1CGJI

Three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
DSLGREAKCYNELNGCTLEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CHYMOTRYPSINOGEN
publication title Three-dimensional structure of the complexes between bovine chymotrypsinogen A and two recombinant variants of human pancreatic secretory trypsin inhibitor (Kazal-type).
pubmed doi rcsb
source organism Bos taurus
molecule tags Serine protease/inhibitor complex
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1cgjI00
1SGNI 3QTLD 2BUSA 1LR8A 2LEOA 2B0UC 2QQDA 4GI3C 2NU1I 1AN1I 1N13A 2JZMA 1OMUA 1CSOI 1IW4A 1NUBA 3OVOA 1PPFI 1H0ZA 1IY5A 1UVFA 1DS3I 1UUCA 1HDLA 1TBQR 1IY6A 1TBRR 2SGPI 2N71A 1MT1A 1SGRI 1PJUA 2SGDI 2JXDA 1SGPI 2SGEI 3SEKC 3B4VC 1DS2I 1TGSI 3TJQA 1TUSA 5JHWC 1HJAI 1CT2I 2GKTI 4OVOA 2KMOA 2M5XA 2ARPF 1SGQI 2JYYA 1LR9A 1SGEI 2SGFI 2SGQI 2NU4I 1CT4I 3SGBI 1M8CA 1KMAA 1TURA 2WCYA 1CE3A 1UVGA 2N52A 1PCEA 2KMRA 2ERWA 1TIHA 1R0RI 1CGII 2OVOA 2F3CI 3HH2C 1FYBA 2P6AC 1CGJI 1SGDI 2KCXA 1BMOA 3SGQI 1LR7A 1BUSA 1OYVI 2V53A 1Y1BA 2KMPA 2GKRI 2GKVA 1OVOA 4SGBI 1HPTA 2QQCA 1Y1CA 2KMQA 1M8BA 1YU6C 2NU0I 1CT0I 1OMTA 5DAEA 1SGYI 1YTPA 2NU3I 4HGUA 1Z7KB 1CHOI 2N17A 2NU2I 2XRCA
chains in the Genus database with same CATH superfamily
1SGNI 3RU0A 2DB6A 3FSYA 3QTLD 3UEJA 2BUSA 5HI7A 2GVIA 3R5DA 1LR8A 2LEOA 1MJBA 3R5CA 2B0UC 2QQDA 1WGCA 2X3TA 4GI3C 2LB7A 3TO9A 2NU1I 1AN1I 2A20A 1N13A 2JZMA 1K7VA 1W4RA 3UOEA 2FNFX 3VDPA 4B6DA 5HQ8A 1OMUA 1CSOI 1IW4A 5EX0A 1NUBA 5EX3A 4A24A 3OVOA 2OU2A 1PPFI 1X4SA 3E2IA 1H0ZA 1IY5A 1HEVA 3R5AA 1UVFA 1DS3I 3MEKA 5E3PA 1FARA 1UUCA 1V1HA 3FSXA 1ULNA 2V1CA 1HDLA 2J9RA 1TBQR 2V1CC 3GOXA 1IY6A 1TBRR 3FC3A 2SGPI 4E1RA 1KBFA 2ODDA 2N71A 1WGTA 4UXJA 1FAQA 1X74A 3TO7A 4DNCA 3CXLA 1FY7A 3OXGA 1MT1A 4MPIA 1SGRI 1PJUA 2OZUA 2QPOA 2SGDI 2JXDA 1Q9BA 1SGPI 2L8EA 2E73A 1S20A 5FUVA 2J87A 2SGEI 5FUYA 3SEKC 3B4VC 1DS2I 5E3QA 1TGSI 1PTRA 2ENNA 1P9GA 4L9MA 3TJQA 2JW6A 3UFFA 1TUSA 5JHWC 1TOTA 3KY9A 1HJAI 1W3SA 1KBEA 3R5BA 2UZ3A 1P9ZA 2LUYA 1CT2I 2GKTI 2ORVA 3OXFA 2KMOA 2YUUA 