2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
2E1NA 5LHHA 5FO5A 3R9GA 1ZRCA 3ULQB 4F6AA 5FGMA 4ESBA 3HUGA 3GXOA 4UV8A 2HOEA 2ZW4A 4KLWA 4EGYA 1S3JA 1YLEA 3DNSA 5HDKA 3GFMA 2A61A 3PQKA 4BAYA 2DBBA 5CVVA 5L3EA 1O3TA 4U0WA 3F22A 1FOKA 3M8FA 1ON2A 2OQRA 4JXRA 3S6GA 2ZNYA 3L00A 3QAHA 3J80K 3O2PE 5L3BA 4XPKA 3M8EA 1K7AA 1YLFA 3FMQA 5DD4A 1K6OA 1BI3A 4KOYA 3H4QA 5CVUA 2M5WA 3GWZA 2FMYA 4Q48A 3MAJA 2P0WA 4A0XA 1UFHA 2JEVA 3BJ7A 1P2FA 1OYIA 1M44A 3I9SA 3G3ZA 1HW1A 1RZ4A 2ACJA 4P55A 3E6BA 3D8PA 1V4RA 2CFXA 3H3ZA 4A5NA 2VBXA 2PI0A 1XMAA 2XAQA 3HRTA 1LEBA 2PSWA 3L7WA 4NXYA 3F3XA 3J7AO 1TNTA 1YVOA 2IW5A 1IXCA 2E7WA 4BYYA 1UB9A 1TQIA 5LGUA 4FD4A 1QQIA 1IXSB 4CICA 5HS9A 3I0TA 4RGRA 1SFUA 3TOBA 5HS8A 2JDDA 4D0PA 4R8HA 1CF7B 1GHEA 3MFKA 4WXCA 4KIFA 3V8KA 1U8RA 4KN7X 3F0AA 1YW7A 1XDSA 4KIGA 2WC2A 3E97A 2FIWA 2PFBA 1DPUA 3PFIA 3CJNA 3R61A 2O03A 1GXPA 2JT1A 2ZW7A 3I71A 1F5TA 2STTA 2ZNZA 3JTGA 1Z4EA 5JI6A 3TKYA 2JPCA 4AVCA 1L0OC 4G8XA 3D5LA 1M1DA 3LSTA 3UY5A 1OR7A 2C6YA 3LQQA 1VKCA 4R3LA 2O6GE 4XNHB 4UVCA 4UNOA 2XASA 1IAWA 1ODDA 5D8KB 2C27A 5ICFA 1SAXA 3CUOA 4QWQA 2EFWA 3RJPA 4ETSA 3KP7A 4LGWA 4H0EA 3VWEA 4JLYA 2O61A 3FMSA 5D4SA 2OZHA 3IRQA 1I27A 4RGUA 1RNLA 1R7JA 2Y75A 1R1TA 5BMZA 3FWEA 2EB7A 2HTSA 2EFPA 1IZ1A 2XKPA 4XLPF 4B5PB 3E3VA 3F8BA 4PGGA 2BGCA 2D2WA 2IA1A 2QZ8A 2G9WA 1N71A 2G7HA 5AONA 2HKOA 2W25A 3GO5A 2RNJA 3EYYA 1QZZA 5C82A 3EYIA 3WR7A 1Q1HA 5F64A 3MQ0A 3H92A 4MQ9F 3SZTA 2CW0F 1PUAA 2ESHA 2HGCA 4KOXA 4WXHA 1Y9WA 2RDPA 2MA3A 3FXRA 4JJXA 2P7CB 2QUFA 3O3KA 1ZHFA 4QB9A 2P5VA 2J5PA 2W57A 1WWXA 2Q8KA 2EFQA 4JD6A 1D8KA 2CNSA 4Q47A 3EY5A 1KQ9A 3F8CA 4K30A 4ZZDA 4QBJA 3HTUA 2QM3A 4HA8A 4OIOF 2EV5A 4KOVA 3J81Z 