3GOXA

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i in the absence of edta
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Restriction endonuclease Hpy99I
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3goxA01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3goxA02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3goxA03
4IKFA 5KH6A 4N4HA 1XNIA 3H6ZA 2R5AA 4IUVA 3OS1A 2L3RA 3LH0A 1EN7A 3OQ5A 2JZ2A 2RHXA 4B9XA 4A4HA 3LX7A 2R57A 4QW2A 4E7JA 4IUQA 3H8ZA 4CRIA 3O8VA 5KCOA 1RI0A 2QQRA 3ZEHA 2MWOA 4QVZA 5IN1A 2K3XA 2RHUA 3UWNA 2E6NA 4C5IA 2P0KA 3OS2A 3FC3A 3BDLA 3F70A 4GY5A 3S3MA 2LRQA 3EAEA 3MEVA 3DLMA 3QJ6A 3FEOA 4A4FA 4ZTFA 3NTHA 2EQMA 2QNCA 2PQWA 2XDPA 2K3YA 1WJRA 2QNFA 5KCHA 4BDZA 1OZ3A 4QQDA 5IAYA 4HCZA 2O4XB 3SD4A 4E7LA 4BD3A 2M16A 3P8DA 3OYNA 5C6SA 3P8HA 3OYEA 3KUFA 4BE0A 1E7LA 2D9TA 4BE1A 3QKJA 3L2UA 4E7KA 2HQEA 3DB4A 3L42A 3ASKA 3LYIA 4X34A 2RHZA 3OMCA 4Z02A 4NS5A 2QQSA 3M9QA 1KHCA 2JTFA 3S6WA 5FRNA 3OYJA 2M0OA 3E9GA 4IUUA 3OYLA 3S3NA 1H3ZA 3FDRA 2L89A 4IUPA 2BIVA 2RI2A 2E5QA 2EFIA 2G3RA 2FHDA 4OVAA 4QQ6A 4C5GA 3NTKA 3L2RA 1MHNA 4ZTJA 3QIIA 5J26A 4II1A 4PLLA 1WJSA 2X4WA 2X4XA 2CKKA 3LLRA 3MO8A 4L59A 1OZ2A 4RG2A 4A4EA 2NLUA 2DIGA 2X35A 2F5KA 4PLIA 5D6YA 3ME9A 4E7HA 2HQXA 4IUTA 3L2WA 5J39A 2GFUA 2GF7A 3PFSA 2RHIA 2LTOA 2R58A 4PL6A 4C5HA 3OYHA 4E7IA 3FLGA 1WGSA 4B9WA 2LDMA 4Q5WA 1G5VA 5D6XA 1E7DA 2M1HA 4N4GA 3S3OA 4LD6A 1N27A 2RHYA 3OY9A 2BUDA 2BKDN 2DIQA 5M9OA 2MWPA 4N4IA 5FRMA 2B8AA 3MEWA 3PMTA 2EKOA 2EQJA 2WACA 3OS0A 3GOXA 1SSFA 3PMIA 3QBYA 5FROA 3OYKA 1OI1A 3L2QA 2IG0A 3MP6A 4UC4A 3UT1A 4BACA 3LGFA 2RJDA 4FL6A 5KE2A 3NTIA 3DB3A 4BDYA 3CEYA 2RI5A 3E9FA 3MEAA 2GFAA 5KE3A 1WJQA 3OYBA 3OYCA 1OYXA 3OYDA 3OA6A 3C4SA 2LCCA 5CIUA 2RJCA 3Q1JA 3OYIA 2L8DA 4A4GA 4C5EA 2YRVA 2VYTA 2LVMA 2EQKA 2RO0A 2XK0A 3MP1A 3PNWC 4EDUA 4QQGA 3OYGA 3LGLA 5C0MA 3OYMA 3OMGA 3OYFA 3OB9A 2RJFA 2O4XA 2X4YA 3META 3MEUA 2DAQA 4FU6A 4IURA 3OYAA 5D6WA 3L2VA 2R5MA 2RJEA 3MP8A 2EQUA 2RI3A 4BE2A
chains in the Genus database with same CATH superfamily
1J3TA 1D09B 4RTZA 2ZPBB 2FZGB 1NPRA 3VS7A 2A28A 2NUTA 4KGZB 1K73C 3LX7A 1LNXA 3FB9A 4ANJA 2RHUA 3OXGA 1BIAA 4FKDA 3UEYA 1B07A 2L2PA 2F69A 3MEVA 3CPFA 2GVIA 1GRIA 2VB6A 4JJBA 1ULNA 2GKRI 2K57A 5I21A 4F17A 4Z89A 3M0UA 2KMQA 2COYA 2P6AC 1PCXA 1YCYA 4BE0A 1ZA1B 3CCET 3L42A 1BK2A 4X34A 2CT4A 1TOVA 2LNHB 1I81A 4C0FA 4M77E 2UZ3A 1Y96A 3E9GA 3VS6A 1QVFA 4XTYA 2EYYA 2NUPB 3OW2A 4QQ6A 2RQTA 5IHKA 1TURA 2RK2A 2RPNA 2A20A 5CKEA 1PG5B 4PLIA 2XMFA 1R8OB 2DMOA 1AZEA 2PTKA 1HD3A 1D1AA 2QASA 1V76A 3RKXA 4HT8A 1TWBA 3VE5A 2BE7D 2M1HA 2QYZA 4NL3A 3VDPA 2E73A 4OP0A 2RB6A 3JV3A 2JZMA 4M7AD 1UFFA 2HBPA 5A0DA 5E3PA 1U5SA 1VA7A 1VQ7Q 2H3JA 3UGLA 2HSPA 4DNCA 1WJQA 3OYBA 3LWHA 2RJCA 3C95A 2LZ6B 3HH2C 3OYIA 2L8DA 5KYXA 2EQIA 3VYGA 2XK0A 4RCCA 3SEKC 3UATA 3CXCP 1OYVI 5DAEA 3OB9A 1PWTA 3MEUA 4HCBA 3J7AF 2X3TA 3JCMJ 1PJUA 3RESA 4C92G 4OMQA 5HQ8A 3BE3A 3H41A 3CCST 3I56A 4OB1B 2JZ2A 1BMOA 3EH2A 4M7AF 3JB9D 2ZPIB 1RAIB 4MZPA 2MYSA 1IXDA 2QQRA 2RN8A 5GANh 4KUIA 1PKTA 2A37A 1EZZB 3JCMg 4F7UA 5GANd 2AZSA 3SEMA 2DK3A 3V8JA 3FEOA 4WCIA 2CP0A 1WHHA 1TOTA 1MNDA 1QVGP 2GTOA 5KCHA 3WVEB 2EAYA 2DIPA 1N8RC 4M77D 1EFNA 2JMCA 2RHZA 1U06A 2JOYA 1X69A 2O9SA 2KAFA 3JSCA 1P92A 2M0OA 2ORVA 1QCFA 1X2KA 3M0RA 5KYUB 2RI2A 1WDXA 4A4KA 5LJ3g 3A8LB 2RA2A 3QIIA 4MMKA 3JB9F 1SGQI 5ECAA 3DLLA 5HKCA 2NYSA 2X35A 3V8KA 4A53A 2DD5A 3L2WA 5J39A 4M75G 4OMMA 1GBQA 2EPDA 4AFSC 3GBQA 3G71T 1SG5A 1UECA 4J9DA 4RTVA 2EJGA 1PD0A 1VIEA 4M7DG 5GAMf 2BUDA 3FJ5A 2GNCA 4AFQC 3PMTA 4KT0E 4M77F 1SSFA 1X27A 4LE9A 1YFNA 4XK8E 2BZXA 1Q7YU 2RH2A 1Q9BA 2RI5A 1Y1CA 3CMEA 1UTIA 3OYCA 3C4SA 2MAMA 1M2OA 1TIHA 4C5EA 1SGDI 1JXOA 5EC7A 1JU5C 2A08A 1RAAB 3THKA 1MNEA 2EYXA 1CSOI 4IKFA 1CSKA 2HKNA 4PFZA 2ZZDA 1BI2A 4JZ4A 2YUNA 5GJVB 1ULMA 4A4HA 5LL6S 4QW2A 1SGYI 3VS1A 2JA1A 2ROLA 5IN1A 1TBOA 1E7OA 3UA7A 1IW4A 3CC4T 2J06A 5CK9A 2VVKA 4WTOB 5IAYA 3PGGA 4HCZA 3V7CA 2O31A 4J8OA 3GPLA 5CKBA 2OD1A 4OMPA 4DEYA 5KYYB 4F16A 2V8IA 5GANg 2DTOA 1SGNI 4C0DB 1Q7YR 1NLPC 1VOMA 5FW9A 2E5QA 2G3RA 1K0SA 1XX6A 3PDNA 4LUDA 2DKVA 1X4SA 4CC3A 3CCEQ 4L59A 4A4EA 4O6JA 1VQ4T 3ME9A 2GBQA 2GFUA 5IHNA 4B9WA 4OMNA 1VQKA 3RUXA 1CT2I 2ROTA 5M9OA 2W10A 2B8AA 2GTJA 4OVOA 1OVOA 1UUEA 3MEWA 2JW4A 2VGMA 2BUSA 1YWPA 2L3QA 3CCLA 1H641 5A0GA 2J9RA 3EFOA 3MCAB 3CD6Q 1OYXA 3U23A 5L23A 1R0CB 2LCCA 5CQXA 2ROWA 3JCMX 5FLXE 2DZ9A 2NUPA 3I5RA 2HBWA 4MDWA 4K11A 2XHCA 5C0MA 1FWZA 4ZGJB 4X1VA 2CP6A 2ZPGB 2ED0A 4DA4A 2QDLA 2R5MA 3CC7Q 2IPOB 3KBGA 2ORWA 3UF4A 1G8XA 4IUVA 1QQJA 1Q82C 2K2MA 2VWFA 1BIBA 2Z0WA 2OAUA 3VUBA 4E7JA 4CRIA 1YITT 5FU6B 2MWOA 1MMDA 4FYYB 1KQSA 4J9GA 2EIFA 2JVVA 1AVZC 1AHJB 2O2OA 1YJNA 5GANj 1YJWA 2WGCA 2QEXA 5GAMg 4UXJA 2MIOA 4FIBA 2SGFI 3HPWA 4LXCA 1VQMQ 2J6OA 1AWWA 3I56T 3HRTA 3OSVA 1Q82U 3FIFA 2VGNA 1VQ9A 3S6WA 4ELZC 3GF5A 3NMZC 1FY7A 5JHWC 1D1BA 5GAN8 2L89A 2BIVA 4RUGA 2LQ8A 4OGEA 2LC4A 7WGAA 1NE8A 1EIFA 4MZMA 1FYNA 1UGPB 4R0KA 4IUTA 1MUZA 4PJOB 2RHIA 1ULKA 1OU9A 1D0XA 2R58A 3FLGA 2ERWA 2PU9B 1H8KA 1IGQA 4EIKA 3CCVA 4KBMB 4E7SA 1R77A 1KD1U 4M78E 3BW1A 2K4YA 2XKOC 3CCJA 2RNAA 4QT7A 5EX0A 3HFOA 2KBTA 3G71Q 3GNFB 4DOVA 1KQ1A 1WGCA 3DB3A 4HVUA 3MEAA 3G7ZA 4A24A 1BBZA 3OA6A 4BY6B 3TU4K 1M8CA 4PJMA 1AWJA 2LVMA 3MP1A 1KHIA 4XTUA 2CZ1B 2EJ9A 4CC2A 1I5LA 1TS9A 3TO6A 2GQVA 3VS0A 4J9HA 2N1UA 2EGEA 2RM4A 2FB7A 4PJLA 1RLPC 2MK5A 4J9IA 4RCBA 2DM1A 4J6XA 4C92E 1YJ9Q 5CKHA 4J6YA 2QGFB 1VQLQ 2R57A 2P84A 5GAMj 3QO3A 3CMET 4RKUE 3QYHB 4XAXB 3LWIA 2YRDA 1TUSA 3OS2A 3G6EA 5I2SA 1N5ZA 1VQOA 3RR6A 1QKWA 4M77A 4A4FA 4ZGEB 5LJ5h 2YUUA 1NEBA 5LJ5d 3QDRB 2IVWA 4DBRA 5GMKh 1ZQ1A 2AIRB 3RBBB 3CCRA 2VV5A 2X3XD 3EHQA 1M90C 5GAN4 3OYEA 1QP3A 4BE1A 4Y28E 1KQ2A 2YUPA 5FRNA 4MZTA 3OYJA 2Y4XA 3UOEA 3ZFJA 2JNGA 2DILA 1M8MA 4FSXA 2LX7A 4RMOA 2CWHA 2MF2A 3NTKA 2JYYA 1NEGA 2X4XA 4LNPA 4QVDA 2JUFA 1MGQA 3FJPA 5CO7A 5D7UA 1RACB 2OTJA 1Q81U 4OMFB 2V8KA 3G4ST 2QA4A 1M90U 4JPBW 4M78D 4DBFA 2SGPI 4M75E 2K6DA 3C0CA 2RHYA 3M55A 3CCUA 1YHQA 1GFDA 2MWPA 4N4IA 4M77C 1VQ4Q 1WGTA 2F3CI 1UGRB 2E64A 4M7DE 3EGDB 3OYKA 1YIJA 1OI1A 2KMTA 2ENNA 9ATCB 3VV0A 1ZX6A 2V26A 1KIKA 3E9FA 2NU2I 1LCKA 4DBQA 1UVGA 1V1IA 5CKDA 2Y0MA 1OX9A 2M02A 2VYTA 1TH7A 2IIMA 3LH5A 4EDUA 1WTJA 4KRTA 1LPLA 1MV0B 1NZ9A 1Y57A 4JJCA 3NGPA 2N1AB 1PM3A 2F2WA 4FU6A 4IURA 3I55A 1VQKT 3R6OA 2RC4A 4M78F 5CKFA 2K5LA 2CJSC 2R5AA 4F7UG 1I5OB 2GQIA 2X9HA 2HNIA 4M78B 1AN1I 3O8VA 4JJDA 4Z8AA 1YCSB 4UXHA 1D0YA 3UWNA 4JJNK 2CSQA 4X9DA 1BB9A 4O5VA 3FC3A 3LW5E 1WPYA 2E70A 3GNGA 1QCNA 1EX4A 4LN2A 1Q81R 1HJDA 2EJFA 1N6AA 2LB7A 2KRMA 1JB0E 2HZYA 1OZ3A 4ORZA 1YITQ 2LJ3A 3SD4A 5CCMA 4C0DC 2QTVA 2KK4A 2L3SA 4J5YA 2MMPA 4P5NA 3EG3A 4PJJA 2FPFA 4LDVA 3OMCA 4TVRA 4C92B 4IUPA 1SRMA 2EFIA 2V1CA 3V8LA 5LJ5g 2A36A 5J26A 5LJ3h 2DETA 5GAN5 1YJNT 5LJ3d 2A7YA 2L7XA 1YJWT 1AWOA 3PFSA 2EYQA 4C5HA 2DBMA 3CC2A 1UB4A 1JJ2P 2QPOA 2JTEA 1G2BA 3UGIA 3VKIA 4E2FB 1Z9QA 4Y92A 2DIQA 1JXMA 1WXUA 4XU2A 5CQYA 4AMLA 2EKOA 1NM7A 3QBYA 3REBB 5FROA 4BACA 1G3TA 2QQBA 4BUGA 1FMVA 1VYUA 2RK1A 3TCJA 5KE3A 1GBRA 1S72T 1VQ6T 3HRSA 2PNIA 3KXTA 4B6MA 2DBKA 2PVGB 2O88A 3LGLA 3X20B 1LR7A 1UUCA 2DYBA 3OYMA 1Z7KB 1W4RA 1X2QA 2V1CC 3HTRA 1OPKA 4FYWB 3HL8A 5KYWB 4BE2A 1BU1A 5FU6C 4M75B 3R5BA 4QVCA 1WHGA 1XNIA 3VYHB 3CCJT 3CCMA 1VQPQ 2M0YA 3MHXA 1YI2T 2CWFA 2I2LA 4ATOA 2FZCB 2KT8A 3L2ZA 2DL4A 4M7DB 1WHLA 3M53A 3QPHA 2E6NA 1Q86R 2OTLA 2SGQI 2JM8A 4AMCA 3S3MA 3KFVA 1DS3I 1VQ8A 4C0GA 2RQWA 4AT1B 1I07A 4F14A 2CZ6B 1IREB 2BZYA 3QG1A 2WCYA 1M1FA 3P8HA 1WNLA 2LQKA 5LJ5j 2QG9B 4FM4B 3QKJA 3EGUA 2OZUA 4ME7A 2JXDA 5GMKj 1GFCA 4E47A 3CMAQ 