1CGJI

Three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
DSLGREAKCYNELNGCTLEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complexes between bovine chymotrypsinogen A and two recombinant variants of human pancreatic secretory trypsin inhibitor (Kazal-type).
pubmed doi rcsb
molecule keywords ALPHA-CHYMOTRYPSINOGEN
molecule tags Serine protease/inhibitor complex
source organism Bos taurus
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1cgjI00
1CGII 1CSOI 2WCYA 1YU6C 5JHWC 1PJUA 1R0RI 2NU2I 2NU0I 1KMAA 4SGBI 2BUSA 1SGQI 1M8CA 1DS3I 4HGUA 1SGPI 2KMQA 2M5XA 3SEKC 2JYYA 2P6AC 1CHOI 3OVOA 2NU1I 1N13A 3HH2C 2GKTI 1LR8A 1TGSI 2KMPA 1SGEI 1OMUA 1Y1CA 2KMOA 2QQCA 1PPFI 1LR7A 1SGNI 2SGFI 1CT0I 1IW4A 1OMTA 1TUSA 2V53A 2N71A 2ERWA 1BMOA 2OVOA 1TBQR 1TBRR 1YTPA 3SGQI 1LR9A 1Y1BA 1BUSA 3QTLD 1CT4I 2JXDA 1H0ZA 1CT2I 2XRCA 1NUBA 1SGYI 1TIHA 2GKRI 2F3CI 2SGEI 1AN1I 2ARPF 2B0UC 2N52A 1UUCA 1HJAI 1SGRI 2SGQI 1TURA 1CE3A 2LEOA 1FYBA 2NU3I 2JZMA 1OVOA 2KCXA 4GI3C 1UVGA 1HPTA 1SGDI 2KMRA 2NU4I 1DS2I 3TJQA 3SGBI 1Z7KB 2SGDI 3B4VC 1HDLA 1IY5A 1MT1A 2GKVA 2N17A 1OYVI 2QQDA 2SGPI 1IY6A 5DAEA 1PCEA 4OVOA 1M8BA 1UVFA 1CGJI
chains in the Genus database with same CATH superfamily
3BJIA 1CGII 3UFFA 1XA6A 5E3RA 1CSOI 2N1AB 1ULNA 2WCYA 2DKVA 2ODDA 3OXGA 5FUYA 1YU6C 1W3SA 3TOBA 5JHWC 1MJ9A 1UHAA 1TBNA 4UXHA 2PQ8A 1PJUA 1FAQA 1R0RI 2NU2I 2NU0I 2ENNA 1KMAA 2ENZA 4SGBI 2BUSA 1WTJA 1SGQI 2FNFX 4E1PA 1M8CA 1DS3I 2L7XA 3MEKA 3D00A 5E3PA 1Q9BA 4E1RA 2E73A 2QPOA 4HGUA 2LB7A 3OXLA 5EX3A 1SGPI 1VDDA 2KMQA 2JW6A 1K7VA 2B8TA 2M5XA 1ULKA 5HI7A 2DIPA 3PDNA 3SEKC 2JYYA 3TOAA 3TO7A 2P6AC 1PTRA 1MJAA 1CHOI 4UXIA 2E5RA 3OVOA 3R5DA 2NU1I 1WGTA 1N13A 3HH2C 2GKTI 1LR8A 4B6DA 1KBEA 1TGSI 2KMPA 1SGEI 1V1HA 1OMUA 1Y1CA 2KMOA 2QQCA 3CXLA 3UGDA 1PPFI 5E3QA 4L9MA 1X74A 1LR7A 1W4RA 2CJSC 1RFHA 1Z2IA 5J8CA 1XBTA 1SGNI 2SGFI 7WGAA 1Y8FA 1CT0I 2QQEA 3RU0A 1OMTA 1TUSA 2V53A 1IW4A 1KBFA 3FC3A 1K7TA 2N71A 2RIJA 2V1CA 3UGIA 2ERWA 5FUWA 1BMOA 2OVOA 3UOEA 3VE5A 3R5BA 1TBQR 1V1IA 2GVIA 1S20A 