1LR8A

Crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue d-myo-inositol hexasulphate (ins6s)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr8A00
1Y1CA 2SGQI 1SGDI 1IY6A 2P6AC 1YTPA 2N52A 1LR7A 2NU3I 2WCYA 1TBRR 3HH2C 1MT1A 1LR9A 1TBQR 2SGFI 1HJAI 1SGQI 1PCEA 1TIHA 2SGEI 4GI3C 2B0UC 3B4VC 2ERWA 2LEOA 1M8BA 1SGPI 2NU0I 1PJUA 4HGUA 2OVOA 1TURA 1LR8A 1KMAA 1UUCA 2JYYA 2N71A 2JZMA 2M5XA 2BUSA 1Y1BA 1SGRI 2KMOA 1N13A 1TUSA 2SGDI 1HPTA 1IY5A 2KMPA 1OYVI 1DS3I 1CT2I 3SGBI 1CHOI 2N17A 2JXDA 3QTLD 2F3CI 4SGBI 2V53A 2KMRA 2GKRI 1H0ZA 1CE3A 1CGII 2QQDA 2SGPI 5DAEA 2GKTI 1OVOA 2NU4I 5JHWC 1TGSI 1PPFI 2GKVA 1CGJI 2ARPF 1CT0I 2KMQA 1SGYI 1FYBA 1CSOI 3OVOA 2NU1I 2QQCA 1YU6C 2NU2I 1BMOA 1DS2I 1OMUA 3TJQA 1CT4I 2KCXA 3SGQI 1OMTA 1AN1I 1NUBA 1BUSA 4OVOA 3SEKC 1M8CA 1UVFA 1IW4A 1HDLA 1UVGA 1R0RI 1Z7KB 1SGEI 1SGNI 2XRCA
chains in the Genus database with same CATH superfamily
1Y1CA 3OL0A 1ULNA 1W4RA 2SGQI 4L9MA 1SGDI 5EX0A 3UGLA 1IY6A 2P6AC 1YTPA 3TO7A 5HI7A 1XA6A 2N52A 3R5CA 1LR7A 2LB7A 1TOTA 2NU3I 2ENNA 2WCYA 1V1HA 1TBRR 2W0TA 3HH2C 3TOAA 4B6DA 1MT1A 3UEJA 1X74A 1LR9A 1TBQR 3VDPA 2SGFI 1HJAI 3R5DA 1SGQI 2QQ0A 3UOEA 1U5KA 1PCEA 1TIHA 1Y8FA 2SGEI 3OXLA 4GI3C 5FUVA 4DNCA 2B0UC 5E3RA 3OXFA 1MJBA 1XBTA 3B4VC 2ERWA 3MEKA 5FUYA 2LEOA 3R5AA 1M8BA 4A24A 1MJAA 3UGDA 2YUUA 1PTRA 1SGPI 2V1CC 2NU0I 1PJUA 2QPOA 4HGUA 1FARA 3RU0A 2QQEA 3VE5A 1WTJA 2UZ3A 2OVOA 1W3SA 1TURA 2A20A 4E1RA 1LR8A 2E73A 1KMAA 5E3QA 5FUWA 1UUCA 4E1PA 2CWHA 2JYYA 2ELIA 5CCMA 2N71A 2JZMA 2M5XA 2J87A 2YQPA 2OZUA 1SGNI 2BUSA 1P9ZA 1HEVA 3E59A 1Y1BA 2GIVA 1SGRI 2KMOA 2L7XA 4MPIA 5J8CA 1N13A 1WGCA 2DB6A 1TUSA 4UXIA 2SGDI 1HPTA 3TO6A 2KMPA 1IY5A 5E3PA 1OYVI 1VDDA 1ULKA 1Z2IA 4UXJA 1DS3I 2ORVA 1CT2I 3SGBI 3FSXA 2X3TA 1CHOI 3PDNA 2OD1A 1P9GA 2X52A 2E5RA 2N17A 4WP4A 9WGAA 3GOXA 2JXDA 5HQ8A 3QTLD 2F3CI 4SGBI 2V53A 2WGCA 2KMRA 1MJ9A 2GVIA 4UXHA 2GKRI 1WKXA 1X4SA 1KBEA 4FKDA 4JCVE 7WGAA 1XX6A 1CE3A 1H0ZA 1CGII 1K7UA 2QQDA 2CWGA 2V1CA 2CWFA 