3QAHA 1K7UA 4OVOA 2M5XA 1Y8FA 1Z2IA 2ARPF 1R79A 1SGQI 5J8CA 2JYYA 5FUXA 2L7XA 1LR9A 1TBNA 3UGIA 2X52A 1SGEI 2SGFI 1ULMA 2SGQI 2NU4I 1MJAA 3TOBA 5J8FA 1CT4I 3SGBI 1M8CA 1KMAA 1TURA 2WCYA 1CE3A 1UVGA 1WKXA 2N52A 3E59A 1PCEA 2KMRA 2RC4A 2ERWA 2Y0MA 1TIHA 2B8TA 2CWGA 1TBOA 1R0RI 1CGII 1VDDA 7WGAA 2OVOA 2F3CI 5E3RA 3VE5A 2VRWB 3HH2C 1RFHA 2CWFA 2UVOA 2GIVA 2JA1A 3PDNA 1FYBA 2E5RA 2P6AC 1CGJI 1WTJA 1XBTA 5CCLA 1SGDI 2KCXA 1BMOA 2ELIA 2RIJA 2QQEA 3UGDA 9WGAA 1UHAA 2OD1A 3SGQI 1LR7A 2QQ0A 3TOAA 3TO6A 4FKDA 1XX6A 1OYVI 2ROWA 4UXIA 2WGCA 1BUSA 2V53A 1Y1BA 2YQPA 2KMPA 3OXLA 2GKRI 2GKVA 2W0TA 4UXHA 1OVOA 4SGBI 3VDUA 1HPTA 3BJIA 2QQCA 3D00A 2K9HA 1Y1CA 2KMQA 1ULKA 2ENZA 2DKVA 3OL0A 5CCMA 1M8BA 1YU6C 2N1AB 3UGLA 1NXUA 5FUWA 4AMLA 2WVJA 1PTQA 3QWPA 2NU0I 1MJ9A 1CT0I 4JCVE 1OMTA 1K7TA 2CWHA 2ORWA 5DAEA 1SGYI 1YTPA 2CJSC 2NU3I 1Z7KB 2PQ8A 4HGUA 4WP4A 1CHOI 1U5KA 2N17A 2NU2I 1V1IA 2XRCA 3UEYA 2DIPA 1XA6A 4E1PA
chains in the Genus database with same CATH topology
1SGNI 3RU0A 2DB6A 3QTLD 3UEJA 2BUSA 5HI7A 2GVIA 1LR8A 2LEOA 4A24A 2B0UC 2QQDA 4GI3C 2NU1I 1AN1I 2A20A 1N13A 2JZMA 1W4RA 2FNFX 3VDPA 4B6DA 5HQ8A 1OMUA 1CSOI 1IW4A 5EX0A 1NUBA 5EX3A 3OVOA 1PPFI 1X4SA 3E2IA 1H0ZA 1IY5A 1UVFA 1DS3I 3MEKA 1FARA 1UUCA 1V1HA 2V1CA 1HDLA 2J9RA 1TBQR 2V1CC 3GOXA 1IY6A 1TBRR 3FC3A 2SGPI 4E1RA 1KBFA 2ODDA 2N71A 4UXJA 1FAQA 1X74A 3CXLA 3OXGA 1MT1A 1SGRI 1PJUA 2SGDI 2QPOA 2JXDA 1SGPI 2L8EA 2E73A 5FUVA 2J87A 2SGEI 5FUYA 3SEKC 3B4VC 1DS2I 1TGSI 1PTRA 2ENNA 4L9MA 3TJQA 2JW6A 3UFFA 1TUSA 5JHWC 1TOTA 3KY9A 1HJAI 1W3SA 1KBEA 2UZ3A 2LUYA 1CT2I 2GKTI 2ORVA 3OXFA 2KMOA 2YUUA 4OVOA 2M5XA 1Y8FA 2ARPF 1R79A 1SGQI 2JYYA 5FUXA 2L7XA 1LR9A 1TBNA 3UGIA 1SGEI 2SGFI 2SGQI 2NU4I 1CT4I 3SGBI 1M8CA 1KMAA 1TURA 2WCYA 1CE3A 1UVGA 2N52A 3E59A 1PCEA 2KMRA 2ERWA 1TIHA 2B8TA 1TBOA 1R0RI 1CGII 1VDDA 2OVOA 2F3CI 3VE5A 2VRWB 3HH2C 1RFHA 2JA1A 3PDNA 1FYBA 2E5RA 2P6AC 1CGJI 5CCLA 1XBTA 1SGDI 2KCXA 1BMOA 2ELIA 2QQEA 3UGDA 2OD1A 3SGQI 1LR7A 2QQ0A 4FKDA 1XX6A 1OYVI 2ROWA 4UXIA 1BUSA 2V53A 1Y1BA 2YQPA 2KMPA 3OXLA 