4VUBA 4FW2A 1QMCA 1IZ6A 1NUBA 2MI6A 2EVRA 3M5AA 4PLLA 1VQOT 2CKKA 2GCXA 5L8RE 2L3PA 3ZL7C 3CBOA 2LTOA 1NLOC 3RMQA 2KDSA 2CP3A 3CCRT 3OSSC 1DS2I 5J3BA 4M4ZA 3CCQQ 1V1CA 4LD6A 2BKDN 2E1HA 3PVLA 5GAOl 3HFNA 4BY6C 1M27C 3QAHA 3L2QA 1ZLMA 4UC4A 3UT1A 1Q7YC 1M5Q1 3G4SQ 3CXLA 2XG8D 1T3SA 2CH4W 2ESWA 2E41A 4PFPA 5IT9E 5I11A 4XTVA 5IXBA 1MMNA 1P9GA 5HK3A 3BY7A 1VQNT 3UPUA 4QQGA 1IO6A 3MJXA 1TGSI 3X26B 2YLBA 4XTXA 3OYFA 2E12A 2OVOA 1F1BB 1M2VB 2L8EA 2O9VA 2DAQA 3OYAA 3J80E 1YHQT 2FYKA 1VQ7A 3OS1A 1W70A 4JUVA 1YIJT 2QTXA 2FRYA 4J83A 3I5SA 1SRLA 3ZBDA 3H8ZA 2VUBA 2EBPA 4PFOA 1AWXA 2VXEA 3EGDA 3OXFA 2N17A 1VQ5Q 2WVJA 4J7FA 1A0NB 1KSWA 3QSUA 1OPLA 2M5XA 3NTHA 1CKAA 1NPPA 2PQWA 1M9SA 5GAMh 2DTIA 3EFRA 1D0ZA 4C8QE 1BI0A 3UEJA 4PKCC 5GAMd 2NU0I 1ACMB 3JAME 3X24B 1M8BA 3EG0A 2KQWA 4E7KA 3ASKA 3LYIA 5GMKi 2EW3A 1M3AA 1JJ2S 1UHAA 4E7ZA 3VDUA 1OMUA 2BE9B 3EGXB 1PPFI 3SB2A 1H3ZA 4M7AG 2DA9A 4PJOE 3QXEB 1UGQB 3L2RA 1XBTA 2JJ9A 1OULA 2LT4A 2PZ1A 2XRCA 4M78A 2WSEE 2X52A 3KY9A 2DFUA 1OEBA 3TJQA 2NLUA 2DIGA 4Y91A 1M3BA 1PHTA 1KC8U 1R0RI 5LJ3j 2D0QB 2K3BA 1H92A 3T9NA 1FMWA 3V7RA 1FX7A 1W2BP 3CQTA 1WYXA 2E65A 5FRMA 1N8RR 1Y8FA 4KH0B 4EMGA 2JM9A 2DLPA 4LDWA 1K0XA 2Y4YA 3OS0A 3EG9B 5FU7B 2IG0A 1K9MR 2DD4A 1TBRR 2E5RA 3MEKA 3NFCA 2SGDI 3EHRA 4BDYA 3VS5A 2LJ0A 3JB9G 2ZCFB 4JLGA 3I9QA 2CSIA 1YNZA 1B34B 3PNWC 2AZVA 2KDPA 2X4JA 1M3CA 3H9NA 2GKVA 1X6OA 2XDDA 2FVUA 2X4YA 4PJNA 1MJ9A 2DYIA 3CXCS 3CPWP 2KGTA 4M78C 4RTYA 3MP8A 1S72Q 1VQ6Q 1SGPI 3RKWA 5KH6A 4N4HA 1YP5A 2YUQA 1R79A 2XI9A 4HVWA 4M77G 2KRNA 3HSBA 2DTHA 4F7UE 5KCOA 3E2IA 3M0SA 4J9FA 2ZGWA 4IIMA 1K9AA 1WXBA 3F70A 4GY5A 1KC8R 3HHTB 3DLMA 1YI2Q 3QJ6A 4C8QD 1E6HA 5HCKA 5HI7A 3TQ7P 4QQDA 2O4XB 1CGII 4BD3A 3CXCA 1QVGS 2HMAA 2OI3A 1IRXA 2JMAA 5E3RA 1WHKA 3CCMT 2ECZA 1SSHA 2KMRA 2CYZB 4PJOD 4RTXA 1TBNA 2GGRA 2NUTB 5KYWA 1P9ZA 3CCSQ 3S3NA 4HA8A 2KE9A 2OTLT 1I4K1 2DVJA 4II1A 1NXUA 3TREA 3LLRA 3VRYA 3TSZA 1OZ2A 3RKYA 1VQ8T 5CVIA 2DXBA 1KK7A 3BFMA 2DEQA 2HQHA 4E7IA 1QVGA 2K2VA 5FUWA 1KD1C 1ZUYA 4C8QB 4XU1A 3M4YA 2HDAA 1LJOA 3CCEA 3A1PA 4FL6A 4PJOF 4DBHA 3P8BB 4MDXA 1XQHA 3E19A 2DL3A 3V7SA 4QKUA 3PVQA 2RF0A 1R0BG 9WGAA 2C0OA 3OS5A 2KXDA 5GANe 1BYMA 4FT4A 4C0ZA 1HPTA 5J8FA 1V1HA 2VASA 1RFHA 3JRZA 2EKHA 2DF6A 2PVOB 4FSSA 2RQUA 2YLCA 2MPXC 2X3WD 1TUCA 1QVFP 5FWCA 1VQNQ 3CD6A 3OW2P 2RQRA 1PZWA 5KYUA 2E6ZA 1UE9A 1KBEA 4C5IA 5GMKl 2NU3I 1PCEA 3TO9A 1UDLA 2QI2A 2KYMA 2YDLA 2OU2A 1X6GA 2RMOA 3EAEA 1UGVA 3TSWA 3CC7A 2K3YA 2P0QA 1AT1B 4E1PA 1QLYA 4IIOA 2V1QA 2AHJB 1AD5A 1NBEB 3A8MB 5IHIA 1VQ7T 4LDUA 4HGUA 4J9CA 2QQ9A 4HCCA 2QQSA 2A3LA 4V2SA 2V1RA 2HAXA 4L6V5 1W2BS 3TVTA 4C5GA 1K7TA 1MHNA 1LR9A 1AZGB 4F7UB 1Y7XA 1IHWA 2Y90A 1VQMA 1Q81C 5DLOA 3CC4Q 2RQVA 3I35A 2AK5A 1K8AR 2YWWA 1WQWA 1N27A 4A54A 2M51A 4MPIA 3PMIA 1KMAA 2K5FA 5GAOn 2I0NA 5HK0A 1WZOA 2PQ8A 3NPFA 5CR2A 2DVEA 3VU3C 2YRCA 2H8HA 1D3BB 5CIUA 3Q1JA 1PSEA 4D8KA 2VRWB 1BUSA 2DO3A 3VRZA 2P0PA 3TO7A 2CGHA 3PT9A 2LNVA 2UVOA 3META 3R5DA 2W0ZA 2XDBA 2P4RA 5KYYA 2XIDA 1M1KU 1WQ7A 3G71A 4J9EA 1X75C 3FSYA 1IY5A 2L3RA 2XICA 1QKXA 1W6XA 1G83A 4GLKA 2QDYB 2DJZA 2K9GA 2ARPF 2DXUA 1FXXA 3RIRA 1UGSB 2K3XA 1U3OA 1LR8A 5DLQE 4JRPA 4BI3A 4C92D 4NL2A 1U5KA 2QNCA 2M9UA 3CBPA 1K1ZA 2VKNA 1TG0A 4FYXB 2DL8A 4RTTA 2QNFA 1B34A 2JS2A 4OF1A 3P8DA 8ATCB 3AT1B 3QWYA 4XTWA 3CCLT 1WA7A 3JCMf 3JB9J 1YJ9A 4KUDK 4LD9K 1E7LA 1VQLA 1SHGA 3L2UA 2ZPHB 4N0AA 2L5QA 1ZSZB 5GAOr 1H3HA 4KGXB 3JB9H 1MJBA 2DRKA 2KRSA 4Z02A 3EFSA 2C0IA 1UJ0A 3UDCA 1Y0MA 1MT1A 2W0TA 1XOVA 3OBYA 4GI3C 1IHVA 3CBMA 4PK4A 4M7AE 1Q86C 2E4HA 1KJWA 5D6YA 4OB2B 1JO8A 3BDUA 2P4TA 1CT0I 3QYGB 4J6WA 3HP9A 3OL0A 2DRMA 4C92F 2LDMA 4Q5WA 1M1KR 4YTLA 4XTZA 2EYWA 5FU7C 1FYBA 3M0TA 4N4GA 2COZA 1NJIU 5I2MA 1AEYA 2WACA 1QP2A 3I56Q 1Q95G 4FYVB 1W4SA 2COWA 1VYTA 2E3IA 3JCMb 2KSSA 1Q86U 3AHUA 2QEXT 4M75D 1QVFS 2QQ0A 4E1RA 1WHMA 4N0AC 3RDVA 3OW2S 1BCMA 1TU0B 2RO0A 5FUYA 1V29B 2FPEA 5I22A 4BI8B 1Z9ZA 3ER0A 4M7DD 2HCKA 2FO0A 1X74A 4FCYA 1ZUKA 1VQ4A 1MV3A 3E59A 3TOAA 1VQ9T 4JDSA 1XJWB 3L2VA 2PVDB 2CZ7B 3OQ5A 4XU0A 3HRUA 3L1AA 4F04B 4C8QA 1SKUB 2FPDA 2J7IA 1ABQA 1K73U 3VS2A 4EMKB 3EFOB 7AT1B 1TUDA 1WHJA 2F5TX 1HJAI 1PTRA 4OMOA 1FMKA 2KI7A 1ZHIA 5GAN6 3SFMA 4M75F 2VC8A 4ZTFA 1BKBA 4B6DA 3RERA 3C94A 1H0ZA 2MOXA 4PJOA 3CCVT 2XDPA 1XTDA 2PUOB 3EH1A 2A0FB 1QVPA 3PE0A 3R5AA 1NJIR 3OYNA 4M7DF 1ZA2B 3KUFA 2VXFA 3R6NA 1NYFA 4D6WA 2SRCA 1PD1A 1UHFA 4M78G 5A0LA 1WX6A 3CD6T 1WI7A 3H0IA 1ZUUA 1VUBA 2NU1I 4JS5A 4RG8A 5GAOq 3M0PA 4HVVA 2J6FA 5GAOp 2LT1A 2GKTI 1SGEI 1U1TA 2JN0A 5GANf 1YITA 2F2VA 1NG2A 2HQXA 2F1LA 3CMEQ 3CC7T 1RUWA 1VDDA 1CT4I 4C8QC 2FNFX 1RI9A 1O9SA 2FEIA 2KVQG 1GL5A 2D0NA 2K7AA 4BB7A 4AFUC 1GXIE 3X25B 3SWNB 2D6FA 2BZ8A 4LUEA 4AG1C 2EQJA 2YHTA 1K73R 1QWEA 3G6ET 4PJOC 1X6BA 4AG2C 2LCLA 5E3QA 2RD1A 3VS3A 1KQSP 3M54A 1RL2A 2KMPA 2GFAA 3QTLD 2CS7A 3OYDA 4OB0B 3A8HB 2AKKA 2CWGA 1VQMT 4M7AB 3EG1A 2DERA 2QQEA 2ZPEB 1ZBJA 2JTMA 2KROA 2CP2A 4UXIA 1QCOA 1UHCA 2HSEB 5D6WA 2RJEA 2YT6A 2EQUA 5LJ5e 2RI3A 3FSXA 2LQNA 3B4VC 2EYZA 3H0FA 5GMKe 1Y1BA 4IUQA 3QUIA 4MMLA 1K9MC 1RAHB 2KNBB 3VS4A 2J87A 2P0KA 2OTJT 2LMJA 4J9BA 2NU4I 2DB6A 2QA4T 4ELYC 2LQWA 1D3BA 1M1GA 1JEGA 3CCUT 4HKEA 1MMGA 5FWBA 3A98A 2AT1B 2HL3A 1VQPA 3M57A 4JCVE 3UFFA 5AYFA 4ZN1A 2ENZA 5C6SA 1PKSA 5GAOm 1N8RU 1O75A 5GAN7 4RTUA 5J8CA 2LCSA 4CC4B 1K9MU 1VQKQ 2EGCA 3OVOA 2V8JA 4OVAA 4X9CA 1WFWA 4ZTJA 1YWOA 3CCLQ 3D00A 4KH1B 3MO8A 1IB8A 1JQQA 2MCNA 1YTPA 1LVKA 2F5KA 3GP8A 4M77B 3I55T 4EMHA 2XU8A 1KC8C 2J05A 3M56A 1T0HA 3JCMW 2E10A 1KG1A 5EG2A 1WXTA 2DX1A 1JBMA 2LP5A 1YJ9T 2J6KA 3QZ5B 1E6GA 1U1SA 5D6XA 3CMAA 2K5IA 1VQLT 2JXBA 4L9MA 1I8FA 1S20A 8AT1B 4HCKA 3GOXA 3M58A 4AFZC 2DXTA 5DY9A 1N13A 4HT9A 2B0UC 1ZSZA 2K79A 3CEYA 4Z88A 4R55A 1CGJI 2YSQA 1X01A 4JRQA 1RADB 2QK0A 3IQLA 4A63B 4DQ2A 3CCQA 4L5GA 3VUZA 2C06A 2RJFA 3EG2A 1YJNQ 3JCMe 2K9HA 1B3QA 3QDFA 1YJWQ 2QEXQ 1N9RA 1JJ2A 2KY9A 3E1SA 1K7UA 2D1XA 3G4SA 3PIOA 2KMOA 3RU0A 2DZCA 4OMLA 2QXFA 4JRIA 1PC0A 2E5KA 4B9XA 1TSFA 2CUDA 4C92A 1RI0A 2YXYA 1VQ9Q 1Y07A 1W3SA 3N5BB 4XU3A 1SEMA 3CC2T 1X43A 2XD0A 1G3SA 2LRQA 3MPUB 1QWFA 1SF9A 4ZN3A 6AT1B 2ATCB 2LEOA 5LJ3e 2KXCA 1WJRA 1ZSZC 2FL7A 3A8GB 2DEUA 3GIBA 2M16A 3TOBA 1TXQA 5IH2A 3E2UA 1TUGB 2O01E 1W1FA 4ESRA 3PIPA 2HQEA 4FT2A 4RTWA 3X28B 2SGEI 4NS5A 1GCPA 1VQ5A 1KHCA 3CCVQ 2L0AA 1UG1A 3SDZA 2G6FX 2FHDA 3CCJQ 2DL5A 2B8TA 1I0CA 1TBQR 2CT3A 4XQ3A 4GBQA 2X4WA 4RG2A 4EMKA 1AOJA 2QQCA 2DJQA 1RAEB 1RLQC 1WIEA 2QQAA 3MKDA 2GIVA 1KQSS 2DXCA 3VJPA 1YBYA 4C92C 1RAFB 1ZBXA 5CCLA 1SGRI 4NOYA 1VYVA 2DKGA 1CHOI 3URGA 2HD0A 3QJYA 3ULRB 4M75A 4JS4A 2E3HA 2F2XA 1C6VX 1TTHB 3NTIA 1G3YA 4M7DA 4JLIA 2YQPA 2ABLA 1BI3A 1PNJA 1HK9A 2YUOA 4C8QF 2DL7A 2YRVA 3A5ZB 3G6EQ 2WSCE 3DKMA 1VQOQ 2OAWA 1OOTA 3JCMP 1PSFA 2QQDA 1Z2IA 1K8AC 3FRNA 3UGDA 4EMKC 1Y96B 2ODDA 3M4GA 1PRMC 3LH0A 3SWNA 3CCRQ 5HY6A 5GJWB 5FUXA 2NWMA 3JCMV 1YN8A 3M59A 1HYOA 4QVZA 1I1JA 1D1CA 5A2QE 3UA6A 1BCOA 5CCAA 1RAGB 1C1AA 3BDLA 4M75C 2QAZA 1KFZA 2ZAEA 1PRLC 3M0QA 1XA6A 3QZ9B 1S72A 1VQ6A 1SHFA 4KULA 5IXFA 4BDZA 1K8AU 4M7DC 4M7AA 2DPPB 4E7LA 5AT1B 1CKBA 2OTJQ 1C0MA 4LDYA 2ELIA 3QHSA 4CC7A 2QA4Q 2WSFE 3GLXA 4DEXA 1HDLA 4D8DA 1K7VA 3M9QA 3CCUQ 1YHQQ 3OYLA 1G3WA 1IY6A 1VIFA 1QW1A 5KYXB 1YI2A 2KT1A 1FARA 1Y71A 1UVFA 1YIJQ 2HKQB 1HXDA 2OJ2A 1KBFA 2KR3A 3SWNC 4E7HA 3H0HA 3NHNA 3REAB 1U8RA 1S1NA 3OYHA 1M2VA 2QGGA 1WGSA 1VQPT 1RABB 5LJ5f 2X51A 1E7DA 3TEEA 3CCSA 1MJAA 1M4ZA 4F7UF 4FW1A 1Q82R 4WP4A 3I55Q 1GCQA 4E6RA 2C0TA 1ARKA 2CP5A 3MP6A 4J7IA 3LGFA 2RJDA 5KE2A 5GMKm 4OGCA 1PTQA 4M7AC 4WF2A 3PTAA 4GLMA 3O5ZA 2N52A 3RNJA 1IGUA 5DM7R 1FAQA 2AKLA 3OYGA 2JS0A 5GAN2 2JT4A 3SGBI 3J81E 4OB3B 4R56A 3OXLA 3CMAT 1DJ7B 4C8QG 2EWNA 3HKSA 2FZKB 3OBWA 1M1KC 2PUKB 3JB9I 2BTTA 5GAN3 3CPWS 2KEAA 3H6ZA 2B86A 2D8HA 1W2BA 5GAMe 1EN7A 1KD1R 2CUBA 2RHXA 3JCMQ 1OMTA 3EGXA 4BI4A 3SGQI 3ZEHA 1SPKA 4PJOG 3JCMc 2ED1A 2FG0A 3OYYA 1HSQA 1ABOA 2DE0X 3BJIA 1GCQC 3CCQT 2CZ0B 2EQMA 3INZA 2ZPFB 2SEMA 4JRKA 1T0JA 1OQKA 5EX3A 2LX9A 1VQNA 3QWXX 5CAIA 3CC2Q 4PNOA 4KGVB 2D9TA 3CPWA 3DB4A 2LJ1A 1JRIA 2HL5C 2JTFA 3EG9A 1HEVA 1OX8A 2HEQA 2KYBA 4IUUA 4ZGDB 3FDRA 2LUYA 1M8VA 4LDXA 4EPCA 1WJSA 2CDTA 4HXJA 2OX7A 2NUZA 3A8OB 4CI0C 5KYNA 3WXMB 2CH4A 2GF7A 4SGBI 4PL6A 1YU6C 5FUVA 3C12A 1G5VA 2JW6A 3SHWA 1T3LA 1NJIC 3S3OA 1NYGA 1M30A 2CP7A 3OY9A 1BI1A 1B7TA 2RIJA 2CREA 1WKXA 2DNUA 1N9SA 1VQ5T 1K76A 3R5CA 2ENMA 1CE3A 2EGAA 2D8JA 3CCMQ 1WLPB 2H3EB 3WVDB 1LOJA 2FRWA 3CC4A 1ZSGA 1OU8A 4A4GA 2KCXA 3RMSA 2EQKA 4ZNXA 5LJ3f 2OTLQ 3D7SB 3JCMh 3OMGA 1MMAA 1OV3A 2V53A 1UJYA 2O4XA 1VQ8Q 3JCMd 2N71A 1UEBA 1K4US 4DOWA 1M90R 3QWPA 4JZ3A 3G1JA