3D00A 2SGPI 3E2IA 2CJSC 5DAEA 2GKTI 1OVOA 2FNFX 2OU2A 2NU4I 5CCLA 5JHWC 1TGSI 1PPFI 2GKVA 3VDUA 2UVOA 3CXLA 3R5BA 1CGJI 2J9RA 1Q9BA 2ARPF 3UFFA 1CT0I 3QAHA 3FSYA 4AMLA 1NXUA 2KMQA 1SGYI 2PQ8A 3BJIA 2ENZA 3FC3A 1FYBA 1CSOI 3OVOA 2ORWA 2WVJA 2NU1I 2RIJA 2QQCA 2RC4A 2Y0MA 1TBNA 3UEYA 2ROWA 1YU6C 2NU2I 2L8EA 1BMOA 1DS2I 2DKVA 1OMUA 1UHAA 1CT4I 3TJQA 3TOBA 2KCXA 3SGQI 1OMTA 1PTQA 2LUYA 2ODDA 1AN1I 1S20A 1V1IA 2B8TA 2JW6A 3QWPA 1NUBA 5FUXA 1K7VA 1R79A 1BUSA 3KY9A 4OVOA 3SEKC 1M8CA 2K9HA 3TO9A 2N1AB 2DIPA 5EX3A 1WGTA 1KBFA 1RFHA 1FY7A 3OXGA 1FAQA 1UVFA 5J8FA 1ULMA 1IW4A 1HDLA 1K7TA 1UVGA 2JA1A 3UGIA 1R0RI 1Z7KB 2VRWB 1SGEI 1TBOA 2XRCA
chains in the Genus database with same CATH topology
1Y1CA 3OL0A 1W4RA 2SGQI 4L9MA 5EX0A 1SGDI 3UGLA 1IY6A 2P6AC 1YTPA 5HI7A 1XA6A 2N52A 1LR7A 1TOTA 2NU3I 2ENNA 2WCYA 1V1HA 1TBRR 2W0TA 3HH2C 4B6DA 1MT1A 3UEJA 1X74A 1LR9A 1TBQR 3VDPA 2SGFI 1HJAI 1SGQI 2QQ0A 1U5KA 1PCEA 1TIHA 1Y8FA 2SGEI 3OXLA 4GI3C 5FUVA 2B0UC 3OXFA 1XBTA 3B4VC 2ERWA 3MEKA 5FUYA 2LEOA 1M8BA 4A24A 3UGDA 2YUUA 1PTRA 1SGPI 2V1CC 2NU0I 1PJUA 2QPOA 4HGUA 1FARA 3RU0A 2QQEA 3VE5A 2UZ3A 2OVOA 1W3SA 1TURA 2A20A 4E1RA 1LR8A 2E73A 1KMAA 5FUWA 1UUCA 4E1PA 2JYYA 2ELIA 5CCMA 2N71A 2JZMA 2M5XA 2J87A 2YQPA 1SGNI 2BUSA 3E59A 1Y1BA 1SGRI 2KMOA 2L7XA 1N13A 4UXIA 2DB6A 1TUSA 2SGDI 1HPTA 1IY5A 2KMPA 1OYVI 1VDDA 4UXJA 1DS3I 2ORVA 1CT2I 3SGBI 1CHOI 3PDNA 2OD1A 3GOXA 2E5RA 2N17A 2JXDA 5HQ8A 3QTLD 2F3CI 4SGBI 2V53A 2KMRA 2GVIA 4UXHA 2GKRI 1X4SA 4FKDA 1KBEA 4JCVE 1XX6A 1CE3A 1H0ZA 1CGII 2QQDA 2V1CA 3D00A 2SGPI 3E2IA 2CJSC 5DAEA 2GKTI 1OVOA 2FNFX 5CCLA 2NU4I 5JHWC 1TGSI 1PPFI 2GKVA 3VDUA 3CXLA 1CGJI 2J9RA 2ARPF 3UFFA 1CT0I 2KMQA 1SGYI 3BJIA 2ENZA 3FC3A 1FYBA 1CSOI 3OVOA 2ORWA 2WVJA 2NU1I 2QQCA 3UEYA 1TBNA 2ROWA 1YU6C 2NU2I 2L8EA 1BMOA 1DS2I 1OMUA 3TJQA 1CT4I 2KCXA 3SGQI 1OMTA 1PTQA 2LUYA 2ODDA 1AN1I 2JW6A 1V1IA 2B8TA 3QWPA 1NUBA 5FUXA 1R79A 1BUSA 3KY9A 4OVOA 3SEKC 1M8CA 2K9HA 2N1AB 2DIPA 5EX3A 1KBFA 1RFHA 3OXGA 