1TBRR 3E59A 1YTPA 3SGQI 3E2IA 1TBOA 1HEVA 1LR9A 3QWPA 5FUVA 2OZUA 4DNCA 2ORVA 3FSXA 1Y1BA 4MPIA 2K9HA 1BUSA 2RC4A 3QTLD 1CT4I 2JXDA 1H0ZA 1CT2I 1FARA 1NXUA 2CWHA 2XRCA 2QQ0A 1NUBA 1SGYI 1TIHA 2F3CI 2GKRI 2SGEI 3UEJA 5CCLA 3VDUA 2WVJA 3KY9A 3GOXA 1AN1I 2ARPF 1P9ZA 2B0UC 4A24A 2N52A 2YQPA 1UUCA 2J87A 1HJAI 2J9RA 2VRWB 4WP4A 1X4SA 1SGRI 1R79A 2YUUA 3TO6A 2SGQI 1TURA 1MJBA 1ULMA 1CE3A 5CCMA 2DB6A 2LEOA 1FYBA 3R5AA 1FY7A 1WKXA 5EX0A 2NU3I 2JZMA 1OVOA 2A20A 2KCXA 2X52A 4GI3C 3OL0A 1UVGA 1HPTA 2JA1A 4UXJA 2ROWA 1XX6A 1SGDI 2Y0MA 3R5CA 1WGCA 2KMRA 3UEYA 1TOTA 2NU4I 1DS2I 3FSYA 2UVOA 1PTQA 3TJQA 2CWFA 1U5KA 2L8EA 3SGBI 1Z7KB 2SGDI 4AMLA 3B4VC 3TO9A 1K7UA 3UGLA 1HDLA 4JCVE 3VDPA 2ORWA 1IY5A 2WGCA 1MT1A 5HQ8A 5J8FA 2LUYA 3OXFA 2GKVA 4FKDA 1P9GA 2GIVA 2ELIA 1OYVI 2N17A 2W0TA 2X3TA 2OD1A 2QQDA 3QAHA 2OU2A 2CWGA 2SGPI 5DAEA 2V1CC 9WGAA 5FUXA 1IY6A 1PCEA 4OVOA 2UZ3A 1M8BA 1UVFA 1CGJI
chains in the Genus database with same CATH topology
3BJIA 1CGII 3UFFA 1XA6A 1CSOI 2N1AB 2WCYA 2ODDA 3OXGA 5FUYA 1YU6C 1W3SA 5JHWC 1TBNA 4UXHA 1PJUA 1FAQA 1R0RI 2NU2I 2NU0I 2ENNA 1KMAA 2ENZA 4SGBI 2BUSA 1SGQI 2FNFX 4E1PA 1M8CA 1DS3I 2L7XA 3MEKA 3D00A 4E1RA 2E73A 2QPOA 4HGUA 3OXLA 5EX3A 1SGPI 1VDDA 2KMQA 2JW6A 2B8TA 2M5XA 5HI7A 3SEKC 3VDUA 2DIPA 3PDNA 2JYYA 2P6AC 1PTRA 4UXIA 1CHOI 2E5RA 3OVOA 2NU1I 1N13A 3HH2C 2GKTI 1LR8A 4B6DA 1KBEA 1TGSI 2KMPA 1SGEI 1V1HA 1OMUA 1Y1CA 2KMOA 2QQCA 3CXLA 3UGDA 1PPFI 4L9MA 1X74A 1LR7A 1W4RA 2CJSC 1RFHA 1XBTA 1SGNI 2SGFI 1Y8FA 1CT0I 2QQEA 3RU0A 1OMTA 1TUSA 2V53A 1IW4A 1KBFA 3FC3A 2V1CA 2N71A 3UGIA 3VE5A 2ERWA 5FUWA 1BMOA 2OVOA 1TBQR 1V1IA 2GVIA 1TBRR 3E59A 1YTPA 3SGQI 3E2IA 1TBOA 1LR9A 3QWPA 5FUVA 2ORVA 1Y1BA 2K9HA 1BUSA 3QTLD 1CT4I 2JXDA 1H0ZA 1CT2I 1FARA 2XRCA 2QQ0A 1NUBA 1SGYI 1TIHA 2F3CI 2GKRI 2SGEI 3UEJA 5CCLA 2WVJA 3KY9A 3GOXA 1AN1I 2ARPF 2B0UC 4A24A 2N52A 2YQPA 1UUCA 2J87A 1HJAI 2J9RA 2VRWB 1X4SA 1SGRI 1R79A 2YUUA 2SGQI 1TURA 1CE3A 5CCMA 2DB6A 2LEOA 1FYBA 5EX0A 2NU3I 2JZMA 1OVOA 2A20A 2KCXA 4GI3C 3OL0A 1UVGA 1HPTA 2JA1A 4UXJA 2ROWA 