chains in the Genus database with same CATH topology
2ZPBB 1NPRA 1K73C 3LX7A 1LNXA 3FB9A 2RHUA 3OXGA 1BIAA 4FKDA 3UEYA 2F69A 3MEVA 3CPFA 2GVIA 2GKRI 2K57A 5I21A 2KMQA 2P6AC 1YCYA 4BE0A 3CCET 3L42A 4X34A 1I81A 4C0FA 4M77E 2UZ3A 1Y96A 3E9GA 1QVFA 4XTYA 3OW2A 4QQ6A 1TURA 2RK2A 2A20A 5CKEA 4PLIA 1R8OB 4HT8A 3RKXA 3VE5A 2M1HA 3VDPA 4NL3A 2E73A 4OP0A 2RB6A 2JZMA 4M7AD 2HBPA 5A0DA 2H3JA 3UGLA 1WJQA 3OYBA 3LWHA 2RJCA 3C95A 3HH2C 3OYIA 2L8DA 3VYGA 2XK0A 4RCCA 3SEKC 1OYVI 5DAEA 3OB9A 3MEUA 4HCBA 3J7AF 3JCMJ 1PJUA 3RESA 4C92G 5HQ8A 3CCST 3I56A 4OB1B 2JZ2A 1BMOA 4M7AF 3JB9D 2ZPIB 4MZPA 2QQRA 5GANh 4KUIA 4F7UA 3JCMg 5GANd 2DK3A 3V8JA 3FEOA 1TOTA 5KCHA 3WVEB 2EAYA 2DIPA 1N8RC 4M77D 2RHZA 2JOYA 2KAFA 3JSCA 1P92A 2M0OA 2ORVA 2RI2A 4A4KA 5LJ3g 3A8LB 2RA2A 3QIIA 4MMKA 3JB9F 1SGQI 3DLLA 5HKCA 2X35A 3V8KA 4A53A 2DD5A 3L2WA 5J39A 4M75G 3G71T 2EJGA 1VIEA 4M7DG 5GAMf 2BUDA 3PMTA 4KT0E 4M77F 1SSFA 4XK8E 1Q7YU 2RH2A 2RI5A 1Y1CA 3CMEA 3OYCA 3C4SA 2MAMA 1TIHA 4C5EA 1SGDI 1CSOI 4IKFA 2ZZDA 1BI2A 4A4HA 5LL6S 4QW2A 1SGYI 2JA1A 5IN1A 1TBOA 1IW4A 3CC4T 5CK9A 5IAYA 3PGGA 4HCZA 3V7CA 4J8OA 3GPLA 5CKBA 2OD1A 2V8IA 5GANg 2DTOA 1SGNI 4C0DB 1XX6A 3PDNA 2E5QA 2G3RA 1X4SA 4L59A 4A4EA 4O6JA 1VQ4T 3ME9A 2GFUA 4B9WA 1VQKA 3RUXA 1CT2I 5M9OA 2B8AA 4OVOA 1OVOA 3MEWA 2VGMA 2BUSA 3CCLA 1H641 5A0GA 2J9RA 3MCAB 1OYXA 5CQXA 2LCCA 2ROWA 3JCMX 5FLXE 2DZ9A 4MDWA 2XHCA 5C0MA 1FWZA 4ZGJB 2ZPGB 4DA4A 2R5MA 3KBGA 2ORWA 4IUVA 1Q82C 1BIBA 2OAUA 3VUBA 4E7JA 4CRIA 1YITT 5FU6B 2MWOA 1KQSA 2EIFA 2JVVA 1AHJB 1YJNA 5GANj 1YJWA 2QEXA 5GAMg 4UXJA 4FIBA 2SGFI 3HPWA 3I56T 3HRTA 3OSVA 1Q82U 3FIFA 2VGNA 1VQ9A 3S6WA 4ELZC 3GF5A 5JHWC 5GAN8 2L89A 2BIVA 2LQ8A 4OGEA 2LC4A 1NE8A 1EIFA 4MZMA 1UGPB 4IUTA 4PJOB 2RHIA 2R58A 3FLGA 2ERWA 2PU9B 3CCVA 4KBMB 1KD1U 4M78E 3BW1A 2K4YA 2XKOC 3CCJA 5EX0A 3HFOA 3GNFB 4DOVA 1KQ1A 3DB3A 3MEAA 3G7ZA 4A24A 3OA6A 4BY6B 3TU4K 1M8CA 2LVMA 3MP1A 1KHIA 4XTUA 2CZ1B 2EJ9A 1I5LA 2GQVA 2RM4A 2FB7A 4RCBA 4J6XA 4C92E 5CKHA 4J6YA 2R57A 5GAMj 3QO3A 3CMET 4RKUE 3QYHB 4XAXB 3LWIA 1TUSA 3OS2A 3G6EA 5I2SA 1VQOA 4M77A 4A4FA 4ZGEB 5LJ5h 2YUUA 5LJ5d 3QDRB 2IVWA 5GMKh 1ZQ1A 3CCRA 2VV5A 1M90C 5GAN4 3OYEA 1QP3A 4BE1A 4Y28E 1KQ2A 5FRNA 4MZTA 3OYJA 2Y4XA 3ZFJA 2JNGA 4FSXA 4RMOA 2MF2A 3NTKA 2JYYA 2X4XA 4QVDA 2JUFA 1MGQA 3FJPA 5CO7A 2OTJA 1Q81U 4OMFB 2V8KA 3G4ST 2QA4A 1M90U 4M78D 2SGPI 4M75E 2RHYA 3M55A 3CCUA 1YHQA 2MWPA 4N4IA 4M77C 2F3CI 1UGRB 2E64A 4M7DE 3OYKA 1YIJA 1OI1A 2KMTA 2ENNA 3VV0A 3E9FA 2NU2I 1UVGA 1V1IA 5CKDA 2VYTA 1TH7A 4EDUA 1NZ9A 2N1AB 4FU6A 4IURA 3I55A 1VQKT 3R6OA 4M78F 5CKFA 2K5LA 2CJSC 2R5AA 4F7UG 2HNIA 4M78B 1AN1I 3O8VA 4UXHA 3UWNA 4JJNK 4X9DA 4O5VA 3FC3A 3LW5E 1WPYA 2E70A 3GNGA 2EJFA 1N6AA 1JB0E 1OZ3A 5CCMA 3SD4A 4C0DC 2KK4A 4J5YA 2MMPA 4P5NA 4LDVA 3OMCA 4TVRA 4C92B 4IUPA 2EFIA 2V1CA 3V8LA 5LJ5g 5J26A 5LJ3h 5GAN5 1YJNT 5LJ3d 2A7YA 2L7XA 1YJWT 3PFSA 2EYQA 4C5HA 3CC2A 1UB4A 2QPOA 3UGIA 3VKIA 2DIQA 4XU2A 5CQYA 2EKOA 3QBYA 5FROA 4BACA 1G3TA 2QQBA 4BUGA 3TCJA 2RK1A 5KE3A 1S72T 1VQ6T 3HRSA 3KXTA 2PVGB 1LR7A 3LGLA 3X20B 1UUCA 1Z7KB 3OYMA 1W4RA 2V1CC 3HL8A 4BE2A 5FU6C 4M75B 4QVCA 1XNIA 3VYHB 3CCJT 3CCMA 3MHXA 1YI2T 2I2LA 4ATOA 3L2ZA 4M7DB 3M53A 3QPHA 2E6NA 2OTLA 2SGQI 3S3MA 1DS3I 1VQ8A 4C0GA 2CZ6B 1IREB 3QG1A 2WCYA 1M1FA 3P8HA 1WNLA 2LQKA 5LJ5j 4FM4B 3QKJA 4ME7A 2JXDA 5GMKj 4E47A 4VUBA 1IZ6A 1NUBA 2MI6A 3M5AA 4PLLA 1VQOT 2CKKA 2GCXA 5L8RE 3CBOA 2LTOA 3RMQA 2KDSA 3CCRT 3OSSC 1DS2I 5J3BA 4LD6A 2BKDN 2E1HA 5GAOl 3HFNA 4BY6C 3L2QA 4UC4A 3UT1A 1Q7YC 1M5Q1 3CXLA 2XG8D 2E41A 5IT9E 4XTVA 5HK3A 3BY7A 1VQNT 3UPUA 4QQGA 1TGSI 3X26B 2YLBA 4XTXA 3OYFA 2E12A 2OVOA 2L8EA 2DAQA 3OYAA 3J80E 1YHQT 2FYKA 1VQ7A 3OS1A 4JUVA 1YIJT 2QTXA 4J83A 3ZBDA 3H8ZA 2VUBA 2VXEA 3OXFA 2N17A 2WVJA 4J7FA 3QSUA 2M5XA 3NTHA 1NPPA 2PQWA 1M9SA 5GAMh 2DTIA 3EFRA 4C8QE 1BI0A 3UEJA 4PKCC 5GAMd 2NU0I 3JAME 3X24B 1M8BA 2KQWA 4E7KA 3ASKA 3LYIA 5GMKi 1JJ2S 3VDUA 1OMUA 1PPFI 3SB2A 1H3ZA 4M7AG 4PJOE 3QXEB 1UGQB 3L2RA 1XBTA 2LT4A 2XRCA 4M78A 2WSEE 3KY9A 3TJQA 2NLUA 2DIGA 4Y91A 1KC8U 1R0RI 5LJ3j 2D0QB 3T9NA 3V7RA 1FX7A 2E65A 5FRMA 1Y8FA 4EMGA 4LDWA 2Y4YA 3OS0A 5FU7B 2IG0A 2DD4A 1TBRR 2E5RA 3MEKA 3NFCA 2SGDI 4BDYA 3JB9G 2ZCFB 4JLGA 3PNWC 1B34B 2X4JA 2GKVA 1X6OA 2XDDA 2FVUA 2X4YA 3CXCS 4M78C 3MP8A 1SGPI 3RKWA 5KH6A 4N4HA 1R79A 2XI9A 4M77G 3HSBA 2DTHA 4F7UE 5KCOA 3E2IA 2ZGWA 3F70A 4GY5A 3HHTB 3DLMA 3QJ6A 4C8QD 5HI7A 4QQDA 2O4XB 1CGII 4BD3A 3CXCA 1QVGS 3CCMT 2KMRA 2CYZB 4PJOD 1TBNA 3S3NA 4HA8A 2OTLT 1I4K1 4II1A 3TREA 3LLRA 1OZ2A 3RKYA 1VQ8T 5CVIA 2DXBA 3BFMA 2DEQA 4E7IA 1QVGA 2K2VA 5FUWA 1KD1C 4C8QB 4XU1A 3M4YA 1LJOA 3CCEA 4FL6A 4PJOF 3P8BB 4MDXA 1XQHA 3E19A 3V7SA 3OS5A 5GANe 1BYMA 4FT4A 4C0ZA 1HPTA 1V1HA 1RFHA 3JRZA 2PVOB 2YLCA 3CD6A 2E6ZA 1KBEA 4C5IA 5GMKl 2NU3I 1PCEA 2QI2A 3EAEA 3CC7A 2K3YA 2P0QA 4E1PA 2AHJB 3A8MB 1VQ7T 4LDUA 4HGUA 2QQ9A 4HCCA 2QQSA 2A3LA 4V2SA 2HAXA 4L6V5 1W2BS 4C5GA 1MHNA 1LR9A 4F7UB 1Y7XA 2Y90A 1VQMA 1Q81C 5DLOA 1WQWA 1N27A 4A54A 3PMIA 1KMAA 2K5FA 5GAOn 5HK0A 5CR2A 2DVEA 3VU3C 1D3BB 5CIUA 3Q1JA 1PSEA 2VRWB 1BUSA 2DO3A 2P0PA 2CGHA 3PT9A 2LNVA 3META 2XDBA 1M1KU 2XIDA 1WQ7A 3G71A 1X75C 1IY5A 2L3RA 2XICA 4GLKA 2QDYB 2DJZA 2ARPF 2DXUA 1FXXA 3RIRA 1UGSB 2K3XA 1LR8A 5DLQE 4JRPA 4BI3A 4C92D 4NL2A 1U5KA 2QNCA 2M9UA 3CBPA 2QNFA 1B34A 4OF1A 3P8DA 3CCLT 4XTWA 3JB9J 3JCMf 1YJ9A 4KUDK 4LD9K 1E7LA 1VQLA 3L2UA 2ZPHB 4N0AA 2L5QA 5GAOr 3JB9H 4Z02A 3UDCA 3EFSA 1MT1A 2W0TA 1XOVA 3OBYA 4GI3C 3CBMA 4M7AE 1Q86C 5D6YA 4OB2B 3BDUA 2P4TA 1CT0I 3QYGB 4J6WA 3HP9A 3OL0A 4C92F 2LDMA 4Q5WA 4YTLA 4XTZA 5FU7C 1FYBA 4N4GA 1NJIU 5I2MA 2WACA 1QP2A 1W4SA 3JCMb 2KSSA 1Q86U 3AHUA 2QEXT 4M75D 1QVFS 2QQ0A 4E1RA 4N0AC 3OW2S 2RO0A 5FUYA 1V29B 4BI8B 3ER0A 4M7DD 1X74A 1VQ4A 3E59A 1VQ9T 4JDSA 3L2VA 2PVDB 2CZ7B 3OQ5A 4XU0A 3HRUA 3L1AA 4C8QA 1K73U 4EMKB 2F5TX 1HJAI 1PTRA 1ZHIA 5GAN6 3SFMA 4M75F 2VC8A 4ZTFA 1BKBA 4B6DA 3RERA 3C94A 1H0ZA 4PJOA 3CCVT 2XDPA 1XTDA 2PUOB 1QVPA 3OYNA 4M7DF 3KUFA 2VXFA 4D6WA 5A0LA 4M78G 3CD6T 1VUBA 2NU1I 4JS5A 4RG8A 5GAOq 5GAOp 2LT1A 2GKTI 1SGEI 1U1TA 2JN0A 5GANf 1YITA 2HQXA 3CC7T 1VDDA 1CT4I 4C8QC 2FNFX 1O9SA 2KVQG 4BB7A 1GXIE 3X25B 3SWNB 2D6FA 2EQJA 2YHTA 3G6ET 4PJOC 2LCLA 2RD1A 3M54A 1RL2A 2KMPA 2GFAA 3QTLD 2CS7A 3OYDA 4OB0B 3A8HB 1VQMT 4M7AB 2QQEA 2ZPEB 2JTMA 4UXIA 5D6WA 2RJEA 2EQUA 5LJ5e 2RI3A 3B4VC 5GMKe 1Y1BA 4IUQA 3QUIA 4MMLA 1K9MC 2J87A 2P0KA 2OTJT 2NU4I 2DB6A 2QA4T 4ELYC 1D3BA 1M1GA 3CCUT 4HKEA 1VQPA 3M57A 4JCVE 3UFFA 5AYFA 4ZN1A 2ENZA 5C6SA 5GAOm 1N8RU 1O75A 5GAN7 1K9MU 3OVOA 2V8JA 4OVAA 4X9CA 4ZTJA 3D00A 3MO8A 1YTPA 2F5KA 3GP8A 4M77B 3I55T 4EMHA 2XU8A 1KC8C 3M56A 3JCMW 2E10A 1KG1A 5EG2A 