3RKYA 4RI1A 3JTHA 2DPUA 4G7OF 1P6RA 1XSDA 1ZGAA 2HZTA 2YSRA 4PCQA 2OQGA 1B4AA 1MDMB 3CO7C 4PSWA 1RIOH 4ENMA 3DF8A 1S7LA 4AG7A 1Z7UA 1I5ZA 3TTHA 2VZZA 3BDDA 3B02A 5LBQA 1M4IA 4ZBGA 3KEQA 3K69A 1B6AA 4EM2A 4Y13A 1G6NA 4WWCA 4NHJA 1LNWA 4E2AA 3GZ5A 1JHHA 5FFXA 2HYGD 2RGVA 4IRGA 3T1BA 3IWZA 2Z11A 2H27A 2IVMA 3ZMUA 1RXTA 1BJAA 5DCFA 1LDDA 3BOQA 1MJ9A 2JZYA 2G3TA 2A4NA 1IN5A 1ZGJA 1G4DA 4KNYA 4KA4A 2PR1A 1HKQA 4M3SA 3LFKA 1HXDA 1WK4A 3KZYA 2A69F 3JUWA 3M1EA 1V0CA 5CVIA 4KMUX 1HKSA 2IP2A 5LHIA 1QPMA 1XGSA 3RYPA 1YR0A 4ZYGA 1RI7A 2Y0MA 4MHGA 1FBUA 2DO7A 3SHFA 1MKMA 3AAFA 4HBLA 1FYMA 2JTVA 3TDUC 1FWZA 2KRFA 2HV2A 2EJRA 4NCZA 2CSOA 4EJUA 2WPWA 2GA1A 5D4RA 2KKOA 3RTRA 2EFOA 4Q5SF 4HV5A 3R9EA 4R57A 3F8NA 3HSRA 4KT5C 4WXDA 2H6BA 2Q04A 3DEUA 4P5OA 4R87A 4N9IA 3R9FA 4G9YA 5A2QZ 2DFIA 3DPLC 1QZYA 2BUEA 2P6EA 3ZN0A 3NEUA 1ZG1A 2P6GA 1XMKA 3W91A 1CJWA 3T9YA 3Q5FA 2F5IA 3L09A 2W85A 1L0CA 4UWJA 5FLXK 1LDKB 4M9SA 3K1MA 5IB0A 4N0BA 1TBXA 5ED4A 3F23A 4AIKA 4CXFA 3S6FA 3V7RA 2JDCA 1EV7A 3ZMZA 3FF5A 2FL4A 4CAVA 2FA5A 1D8JA 2FE3A 2W24A 4I02A 4LK1F 2RKHA 4BHPA 1ON0A 5LGTA 1FZPB 2HYFA 4U7BA 4L89A 1USTA 3E0KA 2L02A 3DFGA 5LRSA 3TOAA 2GZWA 2EVNA 2UXNA 3KP6A 3K1NA 4EM0B 5ERIA 2QENA 3WODF 1H9TA 3KLNA 4KFCA 4LJZF 4M6YA 1UCRA 3ZMVA 3DR6A 4XPDB 4G94A 4S05A 2PLYA 3IL2A 4IRIA 4IHTA 1KUVA 1P0HA 4OIQF 2VOPA 2X7BA 3JAMK 4I7HA 3GF2A 4XPLA 2O0YA 3GUDA 1H9GA 1K78A 2PQ8A 1S60A 4LLGF 2Z0ZA 2V1XA 1SMTA 5HOOA 4DNCA 2E1CA 3OWCA 4KUAA 3IHUA 1SD4A 2MLGA 3CO6C 2AXLA 2M45A 4MEXF 4L9VA 4S04A 1T38A 1BI1A 3D0SA 5ICGA 2FBKA 2GQQA 4A6EA 2VODA 3F8KA 3QPTA 1IYKA 2DPDA 3QU6A 3BWGA 4QC6A 1W5SA 1HSTA 5E1ZB 1ZYRF 3WG9A 3I59B 4UBRA 4AD9A 1IF1A 5EEHA 2FIAA 