2GKRI 2GKVA 2W0TA 4UXHA 1OVOA 4SGBI 3VDUA 1HPTA 3BJIA 2QQCA 3D00A 2K9HA 1Y1CA 2KMQA 2ENZA 3OL0A 5CCMA 1M8BA 1YU6C 2N1AB 3UGLA 5FUWA 2WVJA 1PTQA 3QWPA 2NU0I 1CT0I 4JCVE 1OMTA 2ORWA 5DAEA 1SGYI 1YTPA 2CJSC 2NU3I 1Z7KB 4HGUA 1CHOI 1U5KA 2N17A 2NU2I 1V1IA 2XRCA 3UEYA 2DIPA 1XA6A 4E1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGN I;  3QTL D;  2BUS A;  1LR8 A;  2LEO A;  2B0U C;  2QQD A;  4GI3 C;  2NU1 I;  1AN1 I;  1N13 A;  2JZM A;  1OMU A;  1CSO I;  1IW4 A;  1NUB A;  3OVO A;  1PPF I;  1H0Z A;  1IY5 A;  1UVF A;  1DS3 I;  1UUC A;  1HDL A;  1TBQ R;  1IY6 A;  1TBR R;  2SGP I;  2N71 A;  1MT1 A;  1SGR I;  1PJU A;  2SGD I;  2JXD A;  1SGP I;  2SGE I;  3SEK C;  3B4V C;  1DS2 I;  1TGS I;  3TJQ A;  1TUS A;  5JHW C;  1HJA I;  1CT2 I;  2GKT I;  4OVO A;  2KMO A;  2M5X A;  2ARP F;  1SGQ I;  2JYY A;  1LR9 A;  1SGE I;  2SGF I;  2SGQ I;  2NU4 I;  1CT4 I;  3SGB I;  1M8C A;  1KMA A;  1TUR A;  2WCY A;  1CE3 A;  1UVG A;  2N52 A;  1PCE A;  2KMR A;  2ERW A;  1TIH A;  1R0R I;  1CGI I;  2OVO A;  2F3C I;  3HH2 C;  1FYB A;  2P6A C;  1CGJ I;  1SGD I;  2KCX A;  1BMO A;  3SGQ I;  1LR7 A;  1BUS A;  1OYV I;  2V53 A;  1Y1B A;  2KMP A;  2GKR I;  2GKV A;  1OVO A;  4SGB I;  1HPT A;  2QQC A;  1Y1C A;  2KMQ A;  1M8B A;  1YU6 C;  2NU0 I;  1CT0 I;  1OMT A;  5DAE A;  1SGY I;  1YTP A;  2NU3 I;  4HGU A;  1Z7K B;  1CHO I;  2N17 A;  2NU2 I;  2XRC A; 
#chains in the Genus database with same CATH topology
 1SGN I;  3RU0 A;  2DB6 A;  3FSY A;  3QTL D;  3UEJ A;  2BUS A;  5HI7 A;  2GVI A;  3R5D A;  1LR8 A;  2LEO A;  1MJB A;  3R5C A;  2B0U C;  2QQD A;  1WGC A;  2X3T A;  4GI3 C;  2LB7 A;  3TO9 A;  2NU1 I;  1AN1 I;  2A20 A;  1N13 A;  2JZM A;  1K7V A;  1W4R A;  3UOE A;  2FNF X;  3VDP A;  4B6D A;  5HQ8 A;  1OMU A;  1CSO I;  1IW4 A;  5EX0 A;  1NUB A;  5EX3 A;  4A24 A;  3OVO A;  2OU2 A;  1PPF I;  1X4S A;  3E2I A;  1H0Z A;  1IY5 A;  1HEV A;  3R5A A;  1UVF A;  1DS3 I;  3MEK A;  5E3P A;  1FAR A;  1UUC A;  1V1H A;  3FSX A;  1ULN A;  2V1C A;  1HDL A;  2J9R A;  1TBQ R;  2V1C C;  3GOX A;  1IY6 A;  1TBR R;  