1JBMA 1YJ9T 3QZ5B 1U1SA 5D6XA 3CMAA 2K5IA 1VQLT 4L9MA 1I8FA 3GOXA 3M58A 2DXTA 5DY9A 1N13A 4HT9A 2B0UC 3CEYA 4R55A 1CGJI 1X01A 4JRQA 4DQ2A 3CCQA 4L5GA 3VUZA 2C06A 2RJFA 3JCMe 2K9HA 1N9RA 1JJ2A 2KY9A 3E1SA 3G4SA 3PIOA 2KMOA 3RU0A 2DZCA 2QXFA 4JRIA 4B9XA 4C92A 1RI0A 1Y07A 1W3SA 3N5BB 4XU3A 3CC2T 2XD0A 1G3SA 2LRQA 4ZN3A 2LEOA 5LJ3e 1WJRA 2FL7A 3A8GB 3GIBA 2M16A 2O01E 3PIPA 2HQEA 4FT2A 3X28B 2SGEI 4NS5A 1VQ5A 1KHCA 3SDZA 2FHDA 2B8TA 1TBQR 4XQ3A 2X4WA 4RG2A 4EMKA 2QQCA 2QQAA 1KQSS 2DXCA 3VJPA 1YBYA 4C92C 1ZBXA 5CCLA 1SGRI 4NOYA 2DKGA 1CHOI 3URGA 2HD0A 3QJYA 4M75A 4JS4A 3NTIA 1G3YA 4M7DA 4JLIA 2YQPA 1BI3A 1HK9A 4C8QF 2YRVA 3A5ZB 2WSCE 3DKMA 3JCMP 1PSFA 2QQDA 1K8AC 3FRNA 3UGDA 4EMKC 1Y96B 2ODDA 3M4GA 3LH0A 3SWNA 5HY6A 5FUXA 3JCMV 3M59A 4QVZA 5A2QE 5CCAA 3BDLA 4M75C 1XA6A 3QZ9B 1S72A 1VQ6A 4KULA 4BDZA 1K8AU 4M7DC 4M7AA 2DPPB 4E7LA 4LDYA 2ELIA 3QHSA 2WSFE 3GLXA 1HDLA 3M9QA 3OYLA 1G3WA 1IY6A 1VIFA 1QW1A 1YI2A 1FARA 1Y71A 1UVFA 1HXDA 1KBFA 4E7HA 3SWNC 1U8RA 3OYHA 1WGSA 1VQPT 5LJ5f 1E7DA 3TEEA 3CCSA 1M4ZA 4F7UF 3MP6A 4J7IA 3LGFA 2RJDA 5KE2A 5GMKm 4OGCA 1PTQA 4M7AC 4WF2A 3PTAA 2N52A 5DM7R 1FAQA 3OYGA 5GAN2 3SGBI 3J81E 4OB3B 4R56A 3OXLA 3CMAT 1DJ7B 4C8QG 2EWNA 3HKSA 3OBWA 1M1KC 2PUKB 3JB9I 5GAN3 3CPWS 3H6ZA 1W2BA 5GAMe 1EN7A 2RHXA 3JCMQ 1OMTA 4BI4A 3SGQI 3ZEHA 4PJOG 3JCMc 3OYYA 3BJIA 3CCQT 2CZ0B 2EQMA 3INZA 2ZPFB 4JRKA 5EX3A 2LX9A 1VQNA 5CAIA 4PNOA 2D9TA 3CPWA 3DB4A 1JRIA 2JTFA 4ZGDB 4IUUA 3FDRA 2LUYA 1M8VA 4LDXA 4EPCA 1WJSA 3A8OB 4CI0C 3WXMB 2GF7A 4SGBI 4PL6A 1YU6C 5FUVA 3C12A 1G5VA 2JW6A 1NJIC 3S3OA 3OY9A 1BI1A 1N9SA 1VQ5T 1CE3A 3WVDB 1LOJA 3CC4A 2KCXA 4A4GA 3RMSA 2EQKA 5LJ3f 3JCMh 3OMGA 2V53A 2O4XA 3JCMd 2N71A 1UEBA 4DOWA 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKF A;  5KH6 A;  4N4H A;  1XNI A;  3H6Z A;  2R5A A;  4IUV A;  3OS1 A;  2L3R A;  3LH0 A;  1EN7 A;  3OQ5 A;  2JZ2 A;  2RHX A;  4B9X A;  4A4H A;  3LX7 A;  2R57 A;  4QW2 A;  4E7J A;  4IUQ A;  3H8Z A;  4CRI A;  3O8V A;  5KCO A;  1RI0 A;  2QQR A;  3ZEH A;  2MWO A;  4QVZ A;  5IN1 A;  2K3X A;  2RHU A;  3UWN A;  2E6N A;  4C5I A;  2P0K A;  3OS2 A;  3FC3 A;  3BDL A;  3F70 A;  4GY5 A;  3S3M A;  2LRQ A;  3EAE A;  3MEV A;  3DLM A;  3QJ6 A;  3FEO A;  4A4F A;  4ZTF A;  3NTH A;  2EQM A;  2QNC A;  2PQW A;  2XDP A;  2K3Y A;  1WJR A;  2QNF A;  5KCH A;  4BDZ A;  1OZ3 A;  4QQD A;  5IAY A;  4HCZ A;  2O4X B;  3SD4 A;  4E7L A;  4BD3 A;  2M16 A;  3P8D A;  3OYN A;  5C6S A;  3P8H A;  3OYE A;  3KUF A;  4BE0 A;  1E7L A;  2D9T A;  4BE1 A;  3QKJ A;  3L2U A;  4E7K A;  2HQE A;  3DB4 A;  3L42 A;  3ASK A;  3LYI A;  4X34 A;  2RHZ A;  3OMC A;  4Z02 A;  4NS5 A;  2QQS A;  3M9Q A;  1KHC A;  2JTF A;  3S6W A;  5FRN A;  3OYJ A;  2M0O A;  3E9G A;  4IUU A;  3OYL A;  3S3N A;  1H3Z A;  3FDR A;  2L89 A;  4IUP A;  2BIV A;  2RI2 A;  2E5Q A;  2EFI A;  2G3R A;  2FHD A;  4OVA A;  4QQ6 A;  4C5G A;  3NTK A;  3L2R A;  1MHN A;  4ZTJ A;  3QII A;  5J26 A;  4II1 A;  4PLL A;  1WJS A;  2X4W A;  2X4X A;  2CKK A;  3LLR A;  3MO8 A;  4L59 A;  1OZ2 A;  4RG2 A;  4A4E A;  2NLU A;  2DIG A;  2X35 A;  2F5K A;  4PLI A;  5D6Y A;  3ME9 A;  4E7H A;  2HQX A;  4IUT A;  3L2W A;  5J39 A;  2GFU A;  2GF7 A;  3PFS A;  2RHI A;  2LTO A;  2R58 A;  4PL6 A;  4C5H A;  3OYH A;  4E7I A;  3FLG A;  1WGS A;  4B9W A;  2LDM A;  4Q5W A;  1G5V A;  5D6X A;  1E7D A;  2M1H A;  4N4G A;  3S3O A;  4LD6 A;  1N27 A;  2RHY A;  3OY9 A;  2BUD A;  2BKD N;  2DIQ A;  5M9O A;  2MWP A;  4N4I A;  5FRM A;  2B8A A;  3MEW A;  3PMT A;  2EKO A;  2EQJ A;  2WAC A;  3OS0 A;  3GOX A;  1SSF A;  3PMI A;  3QBY A;  5FRO A;  3OYK A;  1OI1 A;  3L2Q A;  2IG0 A;  3MP6 A;  4UC4 A;  3UT1 A;  4BAC A;  3LGF A;  2RJD A;  4FL6 A;  5KE2 A;  3NTI A;  3DB3 A;  4BDY A;  3CEY A;  2RI5 A;  3E9F A;  3MEA A;  2GFA A;  5KE3 A;  1WJQ A;  3OYB A;  3OYC A;  1OYX A;  3OYD A;  3OA6 A;  3C4S A;  2LCC A;  5CIU A;  2RJC A;  3Q1J A;  3OYI A;  2L8D A;  4A4G A;  4C5E A;  2YRV A;  2VYT A;  2LVM A;  2EQK A;  2RO0 A;  2XK0 A;  3MP1 A;  3PNW C;  4EDU A;  4QQG A;  3OYG A;  3LGL A;  5C0M A;  3OYM A;  3OMG A;  3OYF A;  3OB9 A;  2RJF A;  2O4X A;  2X4Y A;  3MET A;  3MEU A;  2DAQ A;  4FU6 A;  4IUR A;  3OYA A;  5D6W A;  3L2V A;  2R5M A;  2RJE A;  3MP8 A;  2EQU A;  2RI3 A;  4BE2 A; 
#chains in the Genus database with same CATH topology
 1J3T A;  1D09 B;  4RTZ A;  2ZPB B;  2FZG B;  1NPR A;  3VS7 A;  2A28 A;  2NUT A;  4KGZ B;  1K73 C;  3LX7 A;  1LNX A;  3FB9 A;  4ANJ A;  2RHU A;  3OXG A;  1BIA A;  4FKD A;  3UEY A;  1B07 A;  2L2P A;  2F69 A;  3MEV A;  3CPF A;  2GVI A;  1GRI A;  2VB6 A;  4JJB A;  1ULN A;  2GKR I;  2K57 A;  5I21 A;  4F17 A;  4Z89 A;  3M0U A;  2KMQ A;  2COY A;  2P6A C;  1PCX A;  1YCY A;  4BE0 A;  1ZA1 B;  3CCE T;  3L42 A;  1BK2 A;  4X34 A;  2CT4 A;  1TOV A;  2LNH B;  1I81 A;  4C0F A;  4M77 E;  2UZ3 A;  1Y96 A;  3E9G A;  3VS6 A;  1QVF A;  4XTY A;  2EYY A;  2NUP B;  3OW2 A;  4QQ6 A;  2RQT A;  5IHK A;  1TUR A;  2RK2 A;  2RPN A;  2A20 A;  5CKE A;  1PG5 B;  4PLI A;  2XMF A;  1R8O B;  2DMO A;  1AZE A;  2PTK A;  1HD3 A;  1D1A A;  2QAS A;  1V76 A;  3RKX A;  4HT8 A;  1TWB A;  3VE5 A;  2BE7 D;  2M1H A;  2QYZ A;  4NL3 A;  3VDP A;  2E73 A;  4OP0 A;  2RB6 A;  3JV3 A;  2JZM A;  4M7A D;  1UFF A;  2HBP A;  5A0D A;  5E3P A;  1U5S A;  1VA7 A;  1VQ7 Q;  2H3J A;  3UGL A;  2HSP A;  4DNC A;  1WJQ A;  3OYB A;  3LWH A;  2RJC A;  3C95 A;  2LZ6 B;  3HH2 C;  3OYI A;  2L8D A;  5KYX A;  2EQI A;  3VYG A;  2XK0 A;  4RCC A;  3SEK C;  3UAT A;  3CXC P;  1OYV I;  5DAE A;  3OB9 A;  1PWT A;  3MEU A;  4HCB A;  3J7A F;  2X3T A;  3JCM J;  1PJU A;  3RES A;  4C92 G;  4OMQ A;  5HQ8 A;  3BE3 A;  3H41 A;  3CCS T;  3I56 A;  4OB1 B;  2JZ2 A;  1BMO A;  3EH2 A;  4M7A F;  3JB9 D;  2ZPI B;  1RAI B;  4MZP A;  2MYS A;  1IXD A;  2QQR A;  2RN8 A;  5GAN h;  4KUI A;  1PKT A;  2A37 A;  1EZZ B;  3JCM g;  4F7U A;  5GAN d;  2AZS A;  3SEM A;  2DK3 A;  3V8J A;  3FEO A;  4WCI A;  2CP0 A;  1WHH A;  1TOT A;  1MND A;  1QVG P;  2GTO A;  5KCH A;  3WVE B;  2EAY A;  2DIP A;  1N8R C;  4M77 D;  1EFN A;  2JMC A;  2RHZ A;  1U06 A;  2JOY A;  1X69 A;  2O9S A;  2KAF A;  3JSC A;  1P92 A;  2M0O A;  2ORV A;  1QCF A;  1X2K A;  3M0R A;  5KYU B;  2RI2 A;  1WDX A;  4A4K A;  5LJ3 g;  3A8L B;  2RA2 A;  3QII A;  4MMK A;  3JB9 F;  1SGQ I;  5ECA A;  3DLL A;  5HKC A;  2NYS A;  2X35 A;  3V8K A;  4A53 A;  2DD5 A;  3L2W A;  5J39 A;  4M75 G;  4OMM A;  1GBQ A;  2EPD A;  4AFS C;  3GBQ A;  3G71 T;  1SG5 A;  1UEC A;  4J9D A;  4RTV A;  2EJG A;  1PD0 A;  1VIE A;  4M7D G;  5GAM f;  2BUD A;  3FJ5 A;  2GNC A;  4AFQ C;  3PMT A;  4KT0 E;  4M77 F;  1SSF A;  1X27 A;  4LE9 A;  1YFN A;  4XK8 E;  2BZX A;  1Q7Y U;  2RH2 A;  1Q9B A;  2RI5 A;  1Y1C A;  3CME A;  1UTI A;  3OYC A;  3C4S A;  2MAM A;  1M2O A;  1TIH A;  4C5E A;  1SGD I;  1JXO A;  5EC7 A;  1JU5 C;  2A08 A;  1RAA B;  3THK A;  1MNE A;  2EYX A;  1CSO I;  4IKF A;  1CSK A;  2HKN A;  4PFZ A;  2ZZD A;  1BI2 A;  4JZ4 A;  2YUN A;  5GJV B;  1ULM A;  4A4H A;  5LL6 S;  4QW2 A;  1SGY I;  3VS1 A;  2JA1 A;  2ROL A;  5IN1 A;  1TBO A;  1E7O A;  3UA7 A;  1IW4 A;  3CC4 T;  2J06 A;  5CK9 A;  2VVK A;  4WTO B;  5IAY A;  3PGG A;  4HCZ A;  3V7C A;  2O31 A;  4J8O A;  3GPL A;  5CKB A;  2OD1 A;  4OMP A;  4DEY A;  5KYY B;  4F16 A;  2V8I A;  5GAN g;  2DTO A;  1SGN I;  4C0D B;  1Q7Y R;  1NLP C;  1VOM A;  5FW9 A;  2E5Q A;  2G3R A;  1K0S A;  1XX6 A;  3PDN A;  4LUD A;  2DKV A;  1X4S A;  4CC3 A;  3CCE Q;  4L59 A;  4A4E A;  4O6J A;  1VQ4 T;  3ME9 A;  2GBQ A;  2GFU A;  5IHN A;  4B9W A;  4OMN A;  1VQK A;  3RUX A;  1CT2 I;  2ROT A;  5M9O A;  2W10 A;  2B8A A;  2GTJ A;  4OVO A;  1OVO A;  