1J2XA 5BPIA 2K4JA 3K9TA 3U1DA 4KIBA 1ZG5A 1QSRA 1P4NA 4IXAA 4KVXA 2UWMA 2AS5F 5AIQA 1T0FA 4ZYHA 4KMFA 4JQFA 5IV0A 3RIRA 3OV8A 1S6LA 3LODA 2L4AA 4KZTA 3FMRA 3I3GA 4CRZB 5H6QA 2B4BA 3D2MA 2DT5A 5AIPA 5F1RA 4KOSA 4E70A 4L0ZB 5DYMA 2M87A 2EK5A 3G73A 1QBJA 2BYVE 3E6DA 3I59A 2LF8A 1MK4A 2QQ9A 4U9ZA 2VBWA 5ILVA 3WTSC 5JR3A 2COMA 3R95A 4B5OA 2O3FA 5KTDA 5D5VB 2FXFA 2XAJA 1YS6A 4ORFA 4PZJA 1NSLA 1OPCA 4ENNA 2IL4A 3EO4A 1IRGA 5HS7A 2XROA 2L54A 2OB0A 1W5TA 1IICA 3ABTA 2VC1A 1CF7A 3DSBA 1HW5A 5DEQA 4HDVA 4HLXA 4RS8A 2PEXA 1O7FA 3T5XA 1XGMA 1XSVA 2E7XA 1S7OA 3I5UA 3HSEA 4KUBA 1QSMA 1OZPA 4AIHA 2EA4A 4YRHA 5DWNA 2LKPA 4BH9A 1TTYA 2DLLA 2IA0A 3HHHA 5CVJA 3FNCA 5D6FA 4U9YA 1STZA 1Q2DA 4WX9A 3ZZIA 2DI3A 1XN7A 1J7KA 2PR8A 2JSCA 2XHKA 2ADUA 4HV6A 2D1VA 2PG4A 4EMSA 3EUHA 3KCCA 1QSOA 2O28A 5D5UB 3DXJF 4WCGA 1YIOA 2UZKA 2VI7A 2PBIA 4HF2A 2NMTA 1EH6A 2BEIA 4MGRA 1ONVA 4YGOA 4L0YB 1IIDA 1IN4A 1ZREA 1KU9A 4ESFA 1KYWA 4FT8A 3I53A 2AJ6A 3TQNA 4YG2F 1B59A 3HOTA 2X4HA 5ILSA 1QGPA 2OBPA 3JSOA 4WF2A 1Q2CA 4HNYB 1LJ9A 2F5EA 1BM9A 3RPUA 4HAMA 1YW8A 4RAYA 1IYLA 3WTYC 2YX7A 3V7CA 3P2FA 4P9FA 5DUIA 1O3QA 5HMNA 1Z9CA 3GYAA 1LB2A 2IPQX 2Q0YA 3P9KA 5DWMA 2WTEA 1Z6TA 2BV6A 1P92A 1WI9A 2Q7BA 4Y49C 3KP5A 1H0MA 3COAC 2Q44A 3ERED 4GS4A 1U5TA 2J8NA 2M8EA 5EC4A 5DCMB 3F5BA 3KE2A 2LSOA 4H6UA 1SFXA 1O57A 1IW7F 1F1ZA 5K5RA 3DP7A 4HQMA 2IT0A 3RKWA 3EFAA 1S8NA 2GAUA 3GKRA 1KU7A 3E5QA 2FCKA 1XCBA 1SD6A 5E20A 2XAGA 2QYOA 3QRFF 4IHSA 4MJ8A 3W6XA 5E96A 4UA3A 4JK1X 4I49A 2VE8A 2EA2A 5J8CA 1T39A 3FB3A 2R7HA 3ZP5A 4B5PA 1PUEE 3KP2A 3WTVC 1ZRFA 1JHFA 1DPRA 3WTTC 2GWRA 3P2HA 4JWPA 4XRFA 2OZ6A 2BEOA 1XDUA 1E2XA 1WQ2A 3LQRA 2Y48A 2CWEA 2ZMEB 2VBYA 5F6FA 5HLHA 