1XX6A 1SGDI 3UEYA 2KMRA 1TOTA 2NU4I 1DS2I 1PTQA 3TJQA 2L8EA 1U5KA 3SGBI 1Z7KB 2SGDI 3B4VC 3UGLA 1HDLA 4JCVE 3VDPA 2ORWA 1IY5A 1MT1A 5HQ8A 2LUYA 3OXFA 2GKVA 4FKDA 2ELIA 1OYVI 2N17A 2W0TA 2OD1A 2QQDA 2SGPI 1IY6A 5DAEA 2V1CC 5FUXA 1PCEA 4OVOA 2UZ3A 1M8BA 1UVFA 1CGJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGI I;  1CSO I;  2WCY A;  1YU6 C;  5JHW C;  1PJU A;  1R0R I;  2NU2 I;  2NU0 I;  1KMA A;  4SGB I;  2BUS A;  1SGQ I;  1M8C A;  1DS3 I;  4HGU A;  1SGP I;  2KMQ A;  2M5X A;  3SEK C;  2JYY A;  2P6A C;  1CHO I;  3OVO A;  2NU1 I;  1N13 A;  3HH2 C;  2GKT I;  1LR8 A;  1TGS I;  2KMP A;  1SGE I;  1OMU A;  1Y1C A;  2KMO A;  2QQC A;  1PPF I;  1LR7 A;  1SGN I;  2SGF I;  1CT0 I;  1IW4 A;  1OMT A;  1TUS A;  2V53 A;  2N71 A;  2ERW A;  1BMO A;  2OVO A;  1TBQ R;  1TBR R;  1YTP A;  3SGQ I;  1LR9 A;  1Y1B A;  1BUS A;  3QTL D;  1CT4 I;  2JXD A;  1H0Z A;  1CT2 I;  2XRC A;  1NUB A;  1SGY I;  1TIH A;  2GKR I;  2F3C I;  2SGE I;  1AN1 I;  2ARP F;  2B0U C;  2N52 A;  1UUC A;  1HJA I;  1SGR I;  2SGQ I;  1TUR A;  1CE3 A;  2LEO A;  1FYB A;  2NU3 I;  2JZM A;  1OVO A;  2KCX A;  4GI3 C;  1UVG A;  1HPT A;  1SGD I;  2KMR A;  2NU4 I;  1DS2 I;  3TJQ A;  3SGB I;  1Z7K B;  2SGD I;  3B4V C;  1HDL A;  1IY5 A;  1MT1 A;  2GKV A;  2N17 A;  1OYV I;  2QQD A;  2SGP I;  1IY6 A;  5DAE A;  1PCE A;  4OVO A;  1M8B A;  1UVF A;  1CGJ I; 
#chains in the Genus database with same CATH topology
 3BJI A;  1CGI I;  3UFF A;  1XA6 A;  5E3R A;  1CSO I;  2N1A B;  1ULN A;  2WCY A;  2DKV A;  2ODD A;  3OXG A;  5FUY A;  1YU6 C;  1W3S A;  3TOB A;  5JHW C;  1MJ9 A;  1UHA A;  1TBN A;  4UXH A;  2PQ8 A;  1PJU A;  1FAQ A;  1R0R I;  2NU2 I;  2NU0 I;  2ENN A;  1KMA A;  2ENZ A;  4SGB I;  2BUS A;  1WTJ A;  1SGQ I;  2FNF X;  4E1P A;  1M8C A;  1DS3 I;  2L7X A;  3MEK A;  3D00 A;  5E3P A;  1Q9B A;  4E1R A;  2E73 A;  2QPO A;  4HGU A;  2LB7 A;  3OXL A;  5EX3 A;  1SGP I;  1VDD A;  2KMQ A;  2JW6 A;  1K7V A;  2B8T A;  2M5X A;  1ULK A;  5HI7 A;  2DIP A;  3PDN A;  3SEK C;  2JYY A;  3TOA A;  3TO7 A;  2P6A C;  1PTR A;  1MJA