1UUE A;  3MEW A;  2JW4 A;  2VGM A;  2BUS A;  1YWP A;  2L3Q A;  3CCL A;  1H64 1;  5A0G A;  2J9R A;  3EFO A;  3MCA B;  3CD6 Q;  1OYX A;  3U23 A;  5L23 A;  1R0C B;  2LCC A;  5CQX A;  2ROW A;  3JCM X;  5FLX E;  2DZ9 A;  2NUP A;  3I5R A;  2HBW A;  4MDW A;  4K11 A;  2XHC A;  5C0M A;  1FWZ A;  4ZGJ B;  4X1V A;  2CP6 A;  2ZPG B;  2ED0 A;  4DA4 A;  2QDL A;  2R5M A;  3CC7 Q;  2IPO B;  3KBG A;  2ORW A;  3UF4 A;  1G8X A;  4IUV A;  1QQJ A;  1Q82 C;  2K2M A;  2VWF A;  1BIB A;  2Z0W A;  2OAU A;  3VUB A;  4E7J A;  4CRI A;  1YIT T;  5FU6 B;  2MWO A;  1MMD A;  4FYY B;  1KQS A;  4J9G A;  2EIF A;  2JVV A;  1AVZ C;  1AHJ B;  2O2O A;  1YJN A;  5GAN j;  1YJW A;  2WGC A;  2QEX A;  5GAM g;  4UXJ A;  2MIO A;  4FIB A;  2SGF I;  3HPW A;  4LXC A;  1VQM Q;  2J6O A;  1AWW A;  3I56 T;  3HRT A;  3OSV A;  1Q82 U;  3FIF A;  2VGN A;  1VQ9 A;  3S6W A;  4ELZ C;  3GF5 A;  3NMZ C;  1FY7 A;  5JHW C;  1D1B A;  5GAN 8;  2L89 A;  2BIV A;  4RUG A;  2LQ8 A;  4OGE A;  2LC4 A;  7WGA A;  1NE8 A;  1EIF A;  4MZM A;  1FYN A;  1UGP B;  4R0K A;  4IUT A;  1MUZ A;  4PJO B;  2RHI A;  1ULK A;  1OU9 A;  1D0X A;  2R58 A;  3FLG A;  2ERW A;  2PU9 B;  1H8K A;  1IGQ A;  4EIK A;  3CCV A;  4KBM B;  4E7S A;  1R77 A;  1KD1 U;  4M78 E;  3BW1 A;  2K4Y A;  2XKO C;  3CCJ A;  2RNA A;  4QT7 A;  5EX0 A;  3HFO A;  2KBT A;  3G71 Q;  3GNF B;  4DOV A;  1KQ1 A;  1WGC A;  3DB3 A;  4HVU A;  3MEA A;  3G7Z A;  4A24 A;  1BBZ A;  3OA6 A;  4BY6 B;  3TU4 K;  1M8C A;  4PJM A;  1AWJ A;  2LVM A;  3MP1 A;  1KHI A;  4XTU A;  2CZ1 B;  2EJ9 A;  4CC2 A;  1I5L A;  1TS9 A;  3TO6 A;  2GQV A;  3VS0 A;  4J9H A;  2N1U A;  2EGE A;  2RM4 A;  2FB7 A;  4PJL A;  1RLP C;  2MK5 A;  4J9I A;  4RCB A;  2DM1 A;  4J6X A;  4C92 E;  1YJ9 Q;  5CKH A;  4J6Y A;  2QGF B;  1VQL Q;  2R57 A;  2P84 A;  5GAM j;  3QO3 A;  3CME T;  4RKU E;  3QYH B;  4XAX B;  3LWI A;  2YRD A;  1TUS A;  3OS2 A;  3G6E A;  5I2S A;  1N5Z A;  1VQO A;  3RR6 A;  1QKW A;  4M77 A;  4A4F A;  4ZGE B;  5LJ5 h;  2YUU A;  1NEB A;  5LJ5 d;  3QDR B;  2IVW A;  4DBR A;  5GMK h;  1ZQ1 A;  2AIR B;  3RBB B;  3CCR A;  2VV5 A;  2X3X D;  3EHQ A;  1M90 C;  5GAN 4;  3OYE A;  1QP3 A;  4BE1 A;  4Y28 E;  1KQ2 A;  2YUP A;  5FRN A;  4MZT A;  3OYJ A;  2Y4X A;  3UOE A;  3ZFJ A;  2JNG A;  2DIL A;  1M8M A;  4FSX A;  2LX7 A;  4RMO A;  2CWH A;  2MF2 A;  3NTK A;  2JYY A;  1NEG A;  2X4X A;  4LNP A;  4QVD A;  2JUF A;  1MGQ A;  3FJP A;  5CO7 A;  5D7U A;  1RAC B;  2OTJ A;  1Q81 U;  4OMF B;  2V8K A;  3G4S T;  2QA4 A;  1M90 U;  4JPB W;  4M78 D;  4DBF A;  2SGP I;  4M75 E;  2K6D A;  3C0C A;  2RHY A;  3M55 A;  3CCU A;  1YHQ A;  1GFD A;  2MWP A;  4N4I A;  4M77 C;  1VQ4 Q;  1WGT A;  2F3C I;  1UGR B;  2E64 A;  4M7D E;  3EGD B;  3OYK A;  1YIJ A;  1OI1 A;  2KMT A;  2ENN A;  9ATC B;  3VV0 A;  1ZX6 A;  2V26 A;  1KIK A;  3E9F A;  2NU2 I;  1LCK A;  4DBQ A;  1UVG A;  1V1I A;  5CKD A;  2Y0M A;  1OX9 A;  2M02 A;  2VYT A;  1TH7 A;  2IIM A;  3LH5 A;  4EDU A;  1WTJ A;  4KRT A;  1LPL A;  1MV0 B;  1NZ9 A;  1Y57 A;  4JJC A;  3NGP A;  2N1A B;  1PM3 A;  2F2W A;  4FU6 A;  4IUR A;  3I55 A;  1VQK T;  3R6O A;  2RC4 A;  4M78 F;  5CKF A;  2K5L A;  2CJS C;  2R5A A;  4F7U G;  1I5O B;  2GQI A;  2X9H A;  2HNI A;  4M78 B;  1AN1 I;  3O8V A;  4JJD A;  4Z8A A;  1YCS B;  4UXH A;  1D0Y A;  3UWN A;  4JJN K;  2CSQ A;  4X9D A;  1BB9 A;  4O5V A;  3FC3 A;  3LW5 E;  1WPY A;  2E70 A;  3GNG A;  1QCN A;  1EX4 A;  4LN2 A;  1Q81 R;  1HJD A;  2EJF A;  1N6A A;  2LB7 A;  2KRM A;  1JB0 E;  2HZY A;  1OZ3 A;  4ORZ A;  1YIT Q;  2LJ3 A;  3SD4 A;  5CCM A;  4C0D C;  2QTV A;  2KK4 A;  2L3S A;  4J5Y A;  2MMP A;  4P5N A;  3EG3 A;  4PJJ A;  2FPF A;  4LDV A;  3OMC A;  4TVR A;  4C92 B;  4IUP A;  1SRM A;  2EFI A;  2V1C A;  3V8L A;  5LJ5 g;  2A36 A;  5J26 A;  5LJ3 h;  2DET A;  5GAN 5;  1YJN T;  5LJ3 d;  2A7Y A;  2L7X A;  1YJW T;  1AWO A;  3PFS A;  2EYQ A;  4C5H A;  2DBM A;  3CC2 A;  1UB4 A;  1JJ2 P;  2QPO A;  2JTE A;  1G2B A;  3UGI A;  3VKI A;  4E2F B;  1Z9Q A;  4Y92 A;  2DIQ A;  1JXM A;  1WXU A;  4XU2 A;  5CQY A;  4AML A;  2EKO A;  1NM7 A;  3QBY A;  3REB B;  5FRO A;  4BAC A;  1G3T A;  2QQB A;  4BUG A;  1FMV A;  1VYU A;  2RK1 A;  3TCJ A;  5KE3 A;  1GBR A;  1S72 T;  1VQ6 T;  3HRS A;  2PNI A;  3KXT A;  4B6M A;  2DBK A;  2PVG B;  2O88 A;  3LGL A;  3X20 B;  1LR7 A;  1UUC A;  2DYB A;  3OYM A;  1Z7K B;  1W4R A;  1X2Q A;  2V1C C;  3HTR A;  1OPK A;  4FYW B;  3HL8 A;  5KYW B;  4BE2 A;  1BU1 A;  5FU6 C;  4M75 B;  3R5B A;  4QVC A;  1WHG A;  1XNI A;  3VYH B;  3CCJ T;  3CCM A;  1VQP Q;  2M0Y A;  3MHX A;  1YI2 T;  2CWF A;  2I2L A;  4ATO A;  2FZC B;  2KT8 A;  3L2Z A;  2DL4 A;  4M7D B;  1WHL A;  3M53 A;  3QPH A;  2E6N A;  1Q86 R;  2OTL A;  2SGQ I;  2JM8 A;  4AMC A;  3S3M A;  3KFV A;  1DS3 I;  1VQ8 A;  4C0G A;  2RQW A;  4AT1 B;  1I07 A;  4F14 A;  2CZ6 B;  1IRE B;  2BZY A;  3QG1 A;  2WCY A;  1M1F A;  3P8H A;  1WNL A;  2LQK A;  5LJ5 j;  2QG9 B;  4FM4 B;  3QKJ A;  3EGU A;  2OZU A;  4ME7 A;  2JXD A;  5GMK j;  1GFC A;  4E47 A;  3CMA Q;  4VUB A;  4FW2 A;  1QMC A;  1IZ6 A;  1NUB A;  2MI6 A;  2EVR A;  3M5A A;  4PLL A;  1VQO T;  2CKK A;  2GCX A;  5L8R E;  2L3P A;  3ZL7 C;  3CBO A;  2LTO A;  1NLO C;  3RMQ A;  2KDS A;  2CP3 A;  3CCR T;  3OSS C;  1DS2 I;  5J3B A;  4M4Z A;  3CCQ Q;  1V1C A;  4LD6 A;  2BKD N;  2E1H A;  3PVL A;  5GAO l;  3HFN A;  4BY6 C;  1M27 C;  3QAH A;  3L2Q A;  1ZLM A;  4UC4 A;  3UT1 A;  1Q7Y C;  1M5Q 1;  3G4S Q;  3CXL A;  2XG8 D;  1T3S A;  2CH4 W;  2ESW A;  2E41 A;  4PFP A;  5IT9 E;  5I11 A;  4XTV A;  5IXB A;  1MMN A;  1P9G A;  5HK3 A;  3BY7 A;  1VQN T;  3UPU A;  4QQG A;  1IO6 A;  3MJX A;  1TGS I;  3X26 B;  2YLB A;  4XTX A;  3OYF A;  2E12 A;  2OVO A;  1F1B B;  1M2V B;  2L8E A;  2O9V A;  2DAQ A;  3OYA A;  3J80 E;  1YHQ T;  2FYK A;  1VQ7 A;  3OS1 A;  1W70 A;  4JUV A;  1YIJ T;  2QTX A;  2FRY A;  4J83 A;  3I5S A;  1SRL A;  3ZBD A;  3H8Z A;  2VUB A;  2EBP A;  4PFO A;  1AWX A;  2VXE A;  3EGD A;  3OXF A;  2N17 A;  1VQ5 Q;  2WVJ A;  4J7F A;  1A0N B;  1KSW A;  3QSU A;  1OPL A;  2M5X A;  3NTH A;  1CKA A;  1NPP A;  2PQW A;  1M9S A;  5GAM h;  2DTI A;  3EFR A;  1D0Z A;  4C8Q E;  1BI0 A;  3UEJ A;  4PKC C;  5GAM d;  2NU0 I;  1ACM B;  3JAM E;  3X24 B;  1M8B A;  3EG0 A;  2KQW A;  4E7K A;  3ASK A;  3LYI A;  5GMK i;  2EW3 A;  1M3A A;  1JJ2 S;  1UHA A;  4E7Z A;  3VDU A;  1OMU A;  2BE9 B;  3EGX B;  1PPF I;  3SB2 A;  1H3Z A;  4M7A G;  2DA9 A;  4PJO E;  3QXE B;  1UGQ B;  3L2R A;  1XBT A;  2JJ9 A;  1OUL A;  2LT4 A;  2PZ1 A;  2XRC A;  4M78 A;  2WSE E;  2X52 A;  3KY9 A;  2DFU A;  1OEB A;  3TJQ A;  2NLU A;  2DIG A;  4Y91 A;  1M3B A;  1PHT A;  1KC8 U;  1R0R I;  5LJ3 j;  2D0Q B;  2K3B A;  1H92 A;  3T9N A;  1FMW A;  3V7R A;  1FX7 A;  1W2B P;  3CQT A;  1WYX A;  2E65 A;  5FRM A;  1N8R R;  1Y8F A;  4KH0 B;  4EMG A;  2JM9 A;  2DLP A;  4LDW A;  1K0X A;  2Y4Y A;  3OS0 A;  3EG9 B;  5FU7 B;  2IG0 A;  1K9M R;  2DD4 A;  1TBR R;  2E5R A;  3MEK A;  3NFC A;  2SGD I;  3EHR A;  4BDY A;  3VS5 A;  2LJ0 A;  3JB9 G;  2ZCF B;  4JLG A;  3I9Q A;  2CSI A;  1YNZ A;  1B34 B;  3PNW C;  2AZV A;  2KDP A;  2X4J A;  1M3C A;  3H9N A;  2GKV A;  1X6O A;  2XDD A;  2FVU A;  2X4Y A;  4PJN A;  1MJ9 A;  2DYI A;  3CXC S;  3CPW P;  2KGT A;  4M78 C;  4RTY A;  3MP8 A;  1S72 Q;  1VQ6 Q;  1SGP I;  3RKW A;  5KH6 A;  4N4H A;  1YP5 A;  2YUQ A;  1R79 A;  2XI9 A;  4HVW A;  4M77 G;  2KRN A;  3HSB A;  2DTH A;  4F7U E;  5KCO A;  3E2I A;  3M0S A;  4J9F A;  2ZGW A;  4IIM A;  1K9A A;  1WXB A;  3F70 A;  4GY5 A;  1KC8 R;  3HHT B;  3DLM A;  1YI2 Q;  3QJ6 A;  4C8Q D;  1E6H A;  5HCK A;  5HI7 A;  3TQ7 P;  4QQD A;  2O4X B;  1CGI I;  4BD3 A;  3CXC A;  