3DDDA 1U2WA 1JXSA 3WTWC 4A0ZA 3W6JB 4KORA 1ON1A 3BJ8A 4KDPA 4P9UA 2Z33A 4MEYF 5A2QK 1HKTA 3ELKA 3IWFA 4HX8A 3ZPLA 2ELHA 2VN2A 2FU4A 5DUKA 2P5LC 4OAEA 1SMYF 3F8FA 1R58A 1ZN2A 3RPQA 5H20A 1UHWA 4ENJA 2TDXA 1KU3A 4FD7A 2JPBA 3ROUA 1B9NA 1W4MA 4HNXB 2ISYA 5J6XA 1XGOA 2OU2A 3GX4X 2D4OA 4LX9A 4NF1A 4XLNF 2FF4A 5TRDA 2K4BA 2LDUA 3HOSA 2AE6A 3V8IA 2QQBA 1UHMA 4F7ZA 1YVKA 4R79A 3D3SA 4ESJA 1S29A 2YR2A 3QB8A 5IT3A 4M74A 3FXTA 3EC4A 1XF8A 3LD2A 2DK8A 4WK8F 3LWFA 5DV5A 3V8LA 2HUZA 2XRNA 1BN5A 4MQVA 2K5TA 2V1DA 2VBZA 3GVAA 5HDGA 2ESNA 4XPDC 1YX0A 5DD8A 2QIRA 3TO9A 4EJTA 3E5UA 2PC1A 1IUYA 3KP3A 4M6XA 1MD0A 1OMIA 2RV8A 4RB0A 1EH7A 1GHCA 5C88A 3K9UA 1D3YA 3T90A 4U88A 4O5VA 4IF5A 4PK2A 3S2WA 4HLYA 5L3FA 2QVOA 5H84A 1XSXA 4CZZA 1G3YA 3ZN1A 5CYVA 3I54A 1KUXA 3CLOA 2K27A 4EV0A 2VONA 4CO8A 2JRTA 3WU1B 4GYGA 2Q4YA 5H86A 5ILUA 3RYRA 1REPC 2MC3A 4XBFA 1BO4A 2RVCA 2FT0A 2LF7A 2MH9A 5F46A 5JQ4A 1SFEA 2V79A 1U3EM 1MJAA 3RDIA 1XE4A 2KJBA 4ON0A 1DUXC 4UWIA 3GYHX 1J0RA 3LAJA 3V4GA 4I2OA 2QECA 4G7HF 5FD5A 2XKOA 5JPHA 4EVYA 4YFKF 4R1HA 3SXYA 2FNPA 3ZMTA 5D8LB 1J59A 3CXPA 3DPTA 1FPQA 1FBQA 1FSHA 4RS2A 4EGZA 3U9GA 2B5GA 1BI2A 4JXQA 5K1YA 1U6GA 1XIXA 4NSQA 4BMHA 4KUMA 1D5VA 2H6CA 1S7AA 5LLQA 2FQ3A 3P9IA 2K7LA 4MTEA 4OIPF 1IN7A 1J9IA 1WRJA 3L9FA 3PQJA 4RGXA 1UFMA 1U6MA 3I64A 1YYVA 2CY2A 1KGSA 1WWZA 2VXKA 2FBIA 4UVBA 2PMUA 3KEOA 1IN8A 1WSUA 4L5JA 2STWA 3Q9SA 2QMLA 4NB5A 1Z9UA 4OADA 2V1UA 2P6SA 2PJPA 4M85A 3RYOA 2NAZA 2IA2A 2KIFA 2Z5UA 3SFZA 3EETA 4ZYEA 4G6DA 1GVJA 5LHGA 5IT9K 2PRBA 4PV6A 4GYIA 5E1WA 3G8WA 2NS0A 3FYNA 4CHUA 3ZQ7A 2MH2A 3U2RA 1J75A 4UUVA 1RUNA 5BPDA 3MEXA 2XUBA 2NNYA 4NEXA 2Z9OA 3N4MA 2H94A 1LDJA 3I4PA 4RGSA 1U78A 4EQQA 