3FC3 A;  2SGP I;  4E1R A;  1KBF A;  2ODD A;  2N71 A;  1WGT A;  4UXJ A;  1FAQ A;  1X74 A;  3TO7 A;  4DNC A;  3CXL A;  1FY7 A;  3OXG A;  1MT1 A;  4MPI A;  1SGR I;  1PJU A;  2OZU A;  2QPO A;  2SGD I;  2JXD A;  1Q9B A;  1SGP I;  2L8E A;  2E73 A;  1S20 A;  5FUV A;  2J87 A;  2SGE I;  5FUY A;  3SEK C;  3B4V C;  1DS2 I;  5E3Q A;  1TGS I;  1PTR A;  2ENN A;  1P9G A;  4L9M A;  3TJQ A;  2JW6 A;  3UFF A;  1TUS A;  5JHW C;  1TOT A;  3KY9 A;  1HJA I;  1W3S A;  1KBE A;  3R5B A;  2UZ3 A;  1P9Z A;  2LUY A;  1CT2 I;  2GKT I;  2ORV A;  3OXF A;  2KMO A;  2YUU A;  3QAH A;  1K7U A;  4OVO A;  2M5X A;  1Y8F A;  1Z2I A;  2ARP F;  1R79 A;  1SGQ I;  5J8C A;  2JYY A;  5FUX A;  2L7X A;  1LR9 A;  1TBN A;  3UGI A;  2X52 A;  1SGE I;  2SGF I;  1ULM A;  2SGQ I;  2NU4 I;  1MJA A;  3TOB A;  5J8F A;  1CT4 I;  3SGB I;  1M8C A;  1KMA A;  1TUR A;  2WCY A;  1CE3 A;  1UVG A;  1WKX A;  2N52 A;  3E59 A;  1PCE A;  2KMR A;  2RC4 A;  2ERW A;  2Y0M A;  1TIH A;  2B8T A;  2CWG A;  1TBO A;  1R0R I;  1CGI I;  1VDD A;  7WGA A;  2OVO A;  2F3C I;  5E3R A;  3VE5 A;  2VRW B;  3HH2 C;  1RFH A;  2CWF A;  2UVO A;  2GIV A;  2JA1 A;  3PDN A;  1FYB A;  2E5R A;  2P6A C;  1CGJ I;  1WTJ A;  1XBT A;  5CCL A;  1SGD I;  2KCX A;  1BMO A;  2ELI A;  2RIJ A;  2QQE A;  3UGD A;  9WGA A;  1UHA A;  2OD1 A;  3SGQ I;  1LR7 A;  2QQ0 A;  3TOA A;  3TO6 A;  4FKD A;  1XX6 A;  1OYV I;  2ROW A;  4UXI A;  2WGC A;  1BUS A;  2V53 A;  1Y1B A;  2YQP A;  2KMP A;  3OXL A;  2GKR I;  2GKV A;  2W0T A;  4UXH A;  1OVO A;  4SGB I;  3VDU A;  1HPT A;  3BJI A;  2QQC A;  3D00 A;  2K9H A;  1Y1C A;  2KMQ A;  1ULK A;  2ENZ A;  2DKV A;  3OL0 A;  5CCM A;  1M8B A;  1YU6 C;  2N1A B;  3UGL A;  1NXU A;  5FUW A;  4AML A;  2WVJ A;  1PTQ A;  3QWP A;  2NU0 I;  1MJ9 A;  1CT0 I;  4JCV E;  1OMT A;  1K7T A;  2CWH A;  2ORW A;  5DAE A;  1SGY I;  1YTP A;  2CJS C;  2NU3 I;  1Z7K B;  2PQ8 A;  4HGU A;  4WP4 A;  1CHO I;  1U5K A;  2N17 A;  2NU2 I;  1V1I A;  2XRC A;  3UEY A;  2DIP A;  1XA6 A;  4E1P A; 
#chains in the Genus database with same CATH homology