A;  1CHO I;  4UXI A;  2E5R A;  3OVO A;  3R5D A;  2NU1 I;  1WGT A;  1N13 A;  3HH2 C;  2GKT I;  1LR8 A;  4B6D A;  1KBE A;  1TGS I;  2KMP A;  1SGE I;  1V1H A;  1OMU A;  1Y1C A;  2KMO A;  2QQC A;  3CXL A;  3UGD A;  1PPF I;  5E3Q A;  4L9M A;  1X74 A;  1LR7 A;  1W4R A;  2CJS C;  1RFH A;  1Z2I A;  5J8C A;  1XBT A;  1SGN I;  2SGF I;  7WGA A;  1Y8F A;  1CT0 I;  2QQE A;  3RU0 A;  1OMT A;  1TUS A;  2V53 A;  1IW4 A;  1KBF A;  3FC3 A;  1K7T A;  2N71 A;  2RIJ A;  2V1C A;  3UGI A;  2ERW A;  5FUW A;  1BMO A;  2OVO A;  3UOE A;  3VE5 A;  3R5B A;  1TBQ R;  1V1I A;  2GVI A;  1S20 A;  1TBR R;  3E59 A;  1YTP A;  3SGQ I;  3E2I A;  1TBO A;  1HEV A;  1LR9 A;  3QWP A;  5FUV A;  2OZU A;  4DNC A;  2ORV A;  3FSX A;  1Y1B A;  4MPI A;  2K9H A;  1BUS A;  2RC4 A;  3QTL D;  1CT4 I;  2JXD A;  1H0Z A;  1CT2 I;  1FAR A;  1NXU A;  2CWH A;  2XRC A;  2QQ0 A;  1NUB A;  1SGY I;  1TIH A;  2F3C I;  2GKR I;  2SGE I;  3UEJ A;  5CCL A;  3VDU A;  2WVJ A;  3KY9 A;  3GOX A;  1AN1 I;  2ARP F;  1P9Z A;  2B0U C;  4A24 A;  2N52 A;  2YQP A;  1UUC A;  2J87 A;  1HJA I;  2J9R A;  2VRW B;  4WP4 A;  1X4S A;  1SGR I;  1R79 A;  2YUU A;  3TO6 A;  2SGQ I;  1TUR A;  1MJB A;  1ULM A;  1CE3 A;  5CCM A;  2DB6 A;  2LEO A;  1FYB A;  3R5A A;  1FY7 A;  1WKX A;  5EX0 A;  2NU3 I;  2JZM A;  1OVO A;  2A20 A;  2KCX A;  2X52 A;  4GI3 C;  3OL0 A;  1UVG A;  1HPT A;  2JA1 A;  4UXJ A;  2ROW A;  1XX6 A;  1SGD I;  2Y0M A;  3R5C A;  1WGC A;  2KMR A;  3UEY A;  1TOT A;  2NU4 I;  1DS2 I;  3FSY A;  2UVO A;  1PTQ A;  3TJQ A;  2CWF A;  1U5K A;  2L8E A;  3SGB I;  1Z7K B;  2SGD I;  4AML A;  3B4V C;  3TO9 A;  1K7U A;  3UGL A;  1HDL A;  4JCV E;  3VDP A;  2ORW A;  1IY5 A;  2WGC A;  1MT1 A;  5HQ8 A;  5J8F A;  2LUY A;  3OXF A;  2GKV A;  4FKD A;  1P9G A;  2GIV A;  2ELI A;  1OYV I;  2N17 A;  2W0T A;  2X3T A;  2OD1 A;  2QQD A;  3QAH A;  2OU2 A;  2CWG A;  2SGP I;  5DAE A;  2V1C C;  9WGA A;  5FUX A;  1IY6 A;  1PCE A;  4OVO A;  2UZ3 A;  1M8B A;  1UVF A;  1CGJ I; 
#chains in the Genus database with same CATH homology