1FAQA 1UVFA 1IW4A 1HDLA 1UVGA 2JA1A 3UGIA 1R0RI 1Z7KB 2VRWB 1SGEI 1TBOA 2XRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1C A;  2SGQ I;  1SGD I;  1IY6 A;  2P6A C;  1YTP A;  2N52 A;  1LR7 A;  2NU3 I;  2WCY A;  1TBR R;  3HH2 C;  1MT1 A;  1LR9 A;  1TBQ R;  2SGF I;  1HJA I;  1SGQ I;  1PCE A;  1TIH A;  2SGE I;  4GI3 C;  2B0U C;  3B4V C;  2ERW A;  2LEO A;  1M8B A;  1SGP I;  2NU0 I;  1PJU A;  4HGU A;  2OVO A;  1TUR A;  1LR8 A;  1KMA A;  1UUC A;  2JYY A;  2N71 A;  2JZM A;  2M5X A;  2BUS A;  1Y1B A;  1SGR I;  2KMO A;  1N13 A;  1TUS A;  2SGD I;  1HPT A;  1IY5 A;  2KMP A;  1OYV I;  1DS3 I;  1CT2 I;  3SGB I;  1CHO I;  2N17 A;  2JXD A;  3QTL D;  2F3C I;  4SGB I;  2V53 A;  2KMR A;  2GKR I;  1H0Z A;  1CE3 A;  1CGI I;  2QQD A;  2SGP I;  5DAE A;  2GKT I;  1OVO A;  2NU4 I;  5JHW C;  1TGS I;  1PPF I;  2GKV A;  1CGJ I;  2ARP F;  1CT0 I;  2KMQ A;  1SGY I;  1FYB A;  1CSO I;  3OVO A;  2NU1 I;  2QQC A;  1YU6 C;  2NU2 I;  1BMO A;  1DS2 I;  1OMU A;  3TJQ A;  1CT4 I;  2KCX A;  3SGQ I;  1OMT A;  1AN1 I;  1NUB A;  1BUS A;  4OVO A;  3SEK C;  1M8C A;  1UVF A;  1IW4 A;  1HDL A;  1UVG A;  1R0R I;  1Z7K B;  1SGE I;  1SGN I;  2XRC A; 
#chains in the Genus database with same CATH topology
 1Y1C A;  3OL0 A;  1ULN A;  1W4R A;  2SGQ I;  4L9M A;  1SGD I;  5EX0 A;  3UGL A;  1IY6 A;  2P6A C;  1YTP A;  3TO7 A;  5HI7 A;  1XA6 A;  2N52 A;  3R5C A;  1LR7 A;  2LB7 A;  1TOT A;  2NU3 I;  2ENN A;  2WCY A;  1V1H A;  1TBR R;  2W0T A;  3HH2 C;  3TOA A;  4B6D A;  1MT1 A;  3UEJ A;  1X74 A;  1LR9 A;  1TBQ R;  3VDP A;  2SGF I;  1HJA I;  3R5D A;  1SGQ I;  2QQ0 A;  3UOE A;  1U5K A;  1PCE A;  1TIH A;  1Y8F A;  2SGE I;  3OXL A;  4GI3 C;  5FUV A;  4DNC A;  2B0U C;  5E3R A;  3OXF A;  1MJB A;  1XBT A;  3B4V C;  2ERW A;  3MEK A;  5FUY A;  2LEO A;  3R5A A;  1M8B A;  4A24 A;  1MJA A;  3UGD A;  2YUU A;  1PTR A;  1SGP I;  2V1C C;  2NU0 I;  1PJU A;  2QPO A;  4HGU A;  1FAR A;  3RU0 A;  2QQE A;  3VE5 A;  1WTJ A;  2UZ3 A;  2OVO A;  1W3S A;  