2DW4A 2JLMA 1OYYA 2XAHA 2MBFA 1S7NA 4M72A 4Y15A 3TCVA 2P4WA 2EV0A 1XB4A 2DTRA 1FP2A 1YFHA 4ONUA 1HW2A 5LEJA 1YQAA 4H89A 1FP1D 2DU9A 5BS6A 4UVAA 2QBYA 2VE9A 2BL1A 1T98A 4K2EA 4M71A 4EM1A 1PP8F 1LVAA 4ASNA 4BQAA 2VT3A 1Z1DA 2ZPAA 2DQLA 2GIVA 4I09A 4X5KA 2PMHA 5F49A 1W7PD 3QP5A 1TQMA 2CGPA 3CTAA 3EQLF 1PP7U 4HYEA 2P8TA 4Q4ZF 4PDKA 2VZYA 4A2UA 2HS5A 4YIFA 2EWNA 2QWWA 3VB2A 4ZZLA 2B3VA 2ZO4A 1QO0D 4G6QA 1LEAA 3O6BB 2KIMA 2NYXA 5HVQC 2O8XA 1K79A 1IB1E 1AOYA 2H5MA 2CQKA 4GO1A 1FX7A 2KJCA 4LUAA 2GA2A 5E8IA 1KYZA 4FX0A 3WU0A 1CGPA 3KFWX 3WE3A 2CG4A 1ZG3A 3DV8A 3ZMSA 2YPRA 1FBSA 2DK5A 3V8JA 5D5XB 2WV0A 4LLLA 3F6OA 3REOA 2KIUA 4MNUA 3V7SA 4AWXB 4LK0F 2J8RA 4I0AA 4OOIA 2D45A 2ETHA 4IVNA 1MZBA 5J8FA 1KZFA 3BY6A 4IRHA 4RAZA 1SQHA 5L3CA 4OLLA 3B8GA 2QQAA 3WE2A 2IRFG 1R1VA 3S6KA 1XGNA 4AIJA 4O3MA 2Q4VA 4F0YA 5FVJA 3HSFA 2I79A 3QU3A 4LG0B 1V3FA 1F4KA 2EV6A 4MY3A 4KVME 3VEPA 2DXQA 2QLZA 4M9XA 1T2KA 1I12A 4MBUA 3M9AA 1O7LA 4EJOA 1ZARA 4TV7A 2RQPA 2L4MA 2VQYA 3BJ6A 5D6EA 3W6SA 1OYWA 2ZJ2A 5JFRA 2A6EF 1T6SA 3GEZA 4LLNA 3FM5A 3TO6A 3LA2A 1TQPA 2FOKA 4XSXF 3HRUA 4OU0A 3R4KA 3HRMA 2DQRA 2L01A 1M4GA 3R6SA 2HQRA 4UV9A 3ML6A 3CXQA 2OAZA 4Y17A 1IN6A 1B1BA 2ATRA 4HDUA 2FSRA 5BOXA 3CUQC 1F9NA 2Q2EA 3VWDA 1FC3A 1Y9KA 1XCVA 2K86A 4R9MA 2D1HA 1C0WA 1NHAA 5K5OA 3SXOA 4H6ZA 4BXUA 4OMZA 1U5TB 1TNSA 4JBAA 1YW9A 5F47A 1Z05A 5ISVA 1ZLJA 3ZMDA 4DQ2A 4OIRF 1Q2YA 4UHTA 4L18B 4UXNA 1QSTA 5HLIA 2OZGA 3IKVA 3KZZA 3SXNA 2MLKA 3HRSA 1ZAOA 3QPHA 4FHTA 4B09A 2Q0OA 2FE7A 2DAOA 1HSJA 4A0YA 5KK1A 3KKWA 4U0VA 2BE5F 3MWMA 3JVNA 1I21A 4A12A 1ZLKA 3NRVA 3HIFA 4LG0A 3FHZA 3ABUA 2CO5A 5GCNA 2FBHA 2XVCA 2R1IA 2BSWA 4L8AA 3CUQA 2FNAA 2CNTA 1J4JA 3IGRA 2R7DA 