1QVG S;  2HMA A;  2OI3 A;  1IRX A;  2JMA A;  5E3R A;  1WHK A;  3CCM T;  2ECZ A;  1SSH A;  2KMR A;  2CYZ B;  4PJO D;  4RTX A;  1TBN A;  2GGR A;  2NUT B;  5KYW A;  1P9Z A;  3CCS Q;  3S3N A;  4HA8 A;  2KE9 A;  2OTL T;  1I4K 1;  2DVJ A;  4II1 A;  1NXU A;  3TRE A;  3LLR A;  3VRY A;  3TSZ A;  1OZ2 A;  3RKY A;  1VQ8 T;  5CVI A;  2DXB A;  1KK7 A;  3BFM A;  2DEQ A;  2HQH A;  4E7I A;  1QVG A;  2K2V A;  5FUW A;  1KD1 C;  1ZUY A;  4C8Q B;  4XU1 A;  3M4Y A;  2HDA A;  1LJO A;  3CCE A;  3A1P A;  4FL6 A;  4PJO F;  4DBH A;  3P8B B;  4MDX A;  1XQH A;  3E19 A;  2DL3 A;  3V7S A;  4QKU A;  3PVQ A;  2RF0 A;  1R0B G;  9WGA A;  2C0O A;  3OS5 A;  2KXD A;  5GAN e;  1BYM A;  4FT4 A;  4C0Z A;  1HPT A;  5J8F A;  1V1H A;  2VAS A;  1RFH A;  3JRZ A;  2EKH A;  2DF6 A;  2PVO B;  4FSS A;  2RQU A;  2YLC A;  2MPX C;  2X3W D;  1TUC A;  1QVF P;  5FWC A;  1VQN Q;  3CD6 A;  3OW2 P;  2RQR A;  1PZW A;  5KYU A;  2E6Z A;  1UE9 A;  1KBE A;  4C5I A;  5GMK l;  2NU3 I;  1PCE A;  3TO9 A;  1UDL A;  2QI2 A;  2KYM A;  2YDL A;  2OU2 A;  1X6G A;  2RMO A;  3EAE A;  1UGV A;  3TSW A;  3CC7 A;  2K3Y A;  2P0Q A;  1AT1 B;  4E1P A;  1QLY A;  4IIO A;  2V1Q A;  2AHJ B;  1AD5 A;  1NBE B;  3A8M B;  5IHI A;  1VQ7 T;  4LDU A;  4HGU A;  4J9C A;  2QQ9 A;  4HCC A;  2QQS A;  2A3L A;  4V2S A;  2V1R A;  2HAX A;  4L6V 5;  1W2B S;  3TVT A;  4C5G A;  1K7T A;  1MHN A;  1LR9 A;  1AZG B;  4F7U B;  1Y7X A;  1IHW A;  2Y90 A;  1VQM A;  1Q81 C;  5DLO A;  3CC4 Q;  2RQV A;  3I35 A;  2AK5 A;  1K8A R;  2YWW A;  1WQW A;  1N27 A;  4A54 A;  2M51 A;  4MPI A;  3PMI A;  1KMA A;  2K5F A;  5GAO n;  2I0N A;  5HK0 A;  1WZO A;  2PQ8 A;  3NPF A;  5CR2 A;  2DVE A;  3VU3 C;  2YRC A;  2H8H A;  1D3B B;  5CIU A;  3Q1J A;  1PSE A;  4D8K A;  2VRW B;  1BUS A;  2DO3 A;  3VRZ A;  2P0P A;  3TO7 A;  2CGH A;  3PT9 A;  2LNV A;  2UVO A;  3MET A;  3R5D A;  2W0Z A;  2XDB A;  2P4R A;  5KYY A;  2XID A;  1M1K U;  1WQ7 A;  3G71 A;  4J9E A;  1X75 C;  3FSY A;  1IY5 A;  2L3R A;  2XIC A;  1QKX A;  1W6X A;  1G83 A;  4GLK A;  2QDY B;  2DJZ A;  2K9G A;  2ARP F;  2DXU A;  1FXX A;  3RIR A;  1UGS B;  2K3X A;  1U3O A;  1LR8 A;  5DLQ E;  4JRP A;  4BI3 A;  4C92 D;  4NL2 A;  1U5K A;  2QNC A;  2M9U A;  3CBP A;  1K1Z A;  2VKN A;  1TG0 A;  4FYX B;  2DL8 A;  4RTT A;  2QNF A;  1B34 A;  2JS2 A;  4OF1 A;  3P8D A;  8ATC B;  3AT1 B;  3QWY A;  4XTW A;  3CCL T;  1WA7 A;  3JCM f;  3JB9 J;  1YJ9 A;  4KUD K;  4LD9 K;  1E7L A;  1VQL A;  1SHG A;  3L2U A;  2ZPH B;  4N0A A;  2L5Q A;  1ZSZ B;  5GAO r;  1H3H A;  4KGX B;  3JB9 H;  1MJB A;  2DRK A;  2KRS A;  4Z02 A;  3EFS A;  2C0I A;  1UJ0 A;  3UDC A;  1Y0M A;  1MT1 A;  2W0T A;  1XOV A;  3OBY A;  4GI3 C;  1IHV A;  3CBM A;  4PK4 A;  4M7A E;  1Q86 C;  2E4H A;  1KJW A;  5D6Y A;  4OB2 B;  1JO8 A;  3BDU A;  2P4T A;  1CT0 I;  3QYG B;  4J6W A;  3HP9 A;  3OL0 A;  2DRM A;  4C92 F;  2LDM A;  4Q5W A;  1M1K R;  4YTL A;  4XTZ A;  2EYW A;  5FU7 C;  1FYB A;  3M0T A;  4N4G A;  2COZ A;  1NJI U;  5I2M A;  1AEY A;  2WAC A;  1QP2 A;  3I56 Q;  1Q95 G;  4FYV B;  1W4S A;  2COW A;  1VYT A;  2E3I A;  3JCM b;  2KSS A;  1Q86 U;  3AHU A;  2QEX T;  4M75 D;  1QVF S;  2QQ0 A;  4E1R A;  1WHM A;  4N0A C;  3RDV A;  3OW2 S;  1BCM A;  1TU0 B;  2RO0 A;  5FUY A;  1V29 B;  2FPE A;  5I22 A;  4BI8 B;  1Z9Z A;  3ER0 A;  4M7D D;  2HCK A;  2FO0 A;  1X74 A;  4FCY A;  1ZUK A;  1VQ4 A;  1MV3 A;  3E59 A;  3TOA A;  1VQ9 T;  4JDS A;  1XJW B;  3L2V A;  2PVD B;  2CZ7 B;  3OQ5 A;  4XU0 A;  3HRU A;  3L1A A;  4F04 B;  4C8Q A;  1SKU B;  2FPD A;  2J7I A;  1ABQ A;  1K73 U;  3VS2 A;  4EMK B;  3EFO B;  7AT1 B;  1TUD A;  1WHJ A;  2F5T X;  1HJA I;  1PTR A;  4OMO A;  1FMK A;  2KI7 A;  1ZHI A;  5GAN 6;  3SFM A;  4M75 F;  2VC8 A;  4ZTF A;  1BKB A;  4B6D A;  3RER A;  3C94 A;  1H0Z A;  2MOX A;  4PJO A;  3CCV T;  2XDP A;  1XTD A;  2PUO B;  3EH1 A;  2A0F B;  1QVP A;  3PE0 A;  3R5A A;  1NJI R;  3OYN A;  4M7D F;  1ZA2 B;  3KUF A;  2VXF A;  3R6N A;  1NYF A;  4D6W A;  2SRC A;  1PD1 A;  1UHF A;  4M78 G;  5A0L A;  1WX6 A;  3CD6 T;  1WI7 A;  3H0I A;  1ZUU A;  1VUB A;  2NU1 I;  4JS5 A;  4RG8 A;  5GAO q;  3M0P A;  4HVV A;  2J6F A;  5GAO p;  2LT1 A;  2GKT I;  1SGE I;  1U1T A;  2JN0 A;  5GAN f;  1YIT A;  2F2V A;  1NG2 A;  2HQX A;  2F1L A;  3CME Q;  3CC7 T;  1RUW A;  1VDD A;  1CT4 I;  4C8Q C;  2FNF X;  1RI9 A;  1O9S A;  2FEI A;  2KVQ G;  1GL5 A;  2D0N A;  2K7A A;  4BB7 A;  4AFU C;  1GXI E;  3X25 B;  3SWN B;  2D6F A;  2BZ8 A;  4LUE A;  4AG1 C;  2EQJ A;  2YHT A;  1K73 R;  1QWE A;  3G6E T;  4PJO C;  1X6B A;  4AG2 C;  2LCL A;  5E3Q A;  2RD1 A;  3VS3 A;  1KQS P;  3M54 A;  1RL2 A;  2KMP A;  2GFA A;  3QTL D;  2CS7 A;  3OYD A;  4OB0 B;  3A8H B;  2AKK A;  2CWG A;  1VQM T;  4M7A B;  3EG1 A;  2DER A;  2QQE A;  2ZPE B;  1ZBJ A;  2JTM A;  2KRO A;  2CP2 A;  4UXI A;  1QCO A;  1UHC A;  2HSE B;  5D6W A;  2RJE A;  2YT6 A;  2EQU A;  5LJ5 e;  2RI3 A;  3FSX A;  2LQN A;  3B4V C;  2EYZ A;  3H0F A;  5GMK e;  1Y1B A;  4IUQ A;  3QUI A;  4MML A;  1K9M C;  1RAH B;  2KNB B;  3VS4 A;  2J87 A;  2P0K A;  2OTJ T;  2LMJ A;  4J9B A;  2NU4 I;  2DB6 A;  2QA4 T;  4ELY C;  2LQW A;  1D3B A;  1M1G A;  1JEG A;  3CCU T;  4HKE A;  1MMG A;  5FWB A;  3A98 A;  2AT1 B;  2HL3 A;  1VQP A;  3M57 A;  4JCV E;  3UFF A;  5AYF A;  4ZN1 A;  2ENZ A;  5C6S A;  1PKS A;  5GAO m;  1N8R U;  1O75 A;  5GAN 7;  4RTU A;  5J8C A;  2LCS A;  4CC4 B;  1K9M U;  1VQK Q;  2EGC A;  3OVO A;  2V8J A;  4OVA A;  4X9C A;  1WFW A;  4ZTJ A;  1YWO A;  3CCL Q;  3D00 A;  4KH1 B;  3MO8 A;  1IB8 A;  1JQQ A;  2MCN A;  1YTP A;  1LVK A;  2F5K A;  3GP8 A;  4M77 B;  3I55 T;  4EMH A;  2XU8 A;  1KC8 C;  2J05 A;  3M56 A;  1T0H A;  3JCM W;  2E10 A;  1KG1 A;  5EG2 A;  1WXT A;  2DX1 A;  1JBM A;  2LP5 A;  1YJ9 T;  2J6K A;  3QZ5 B;  1E6G A;  1U1S A;  5D6X A;  3CMA A;  2K5I A;  1VQL T;  2JXB A;  4L9M A;  1I8F A;  1S20 A;  8AT1 B;  4HCK A;  3GOX A;  3M58 A;  4AFZ C;  2DXT A;  5DY9 A;  1N13 A;  4HT9 A;  2B0U C;  1ZSZ A;  2K79 A;  3CEY A;  4Z88 A;  4R55 A;  1CGJ I;  2YSQ A;  1X01 A;  4JRQ A;  1RAD B;  2QK0 A;  3IQL A;  4A63 B;  4DQ2 A;  3CCQ A;  4L5G A;  3VUZ A;  2C06 A;  2RJF A;  3EG2 A;  1YJN Q;  3JCM e;  2K9H A;  1B3Q A;  3QDF A;  1YJW Q;  2QEX Q;  1N9R A;  1JJ2 A;  2KY9 A;  3E1S A;  1K7U A;  2D1X A;  3G4S A;  3PIO A;  2KMO A;  3RU0 A;  2DZC A;  4OML A;  2QXF A;  4JRI A;  1PC0 A;  2E5K A;  4B9X A;  1TSF A;  2CUD A;  4C92 A;  1RI0 A;  2YXY A;  1VQ9 Q;  1Y07 A;  1W3S A;  3N5B B;  4XU3 A;  1SEM A;  3CC2 T;  1X43 A;  2XD0 A;  1G3S A;  2LRQ A;  3MPU B;  1QWF A;  1SF9 A;  4ZN3 A;  6AT1 B;  2ATC B;  2LEO A;  5LJ3 e;  2KXC A;  1WJR A;  1ZSZ C;  2FL7 A;  3A8G B;  2DEU A;  3GIB A;  2M16 A;  3TOB A;  1TXQ A;  5IH2 A;  3E2U A;  1TUG B;  2O01 E;  1W1F A;  4ESR A;  3PIP A;  2HQE A;  4FT2 A;  4RTW A;  3X28 B;  2SGE I;  4NS5 A;  1GCP A;  1VQ5 A;  1KHC A;  3CCV Q;  2L0A A;  1UG1 A;  3SDZ A;  2G6F X;  2FHD A;  3CCJ Q;  2DL5 A;  2B8T A;  1I0C A;  1TBQ R;  2CT3 A;  4XQ3 A;  4GBQ A;  2X4W A;  4RG2 A;  4EMK A;  1AOJ A;  2QQC A;  2DJQ A;  1RAE B;  1RLQ C;  1WIE A;  2QQA A;  3MKD A;  2GIV A;  1KQS S;  2DXC A;  3VJP A;  1YBY A;  4C92 C;  1RAF B;  1ZBX A;  5CCL A;  1SGR I;  4NOY A;  1VYV A;  2DKG A;  1CHO I;  3URG A;  2HD0 A;  3QJY A;  3ULR B;  4M75 A;  4JS4 A;  2E3H A;  2F2X A;  1C6V X;  1TTH B;  3NTI A;  1G3Y A;  4M7D A;  4JLI A;  2YQP A;  2ABL A;  1BI3 A;  1PNJ A;  1HK9 A;  2YUO A;  4C8Q F;  2DL7 A;  2YRV A;  3A5Z B;  3G6E Q;  2WSC E;  3DKM A;  1VQO Q;  2OAW A;  1OOT A;  3JCM P;  1PSF A;  2QQD A;  1Z2I A;  1K8A C;  3FRN A;  3UGD A;  4EMK C;  1Y96 B;  2ODD A;  3M4G A;  1PRM C;  3LH0 A;  3SWN A;  3CCR