1TUR A;  2A20 A;  4E1R A;  1LR8 A;  2E73 A;  1KMA A;  5E3Q A;  5FUW A;  1UUC A;  4E1P A;  2CWH A;  2JYY A;  2ELI A;  5CCM A;  2N71 A;  2JZM A;  2M5X A;  2J87 A;  2YQP A;  2OZU A;  1SGN I;  2BUS A;  1P9Z A;  1HEV A;  3E59 A;  1Y1B A;  2GIV A;  1SGR I;  2KMO A;  2L7X A;  4MPI A;  5J8C A;  1N13 A;  1WGC A;  2DB6 A;  1TUS A;  4UXI A;  2SGD I;  1HPT A;  3TO6 A;  2KMP A;  1IY5 A;  5E3P A;  1OYV I;  1VDD A;  1ULK A;  1Z2I A;  4UXJ A;  1DS3 I;  2ORV A;  1CT2 I;  3SGB I;  3FSX A;  2X3T A;  1CHO I;  3PDN A;  2OD1 A;  1P9G A;  2X52 A;  2E5R A;  2N17 A;  4WP4 A;  9WGA A;  3GOX A;  2JXD A;  5HQ8 A;  3QTL D;  2F3C I;  4SGB I;  2V53 A;  2WGC A;  2KMR A;  1MJ9 A;  2GVI A;  4UXH A;  2GKR I;  1WKX A;  1X4S A;  1KBE A;  4FKD A;  4JCV E;  7WGA A;  1XX6 A;  1CE3 A;  1H0Z A;  1CGI I;  1K7U A;  2QQD A;  2CWG A;  2V1C A;  2CWF A;  3D00 A;  2SGP I;  3E2I A;  2CJS C;  5DAE A;  2GKT I;  1OVO A;  2FNF X;  2OU2 A;  2NU4 I;  5CCL A;  5JHW C;  1TGS I;  1PPF I;  2GKV A;  3VDU A;  2UVO A;  3CXL A;  3R5B A;  1CGJ I;  2J9R A;  1Q9B A;  2ARP F;  3UFF A;  1CT0 I;  3QAH A;  3FSY A;  4AML A;  1NXU A;  2KMQ A;  1SGY I;  2PQ8 A;  3BJI A;  2ENZ A;  3FC3 A;  1FYB A;  1CSO I;  3OVO A;  2ORW A;  2WVJ A;  2NU1 I;  2RIJ A;  2QQC A;  2RC4 A;  2Y0M A;  1TBN A;  3UEY A;  2ROW A;  1YU6 C;  2NU2 I;  2L8E A;  1BMO A;  1DS2 I;  2DKV A;  1OMU A;  1UHA A;  1CT4 I;  3TJQ A;  3TOB A;  2KCX A;  3SGQ I;  1OMT A;  1PTQ A;  2LUY A;  2ODD A;  1AN1 I;  1S20 A;  1V1I A;  2B8T A;  2JW6 A;  3QWP A;  1NUB A;  5FUX A;  1K7V A;  1R79 A;  1BUS A;  3KY9 A;  4OVO A;  3SEK C;  1M8C A;  2K9H A;  3TO9 A;  2N1A B;  2DIP A;  5EX3 A;  1WGT A;  1KBF A;  1RFH A;  1FY7 A;  3OXG A;  1FAQ A;  1UVF A;  5J8F A;  1ULM A;  1IW4 A;  1HDL A;  1K7T A;  1UVG A;  2JA1 A;  3UGI A;  1R0R I;  1Z7K B;  2VRW B;  1SGE I;  1TBO A;  2XRC A; 
#chains in the Genus database with same CATH homology