 3BJI A;  1CGI I;  3UFF A;  1XA6 A;  1CSO I;  2N1A B;  2WCY A;  2ODD A;  3OXG A;  5FUY A;  1YU6 C;  1W3S A;  5JHW C;  1TBN A;  4UXH A;  1PJU A;  1FAQ A;  1R0R I;  2NU2 I;  2NU0 I;  2ENN A;  1KMA A;  2ENZ A;  4SGB I;  2BUS A;  1SGQ I;  2FNF X;  4E1P A;  1M8C A;  1DS3 I;  2L7X A;  3MEK A;  3D00 A;  4E1R A;  2E73 A;  2QPO A;  4HGU A;  3OXL A;  5EX3 A;  1SGP I;  1VDD A;  2KMQ A;  2JW6 A;  2B8T A;  2M5X A;  5HI7 A;  3SEK C;  3VDU A;  2DIP A;  3PDN A;  2JYY A;  2P6A C;  1PTR A;  4UXI A;  1CHO I;  2E5R A;  3OVO A;  2NU1 I;  1N13 A;  3HH2 C;  2GKT I;  1LR8 A;  4B6D A;  1KBE A;  1TGS I;  2KMP A;  1SGE I;  1V1H A;  1OMU A;  1Y1C A;  2KMO A;  2QQC A;  3CXL A;  3UGD A;  1PPF I;  4L9M A;  1X74 A;  1LR7 A;  1W4R A;  2CJS C;  1RFH A;  1XBT A;  1SGN I;  2SGF I;  1Y8F A;  1CT0 I;  2QQE A;  3RU0 A;  1OMT A;  1TUS A;  2V53 A;  1IW4 A;  1KBF A;  3FC3 A;  2V1C A;  2N71 A;  3UGI A;  3VE5 A;  2ERW A;  5FUW A;  1BMO A;  2OVO A;  1TBQ R;  1V1I A;  2GVI A;  1TBR R;  3E59 A;  1YTP A;  3SGQ I;  3E2I A;  1TBO A;  1LR9 A;  3QWP A;  5FUV A;  2ORV A;  1Y1B A;  2K9H A;  1BUS A;  3QTL D;  1CT4 I;  2JXD A;  1H0Z A;  1CT2 I;  1FAR A;  2XRC A;  2QQ0 A;  1NUB A;  1SGY I;  1TIH A;  2F3C I;  2GKR I;  2SGE I;  3UEJ A;  5CCL A;  2WVJ A;  3KY9 A;  3GOX A;  1AN1 I;  2ARP F;  2B0U C;  4A24 A;  2N52 A;  2YQP A;  1UUC A;  2J87 A;  1HJA I;  2J9R A;  2VRW B;  1X4S A;  1SGR I;  1R79 A;  2YUU A;  2SGQ I;  1TUR A;  1CE3 A;  5CCM A;  2DB6 A;  2LEO A;  1FYB A;  5EX0 A;  2NU3 I;  2JZM A;  1OVO A;  2A20 A;  2KCX A;  4GI3 C;  3OL0 A;  1UVG A;  1HPT A;  2JA1 A;  4UXJ A;  2ROW A;  1XX6 A;  1SGD I;  3UEY A;  2KMR A;  1TOT A;  2NU4 I;  1DS2 I;  1PTQ A;  3TJQ A;  2L8E A;  1U5K A;  3SGB I;  1Z7K B;  2SGD I;  3B4V C;  3UGL A;  1HDL A;  4JCV E;  3VDP A;  2ORW A;  1IY5 A;  1MT1 A;  5HQ8 A;  2LUY A;  3OXF A;  2GKV A;  4FKD A;  2ELI A;  1OYV I;  2N17 A;  2W0T A;  2OD1 A;  2QQD A;  2SGP I;  1IY6 A;  5DAE A;  2V1C C;  5FUX A;  1PCE A;  4OVO A;  2UZ3 A;  1M8B A;  1UVF A;  1CGJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...