Q;  5HY6 A;  5GJW B;  5FUX A;  2NWM A;  3JCM V;  1YN8 A;  3M59 A;  1HYO A;  4QVZ A;  1I1J A;  1D1C A;  5A2Q E;  3UA6 A;  1BCO A;  5CCA A;  1RAG B;  1C1A A;  3BDL A;  4M75 C;  2QAZ A;  1KFZ A;  2ZAE A;  1PRL C;  3M0Q A;  1XA6 A;  3QZ9 B;  1S72 A;  1VQ6 A;  1SHF A;  4KUL A;  5IXF A;  4BDZ A;  1K8A U;  4M7D C;  4M7A A;  2DPP B;  4E7L A;  5AT1 B;  1CKB A;  2OTJ Q;  1C0M A;  4LDY A;  2ELI A;  3QHS A;  4CC7 A;  2QA4 Q;  2WSF E;  3GLX A;  4DEX A;  1HDL A;  4D8D A;  1K7V A;  3M9Q A;  3CCU Q;  1YHQ Q;  3OYL A;  1G3W A;  1IY6 A;  1VIF A;  1QW1 A;  5KYX B;  1YI2 A;  2KT1 A;  1FAR A;  1Y71 A;  1UVF A;  1YIJ Q;  2HKQ B;  1HXD A;  2OJ2 A;  1KBF A;  2KR3 A;  3SWN C;  4E7H A;  3H0H A;  3NHN A;  3REA B;  1U8R A;  1S1N A;  3OYH A;  1M2V A;  2QGG A;  1WGS A;  1VQP T;  1RAB B;  5LJ5 f;  2X51 A;  1E7D A;  3TEE A;  3CCS A;  1MJA A;  1M4Z A;  4F7U F;  4FW1 A;  1Q82 R;  4WP4 A;  3I55 Q;  1GCQ A;  4E6R A;  2C0T A;  1ARK A;  2CP5 A;  3MP6 A;  4J7I A;  3LGF A;  2RJD A;  5KE2 A;  5GMK m;  4OGC A;  1PTQ A;  4M7A C;  4WF2 A;  3PTA A;  4GLM A;  3O5Z A;  2N52 A;  3RNJ A;  1IGU A;  5DM7 R;  1FAQ A;  2AKL A;  3OYG A;  2JS0 A;  5GAN 2;  2JT4 A;  3SGB I;  3J81 E;  4OB3 B;  4R56 A;  3OXL A;  3CMA T;  1DJ7 B;  4C8Q G;  2EWN A;  3HKS A;  2FZK B;  3OBW A;  1M1K C;  2PUK B;  3JB9 I;  2BTT A;  5GAN 3;  3CPW S;  2KEA A;  3H6Z A;  2B86 A;  2D8H A;  1W2B A;  5GAM e;  1EN7 A;  1KD1 R;  2CUB A;  2RHX A;  3JCM Q;  1OMT A;  3EGX A;  4BI4 A;  3SGQ I;  3ZEH A;  1SPK A;  4PJO G;  3JCM c;  2ED1 A;  2FG0 A;  3OYY A;  1HSQ A;  1ABO A;  2DE0 X;  3BJI A;  1GCQ C;  3CCQ T;  2CZ0 B;  2EQM A;  3INZ A;  2ZPF B;  2SEM A;  4JRK A;  1T0J A;  1OQK A;  5EX3 A;  2LX9 A;  1VQN A;  3QWX X;  5CAI A;  3CC2 Q;  4PNO A;  4KGV B;  2D9T A;  3CPW A;  3DB4 A;  2LJ1 A;  1JRI A;  2HL5 C;  2JTF A;  3EG9 A;  1HEV A;  1OX8 A;  2HEQ A;  2KYB A;  4IUU A;  4ZGD B;  3FDR A;  2LUY A;  1M8V A;  4LDX A;  4EPC A;  1WJS A;  2CDT A;  4HXJ A;  2OX7 A;  2NUZ A;  3A8O B;  4CI0 C;  5KYN A;  3WXM B;  2CH4 A;  2GF7 A;  4SGB I;  4PL6 A;  1YU6 C;  5FUV A;  3C12 A;  1G5V A;  2JW6 A;  3SHW A;  1T3L A;  1NJI C;  3S3O A;  1NYG A;  1M30 A;  2CP7 A;  3OY9 A;  1BI1 A;  1B7T A;  2RIJ A;  2CRE A;  1WKX A;  2DNU A;  1N9S A;  1VQ5 T;  1K76 A;  3R5C A;  2ENM A;  1CE3 A;  2EGA A;  2D8J A;  3CCM Q;  1WLP B;  2H3E B;  3WVD B;  1LOJ A;  2FRW A;  3CC4 A;  1ZSG A;  1OU8 A;  4A4G A;  2KCX A;  3RMS A;  2EQK A;  4ZNX A;  5LJ3 f;  2OTL Q;  3D7S B;  3JCM h;  3OMG A;  1MMA A;  1OV3 A;  2V53 A;  1UJY A;  2O4X A;  1VQ8 Q;  3JCM d;  2N71 A;  1UEB A;  1K4U S;  4DOW A;  1M90 R;  3QWP A;  4JZ3 A;  3G1J A; 
#chains in the Genus database with same CATH homology
 2ZPB B;  1NPR A;  1K73 C;  3LX7 A;  1LNX A;  3FB9 A;  2RHU A;  3OXG A;  1BIA A;  4FKD A;  3UEY A;  2F69 A;  3MEV A;  3CPF A;  2GVI A;  2GKR I;  2K57 A;  5I21 A;  2KMQ A;  2P6A C;  1YCY A;  4BE0 A;  3CCE T;  3L42 A;  4X34 A;  1I81 A;  4C0F A;  4M77 E;  2UZ3 A;  1Y96 A;  3E9G A;  1QVF A;  4XTY A;  3OW2 A;  4QQ6 A;  1TUR A;  2RK2 A;  2A20 A;  5CKE A;  4PLI A;  1R8O B;  4HT8 A;  3RKX A;  3VE5 A;  2M1H A;  3VDP A;  4NL3 A;  2E73 A;  4OP0 A;  2RB6 A;  2JZM A;  4M7A D;  2HBP A;  5A0D A;  2H3J A;  3UGL A;  1WJQ A;  3OYB A;  3LWH A;  2RJC A;  3C95 A;  3HH2 C;  3OYI A;  2L8D A;  3VYG A;  2XK0 A;  4RCC A;  3SEK C;  1OYV I;  5DAE A;  3OB9 A;  3MEU A;  4HCB A;  3J7A F;  3JCM J;  1PJU A;  3RES A;  4C92 G;  5HQ8 A;  3CCS T;  3I56 A;  4OB1 B;  2JZ2 A;  1BMO A;  4M7A F;  3JB9 D;  2ZPI B;  4MZP A;  2QQR A;  5GAN h;  4KUI A;  4F7U A;  3JCM g;  5GAN d;  2DK3 A;  3V8J A;  3FEO A;  1TOT A;  5KCH A;  3WVE B;  2EAY A;  2DIP A;  1N8R C;  4M77 D;  2RHZ A;  2JOY A;  2KAF A;  3JSC A;  1P92 A;  2M0O A;  2ORV A;  2RI2 A;  4A4K A;  5LJ3 g;  3A8L B;  2RA2 A;  3QII A;  4MMK A;  3JB9 F;  1SGQ I;  3DLL A;  5HKC A;  2X35 A;  3V8K A;  4A53 A;  2DD5 A;  3L2W A;  5J39 A;  4M75 G;  3G71 T;  2EJG A;  1VIE A;  4M7D G;  5GAM f;  2BUD A;  3PMT A;  4KT0 E;  4M77 F;  1SSF A;  4XK8 E;  1Q7Y U;  2RH2 A;  2RI5 A;  1Y1C A;  3CME A;  3OYC A;  3C4S A;  2MAM A;  1TIH A;  4C5E A;  1SGD I;  1CSO I;  4IKF A;  2ZZD A;  1BI2 A;  4A4H A;  5LL6 S;  4QW2 A;  1SGY I;  2JA1 A;  5IN1 A;  1TBO A;  1IW4 A;  3CC4 T;  5CK9 A;  5IAY A;  3PGG A;  4HCZ A;  3V7C A;  4J8O A;  3GPL A;  5CKB A;  2OD1 A;  2V8I A;  5GAN g;  2DTO A;  1SGN I;  4C0D B;  1XX6 A;  3PDN A;  2E5Q A;  2G3R A;  1X4S A;  4L59 A;  4A4E A;  4O6J A;  1VQ4 T;  3ME9 A;  2GFU A;  4B9W A;  1VQK A;  3RUX A;  1CT2 I;  5M9O A;  2B8A A;  4OVO A;  1OVO A;  3MEW A;  2VGM A;  2BUS A;  3CCL A;  1H64 1;  5A0G A;  2J9R A;  3MCA B;  1OYX A;  5CQX A;  2LCC A;  2ROW A;  3JCM X;  5FLX E;  2DZ9 A;  4MDW A;  2XHC A;  5C0M A;  1FWZ A;  4ZGJ B;  2ZPG B;  4DA4 A;  2R5M A;  3KBG A;  2ORW A;  4IUV A;  1Q82 C;  1BIB A;  2OAU A;  3VUB A;  4E7J A;  4CRI A;  1YIT T;  5FU6 B;  2MWO A;  1KQS A;  2EIF A;  2JVV A;  1AHJ B;  1YJN A;  5GAN j;  1YJW A;  2QEX A;  5GAM g;  4UXJ A;  4FIB A;  2SGF I;  3HPW A;  3I56 T;  3HRT A;  3OSV A;  1Q82 U;  3FIF A;  2VGN A;  1VQ9 A;  3S6W A;  4ELZ C;  3GF5 A;  5JHW C;  5GAN 8;  2L89 A;  2BIV A;  2LQ8 A;  4OGE A;  2LC4 A;  1NE8 A;  1EIF A;  4MZM A;  1UGP B;  4IUT A;  4PJO B;  2RHI A;  2R58 A;  3FLG A;  2ERW A;  2PU9 B;  3CCV A;  4KBM B;  1KD1 U;  4M78 E;  3BW1 A;  2K4Y A;  2XKO C;  3CCJ A;  5EX0 A;  3HFO A;  3GNF B;  4DOV A;  1KQ1 A;  3DB3 A;  3MEA A;  3G7Z A;  4A24 A;  3OA6 A;  4BY6 B;  3TU4 K;  1M8C A;  2LVM A;  3MP1 A;  1KHI A;  4XTU A;  2CZ1 B;  2EJ9 A;  1I5L A;  2GQV A;  2RM4 A;  2FB7 A;  4RCB A;  4J6X A;  4C92 E;  5CKH A;  4J6Y A;  2R57 A;  5GAM j;  3QO3 A;  3CME T;  4RKU E;  3QYH B;  4XAX B;  3LWI A;  1TUS A;  3OS2 A;  3G6E A;  5I2S A;  1VQO A;  4M77 A;  4A4F A;  4ZGE B;  5LJ5 h;  2YUU A;  5LJ5 d;  3QDR B;  2IVW A;  5GMK h;  1ZQ1 A;  3CCR A;  2VV5 A;  1M90 C;  5GAN 4;  3OYE A;  1QP3 A;  4BE1 A;  4Y28 E;  1KQ2 A;  5FRN A;  4MZT A;  3OYJ A;  2Y4X A;  3ZFJ A;  2JNG A;  4FSX A;  4RMO A;  2MF2 A;  3NTK A;  2JYY A;  2X4X A;  4QVD A;  2JUF A;  1MGQ A;  3FJP A;  5CO7 A;  2OTJ A;  1Q81 U;  4OMF B;  2V8K A;  3G4S T;  2QA4 A;  1M90 U;  4M78 D;  2SGP I;  4M75 E;  2RHY A;  3M55 A;  3CCU A;  1YHQ A;  2MWP A;  4N4I A;  4M77 C;  2F3C I;  1UGR B;  2E64 A;  4M7D E;  3OYK A;  1YIJ A;  1OI1 A;  2KMT A;  2ENN A;  3VV0 A;  3E9F A;  2NU2 I;  1UVG A;  1V1I A;  5CKD A;  2VYT A;  1TH7 A;  4EDU A;  1NZ9 A;  2N1A B;  4FU6 A;  4IUR A;  3I55 A;  1VQK T;  3R6O A;  4M78 F;  5CKF A;  2K5L A;  2CJS C;  2R5A A;  4F7U G;  2HNI A;  4M78 B;  1AN1 I;  3O8V A;  4UXH A;  3UWN A;  4JJN K;  4X9D A;  4O5V A;  3FC3 A;  3LW5 E;  1WPY A;  2E70 A;  3GNG A;  2EJF A;  1N6A A;  1JB0 E;  1OZ3 A;  5CCM A;  3SD4 A;  4C0D C;  2KK4 A;  4J5Y A;  2MMP A;  4P5N A;  4LDV A;  3OMC A;  4TVR A;  4C92 B;  4IUP A;  2EFI A;  2V1C A;  3V8L A;  5LJ5 g;  5J26 A;  5LJ3 h;  5GAN 5;  1YJN T;  5LJ3 d;  2A7Y A;  2L7X A;  1YJW T;  3PFS A;  2EYQ A;  4C5H A;  3CC2 A;  1UB4 A;  2QPO A;  3UGI A;  3VKI A;  2DIQ A;  4XU2 A;  5CQY A;  2EKO A;  3QBY A;  5FRO A;  4BAC A;  1G3T A;  2QQB A;  4BUG A;  3TCJ A;  2RK1 A;  5KE3 A;  1S72 T;  1VQ6 T;  3HRS A;  3KXT A;  2PVG B;  1LR7 A;  3LGL A;  3X20 B;  1UUC A;  1Z7K B;  3OYM A;  1W4R A;  2V1C C;  3HL8 A;  4BE2 A;  5FU6 C;  4M75 B;  4QVC A;  1XNI A;  3VYH B;  3CCJ T;  3CCM A;  3MHX A;  1YI2 T;  2I2L A;  4ATO A;  3L2Z A;  4M7D B;  3M53 A;  3QPH A;  2E6N A;  2OTL A;  2SGQ I;  3S3M A;  1DS3 I;  1VQ8 A;  4C0G A;  2CZ6 B;  1IRE B;  3QG1 A;  2WCY A;  1M1F A;  3P8H A;  1WNL A;  2LQK A;  5LJ5 j;  4FM4 B;  3QKJ A;  