 1Y1C A;  3OL0 A;  1W4R A;  2SGQ I;  4L9M A;  5EX0 A;  1SGD I;  3UGL A;  1IY6 A;  2P6A C;  1YTP A;  5HI7 A;  1XA6 A;  2N52 A;  1LR7 A;  1TOT A;  2NU3 I;  2ENN A;  2WCY A;  1V1H A;  1TBR R;  2W0T A;  3HH2 C;  4B6D A;  1MT1 A;  3UEJ A;  1X74 A;  1LR9 A;  1TBQ R;  3VDP A;  2SGF I;  1HJA I;  1SGQ I;  2QQ0 A;  1U5K A;  1PCE A;  1TIH A;  1Y8F A;  2SGE I;  3OXL A;  4GI3 C;  5FUV A;  2B0U C;  3OXF A;  1XBT A;  3B4V C;  2ERW A;  3MEK A;  5FUY A;  2LEO A;  1M8B A;  4A24 A;  3UGD A;  2YUU A;  1PTR A;  1SGP I;  2V1C C;  2NU0 I;  1PJU A;  2QPO A;  4HGU A;  1FAR A;  3RU0 A;  2QQE A;  3VE5 A;  2UZ3 A;  2OVO A;  1W3S A;  1TUR A;  2A20 A;  4E1R A;  1LR8 A;  2E73 A;  1KMA A;  5FUW A;  1UUC A;  4E1P A;  2JYY A;  2ELI A;  5CCM A;  2N71 A;  2JZM A;  2M5X A;  2J87 A;  2YQP A;  1SGN I;  2BUS A;  3E59 A;  1Y1B A;  1SGR I;  2KMO A;  2L7X A;  1N13 A;  4UXI A;  2DB6 A;  1TUS A;  2SGD I;  1HPT A;  1IY5 A;  2KMP A;  1OYV I;  1VDD A;  4UXJ A;  1DS3 I;  2ORV A;  1CT2 I;  3SGB I;  1CHO I;  3PDN A;  2OD1 A;  3GOX A;  2E5R A;  2N17 A;  2JXD A;  5HQ8 A;  3QTL D;  2F3C I;  4SGB I;  2V53 A;  2KMR A;  2GVI A;  4UXH A;  2GKR I;  1X4S A;  4FKD A;  1KBE A;  4JCV E;  1XX6 A;  1CE3 A;  1H0Z A;  1CGI I;  2QQD A;  2V1C A;  3D00 A;  2SGP I;  3E2I A;  2CJS C;  5DAE A;  2GKT I;  1OVO A;  2FNF X;  5CCL A;  2NU4 I;  5JHW C;  1TGS I;  1PPF I;  2GKV A;  3VDU A;  3CXL A;  1CGJ I;  2J9R A;  2ARP F;  3UFF A;  1CT0 I;  2KMQ A;  1SGY I;  3BJI A;  2ENZ A;  3FC3 A;  1FYB A;  1CSO I;  3OVO A;  2ORW A;  2WVJ A;  2NU1 I;  2QQC A;  3UEY A;  1TBN A;  2ROW A;  1YU6 C;  2NU2 I;  2L8E A;  1BMO A;  1DS2 I;  1OMU A;  3TJQ A;  1CT4 I;  2KCX A;  3SGQ I;  1OMT A;  1PTQ A;  2LUY A;  2ODD A;  1AN1 I;  2JW6 A;  1V1I A;  2B8T A;  3QWP A;  1NUB A;  5FUX A;  1R79 A;  1BUS A;  3KY9 A;  4OVO A;  3SEK C;  1M8C A;  2K9H A;  2N1A B;  2DIP A;  5EX3 A;  1KBF A;  1RFH A;  3OXG A;  1FAQ A;  1UVF A;  1IW4 A;  1HDL A;  1UVG A;  2JA1 A;  3UGI A;  1R0R I;  1Z7K B;  2VRW B;  1SGE I;  1TBO A;  2XRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...