3 f;  3M57 A;  1H0Z A;  2E10 A;  2K3Y A;  1YJ9 T;  5GAO m;  3CCV T;  4XU1 A;  2EIF A;  1YIT A;  3PT9 A;  1OYV I;  2DXT A;  2GVI A;  5CCM A;  3I55 A;  4M77 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...