4ME7 A;  2JXD A;  5GMK j;  4E47 A;  4VUB A;  1IZ6 A;  1NUB A;  2MI6 A;  3M5A A;  4PLL A;  1VQO T;  2CKK A;  2GCX A;  5L8R E;  3CBO A;  2LTO A;  3RMQ A;  2KDS A;  3CCR T;  3OSS C;  1DS2 I;  5J3B A;  4LD6 A;  2BKD N;  2E1H A;  5GAO l;  3HFN A;  4BY6 C;  3L2Q A;  4UC4 A;  3UT1 A;  1Q7Y C;  1M5Q 1;  3CXL A;  2XG8 D;  2E41 A;  5IT9 E;  4XTV A;  5HK3 A;  3BY7 A;  1VQN T;  3UPU A;  4QQG A;  1TGS I;  3X26 B;  2YLB A;  4XTX A;  3OYF A;  2E12 A;  2OVO A;  2L8E A;  2DAQ A;  3OYA A;  3J80 E;  1YHQ T;  2FYK A;  1VQ7 A;  3OS1 A;  4JUV A;  1YIJ T;  2QTX A;  4J83 A;  3ZBD A;  3H8Z A;  2VUB A;  2VXE A;  3OXF A;  2N17 A;  2WVJ A;  4J7F A;  3QSU A;  2M5X A;  3NTH A;  1NPP A;  2PQW A;  1M9S A;  5GAM h;  2DTI A;  3EFR A;  4C8Q E;  1BI0 A;  3UEJ A;  4PKC C;  5GAM d;  2NU0 I;  3JAM E;  3X24 B;  1M8B A;  2KQW A;  4E7K A;  3ASK A;  3LYI A;  5GMK i;  1JJ2 S;  3VDU A;  1OMU A;  1PPF I;  3SB2 A;  1H3Z A;  4M7A G;  4PJO E;  3QXE B;  1UGQ B;  3L2R A;  1XBT A;  2LT4 A;  2XRC A;  4M78 A;  2WSE E;  3KY9 A;  3TJQ A;  2NLU A;  2DIG A;  4Y91 A;  1KC8 U;  1R0R I;  5LJ3 j;  2D0Q B;  3T9N A;  3V7R A;  1FX7 A;  2E65 A;  5FRM A;  1Y8F A;  4EMG A;  4LDW A;  2Y4Y A;  3OS0 A;  5FU7 B;  2IG0 A;  2DD4 A;  1TBR R;  2E5R A;  3MEK A;  3NFC A;  2SGD I;  4BDY A;  3JB9 G;  2ZCF B;  4JLG A;  3PNW C;  1B34 B;  2X4J A;  2GKV A;  1X6O A;  2XDD A;  2FVU A;  2X4Y A;  3CXC S;  4M78 C;  3MP8 A;  1SGP I;  3RKW A;  5KH6 A;  4N4H A;  1R79 A;  2XI9 A;  4M77 G;  3HSB A;  2DTH A;  4F7U E;  5KCO A;  3E2I A;  2ZGW A;  3F70 A;  4GY5 A;  3HHT B;  3DLM A;  3QJ6 A;  4C8Q D;  5HI7 A;  4QQD A;  2O4X B;  1CGI I;  4BD3 A;  3CXC A;  1QVG S;  3CCM T;  2KMR A;  2CYZ B;  4PJO D;  1TBN A;  3S3N A;  4HA8 A;  2OTL T;  1I4K 1;  4II1 A;  3TRE A;  3LLR A;  1OZ2 A;  3RKY A;  1VQ8 T;  5CVI A;  2DXB A;  3BFM A;  2DEQ A;  4E7I A;  1QVG A;  2K2V A;  5FUW A;  1KD1 C;  4C8Q B;  4XU1 A;  3M4Y A;  1LJO A;  3CCE A;  4FL6 A;  4PJO F;  3P8B B;  4MDX A;  1XQH A;  3E19 A;  3V7S A;  3OS5 A;  5GAN e;  1BYM A;  4FT4 A;  4C0Z A;  1HPT A;  1V1H A;  1RFH A;  3JRZ A;  2PVO B;  2YLC A;  3CD6 A;  2E6Z A;  1KBE A;  4C5I A;  5GMK l;  2NU3 I;  1PCE A;  2QI2 A;  3EAE A;  3CC7 A;  2K3Y A;  2P0Q A;  4E1P A;  2AHJ B;  3A8M B;  1VQ7 T;  4LDU A;  4HGU A;  2QQ9 A;  4HCC A;  2QQS A;  2A3L A;  4V2S A;  2HAX A;  4L6V 5;  1W2B S;  4C5G A;  1MHN A;  1LR9 A;  4F7U B;  1Y7X A;  2Y90 A;  1VQM A;  1Q81 C;  5DLO A;  1WQW A;  1N27 A;  4A54 A;  3PMI A;  1KMA A;  2K5F A;  5GAO n;  5HK0 A;  5CR2 A;  2DVE A;  3VU3 C;  1D3B B;  5CIU A;  3Q1J A;  1PSE A;  2VRW B;  1BUS A;  2DO3 A;  2P0P A;  2CGH A;  3PT9 A;  2LNV A;  3MET A;  2XDB A;  1M1K U;  2XID A;  1WQ7 A;  3G71 A;  1X75 C;  1IY5 A;  2L3R A;  2XIC A;  4GLK A;  2QDY B;  2DJZ A;  2ARP F;  2DXU A;  1FXX A;  3RIR A;  1UGS B;  2K3X A;  1LR8 A;  5DLQ E;  4JRP A;  4BI3 A;  4C92 D;  4NL2 A;  1U5K A;  2QNC A;  2M9U A;  3CBP A;  2QNF A;  1B34 A;  4OF1 A;  3P8D A;  3CCL T;  4XTW A;  3JB9 J;  3JCM f;  1YJ9 A;  4KUD K;  4LD9 K;  1E7L A;  1VQL A;  3L2U A;  2ZPH B;  4N0A A;  2L5Q A;  5GAO r;  3JB9 H;  4Z02 A;  3UDC A;  3EFS A;  1MT1 A;  2W0T A;  1XOV A;  3OBY A;  4GI3 C;  3CBM A;  4M7A E;  1Q86 C;  5D6Y A;  4OB2 B;  3BDU A;  2P4T A;  1CT0 I;  3QYG B;  4J6W A;  3HP9 A;  3OL0 A;  4C92 F;  2LDM A;  4Q5W A;  4YTL A;  4XTZ A;  5FU7 C;  1FYB A;  4N4G A;  1NJI U;  5I2M A;  2WAC A;  1QP2 A;  1W4S A;  3JCM b;  2KSS A;  1Q86 U;  3AHU A;  2QEX T;  4M75 D;  1QVF S;  2QQ0 A;  4E1R A;  4N0A C;  3OW2 S;  2RO0 A;  5FUY A;  1V29 B;  4BI8 B;  3ER0 A;  4M7D D;  1X74 A;  1VQ4 A;  3E59 A;  1VQ9 T;  4JDS A;  3L2V A;  2PVD B;  2CZ7 B;  3OQ5 A;  4XU0 A;  3HRU A;  3L1A A;  4C8Q A;  1K73 U;  4EMK B;  2F5T X;  1HJA I;  1PTR A;  1ZHI A;  5GAN 6;  3SFM A;  4M75 F;  2VC8 A;  4ZTF A;  1BKB A;  4B6D A;  3RER A;  3C94 A;  1H0Z A;  4PJO A;  3CCV T;  2XDP A;  1XTD A;  2PUO B;  1QVP A;  3OYN A;  4M7D F;  3KUF A;  2VXF A;  4D6W A;  5A0L A;  4M78 G;  3CD6 T;  1VUB A;  2NU1 I;  4JS5 A;  4RG8 A;  5GAO q;  5GAO p;  2LT1 A;  2GKT I;  1SGE I;  1U1T A;  2JN0 A;  5GAN f;  1YIT A;  2HQX A;  3CC7 T;  1VDD A;  1CT4 I;  4C8Q C;  2FNF X;  1O9S A;  2KVQ G;  4BB7 A;  1GXI E;  3X25 B;  3SWN B;  2D6F A;  2EQJ A;  2YHT A;  3G6E T;  4PJO C;  2LCL A;  2RD1 A;  3M54 A;  1RL2 A;  2KMP A;  2GFA A;  3QTL D;  2CS7 A;  3OYD A;  4OB0 B;  3A8H B;  1VQM T;  4M7A B;  2QQE A;  2ZPE B;  2JTM A;  4UXI A;  5D6W A;  2RJE A;  2EQU A;  5LJ5 e;  2RI3 A;  3B4V C;  5GMK e;  1Y1B A;  4IUQ A;  3QUI A;  4MML A;  1K9M C;  2J87 A;  2P0K A;  2OTJ T;  2NU4 I;  2DB6 A;  2QA4 T;  4ELY C;  1D3B A;  1M1G A;  3CCU T;  4HKE A;  1VQP A;  3M57 A;  4JCV E;  3UFF A;  5AYF A;  4ZN1 A;  2ENZ A;  5C6S A;  5GAO m;  1N8R U;  1O75 A;  5GAN 7;  1K9M U;  3OVO A;  2V8J A;  4OVA A;  4X9C A;  4ZTJ A;  3D00 A;  3MO8 A;  1YTP A;  2F5K A;  3GP8 A;  4M77 B;  3I55 T;  4EMH A;  2XU8 A;  1KC8 C;  3M56 A;  3JCM W;  2E10 A;  1KG1 A;  5EG2 A;  1JBM A;  1YJ9 T;  3QZ5 B;  1U1S A;  5D6X A;  3CMA A;  2K5I A;  1VQL T;  4L9M A;  1I8F A;  3GOX A;  3M58 A;  2DXT A;  5DY9 A;  1N13 A;  4HT9 A;  2B0U C;  3CEY A;  4R55 A;  1CGJ I;  1X01 A;  4JRQ A;  4DQ2 A;  3CCQ A;  4L5G A;  3VUZ A;  2C06 A;  2RJF A;  3JCM e;  2K9H A;  1N9R A;  1JJ2 A;  2KY9 A;  3E1S A;  3G4S A;  3PIO A;  2KMO A;  3RU0 A;  2DZC A;  2QXF A;  4JRI A;  4B9X A;  4C92 A;  1RI0 A;  1Y07 A;  1W3S A;  3N5B B;  4XU3 A;  3CC2 T;  2XD0 A;  1G3S A;  2LRQ A;  4ZN3 A;  2LEO A;  5LJ3 e;  1WJR A;  2FL7 A;  3A8G B;  3GIB A;  2M16 A;  2O01 E;  3PIP A;  2HQE A;  4FT2 A;  3X28 B;  2SGE I;  4NS5 A;  1VQ5 A;  1KHC A;  3SDZ A;  2FHD A;  2B8T A;  1TBQ R;  4XQ3 A;  2X4W A;  4RG2 A;  4EMK A;  2QQC A;  2QQA A;  1KQS S;  2DXC A;  3VJP A;  1YBY A;  4C92 C;  1ZBX A;  5CCL A;  1SGR I;  4NOY A;  2DKG A;  1CHO I;  3URG A;  2HD0 A;  3QJY A;  4M75 A;  4JS4 A;  3NTI A;  1G3Y A;  4M7D A;  4JLI A;  2YQP A;  1BI3 A;  1HK9 A;  4C8Q F;  2YRV A;  3A5Z B;  2WSC E;  3DKM A;  3JCM P;  1PSF A;  2QQD A;  1K8A C;  3FRN A;  3UGD A;  4EMK C;  1Y96 B;  2ODD A;  3M4G A;  3LH0 A;  3SWN A;  5HY6 A;  5FUX A;  3JCM V;  3M59 A;  4QVZ A;  5A2Q E;  5CCA A;  3BDL A;  4M75 C;  1XA6 A;  3QZ9 B;  1S72 A;  1VQ6 A;  4KUL A;  4BDZ A;  1K8A U;  4M7D C;  4M7A A;  2DPP B;  4E7L A;  4LDY A;  2ELI A;  3QHS A;  2WSF E;  3GLX A;  1HDL A;  3M9Q A;  3OYL A;  1G3W A;  1IY6 A;  1VIF A;  1QW1 A;  1YI2 A;  1FAR A;  1Y71 A;  1UVF A;  1HXD A;  1KBF A;  4E7H A;  3SWN C;  1U8R A;  3OYH A;  1WGS A;  1VQP T;  5LJ5 f;  1E7D A;  3TEE A;  3CCS A;  1M4Z A;  4F7U F;  3MP6 A;  4J7I A;  3LGF A;  2RJD A;  5KE2 A;  5GMK m;  4OGC A;  1PTQ A;  4M7A C;  4WF2 A;  3PTA A;  2N52 A;  5DM7 R;  1FAQ A;  3OYG A;  5GAN 2;  3SGB I;  3J81 E;  4OB3 B;  4R56 A;  3OXL A;  3CMA T;  1DJ7 B;  4C8Q G;  2EWN A;  3HKS A;  3OBW A;  1M1K C;  2PUK B;  3JB9 I;  5GAN 3;  3CPW S;  3H6Z A;  1W2B A;  5GAM e;  1EN7 A;  2RHX A;  3JCM Q;  1OMT A;  4BI4 A;  3SGQ I;  3ZEH A;  4PJO G;  3JCM c;  3OYY A;  3BJI A;  3CCQ T;  2CZ0 B;  2EQM A;  3INZ A;  2ZPF B;  4JRK A;  5EX3 A;  2LX9 A;  1VQN A;  5CAI A;  4PNO A;  2D9T A;  3CPW A;  3DB4 A;  1JRI A;  2JTF A;  4ZGD B;  4IUU A;  3FDR A;  2LUY A;  1M8V A;  4LDX A;  4EPC A;  1WJS A;  3A8O B;  4CI0 C;  3WXM B;  2GF7 A;  4SGB I;  4PL6 A;  1YU6 C;  5FUV A;  3C12 A;  1G5V A;  2JW6 A;  1NJI C;  3S3O A;  3OY9 A;  1BI1 A;  1N9S A;  1VQ5 T;  1CE3 A;  3WVD B;  1LOJ A;  3CC4 A;  2KCX A;  4A4G A;  3RMS A;  2EQK A;  5LJ3 f;  3JCM h;  3OMG A;  2V53 A;  2O4X A;  3JCM d;  2N71 A;  1UEB A;  4DOW A;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...