 1SGN I;  3RU0 A;  2DB6 A;  3QTL D;  3UEJ A;  2BUS A;  5HI7 A;  2GVI A;  1LR8 A;  2LEO A;  4A24 A;  2B0U C;  2QQD A;  4GI3 C;  2NU1 I;  1AN1 I;  2A20 A;  1N13 A;  2JZM A;  1W4R A;  2FNF X;  3VDP A;  4B6D A;  5HQ8 A;  1OMU A;  1CSO I;  1IW4 A;  5EX0 A;  1NUB A;  5EX3 A;  3OVO A;  1PPF I;  1X4S A;  3E2I A;  1H0Z A;  1IY5 A;  1UVF A;  1DS3 I;  3MEK A;  1FAR A;  1UUC A;  1V1H A;  2V1C A;  1HDL A;  2J9R A;  1TBQ R;  2V1C C;  3GOX A;  1IY6 A;  1TBR R;  3FC3 A;  2SGP I;  4E1R A;  1KBF A;  2ODD A;  2N71 A;  4UXJ A;  1FAQ A;  1X74 A;  3CXL A;  3OXG A;  1MT1 A;  1SGR I;  1PJU A;  2SGD I;  2QPO A;  2JXD A;  1SGP I;  2L8E A;  2E73 A;  5FUV A;  2J87 A;  2SGE I;  5FUY A;  3SEK C;  3B4V C;  1DS2 I;  1TGS I;  1PTR A;  2ENN A;  4L9M A;  3TJQ A;  2JW6 A;  3UFF A;  1TUS A;  5JHW C;  1TOT A;  3KY9 A;  1HJA I;  1W3S A;  1KBE A;  2UZ3 A;  2LUY A;  1CT2 I;  2GKT I;  2ORV A;  3OXF A;  2KMO A;  2YUU A;  4OVO A;  2M5X A;  1Y8F A;  2ARP F;  1R79 A;  1SGQ I;  2JYY A;  5FUX A;  2L7X A;  1LR9 A;  1TBN A;  3UGI A;  1SGE I;  2SGF I;  2SGQ I;  2NU4 I;  1CT4 I;  3SGB I;  1M8C A;  1KMA A;  1TUR A;  2WCY A;  1CE3 A;  1UVG A;  2N52 A;  3E59 A;  1PCE A;  2KMR A;  2ERW A;  1TIH A;  2B8T A;  1TBO A;  1R0R I;  1CGI I;  1VDD A;  2OVO A;  2F3C I;  3VE5 A;  2VRW B;  3HH2 C;  1RFH A;  2JA1 A;  3PDN A;  1FYB A;  2E5R A;  2P6A C;  1CGJ I;  5CCL A;  1XBT A;  1SGD I;  2KCX A;  1BMO A;  2ELI A;  2QQE A;  3UGD A;  2OD1 A;  3SGQ I;  1LR7 A;  2QQ0 A;  4FKD A;  1XX6 A;  1OYV I;  2ROW A;  4UXI A;  1BUS A;  2V53 A;  1Y1B A;  2YQP A;  2KMP A;  3OXL A;  2GKR I;  2GKV A;  2W0T A;  4UXH A;  1OVO A;  4SGB I;  3VDU A;  1HPT A;  3BJI A;  2QQC A;  3D00 A;  2K9H A;  1Y1C A;  2KMQ A;  2ENZ A;  3OL0 A;  5CCM A;  1M8B A;  1YU6 C;  2N1A B;  3UGL A;  5FUW A;  2WVJ A;  1PTQ A;  3QWP A;  2NU0 I;  1CT0 I;  4JCV E;  1OMT A;  2ORW A;  5DAE A;  1SGY I;  1YTP A;  2CJS C;  2NU3 I;  1Z7K B;  4HGU A;  1CHO I;  1U5K A;  2N17 A;  2NU2 I;  1V1I A;  2XRC A;  3UEY A;  2DIP A;  1XA6 A;  4E1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...