3T8TA 3JAMZ 3FXUA 3FM3A 4KICA 2VOOA 4QLCU 1B6BA 1I1SA 5FD6A 2HWVA 4HF1A 1QSNA 3D2PA 2WWYA 3MGDA 3IRRA 4LD5A 4BHCA 2ZXVA 3I58A 2PN6A 3R60A 2HEOA 2J8MA 3TFYA 4AG9A 4IJAA 3PGPA 1YREA 3CUQB 3R0AA 2REFA 1FYKA 3T0YA 4BHBA 3JSPA 3WTXC 1YTYA 2J5OA 3W6KB 2VBQA 3G3SA 5KTCA 1A04A 1R36A 2B58A 3BPXA 3ECHA 2P5KA 3F21A 4KOWA 2EUIA 3LA3A 1ZH5A 3WGIA 2UXXA 2VT2A 3FBUA 5H6RA 3SQNA 2ZBKA 2Z3YA 3B73A 1Z6RA 3BROA 2ZFWA 2F2EA 1Y0UA 3TO7A 1KQ8A 3KP4A 2M1BA 5DCMA 3N7ZA 2B3UA 2YU3A 1KA8A 4Z2YA 1YK3A 4CYDA 2VXZA 1O3SA 1GXQA 5LEKA 2FSWA 2NNNA 5JVTA 4NQWA 4FD6A 1RO5A 3WTUC 2B0LA 1R22A 5LGNA 3L2CA 1TIQA 3Q9VA 2P7VB 2XIGA 3C18A 2RN7A 5BQTA 5CVRA 5E17F 1BBYA 1NMTA 4KOTA 4ZH4F 4U5YA 3K0LA 1HBXG 4IF4A 3K2ZA 3IWGA 1G3SA 2G7UA 4GGGA 2B5GB 1J5YA 4CAWA 3MZYA 4GXOA 4EJVA 5HH1A 1YS7A 1R57A 4E0AA 1E17A 3C3WA 3BP8A 3P7NA 3FX3A 4HQEA 4I0BA 1BC7C 3N97A 3KETA 3S6HA 4LFUA 1YGHA 5KTAA 1R5HA 4I98B 4L9JA 2FS5A 1BOAA 3DQVC 2M30A 4O6JA 5CJ9A 1K78B 3R96A 4P96A 4A5MA 1ZRDA 3SHPA 3EXNA 5ICCA 1SD5A 2A68F 3H3UA 1XMTA 2FMLA 4YIIA 3PZJA 4HZFA 2F5CA 5I0CA 1CM0A 4G7ZF 5CLSA 5KVRA 1FYLA 3ISPA 5E1XA 3WTZA 4J3GA 2IJLA 3R1KA 1M4DA 2OD5A 3GFIA 5IT9Z 5CNPA 3ECOA 3E6MA 2R3SA 3VFZA 4YFNF 1XD7A 1R23A 4I01A 2R98A 5E8GA 3GFJA 3WGGA 5HDNA 2I00A 4FX4A 5F48A 2BBYA 3RI4A 3DR8A 3QOPA 5D5WB 2X0LA 3GW2A 4L5IA 1EH8A 2CYYA 5FB2A 1FLIA 1VHSA 1HQCA 4N9HA 1L3LA 3FIXA 3GZ6A 3FRMA 1JGSA 4IUSA 4BNCA 2B4DA 5EBVA 4PGHA 1RUOA 4KYWA 2A5YB 3OOPA 2WPXA 5FFZA 2MD5A 4R3KA 3J81K 2YX4A 4XNHC 2R8VA 1S7KA 4LB6B 2FXAA 3BLNA 3TT2A 1TW2A 3M7GA 2NRAC 2H09A 2FEZA 4PSXA 2ARHA 3MZHA 4AVBA 5TJJA 3NE7A 1SD7A 1QNTA 2D4PA 3E5XA 2XAFA 4KN4X 4B8XA 3F6VA 1I1GA 4LB5A 1AWCA 1FT9A 2PDOA 3KLOA 3P9CA 3HHGA 2ZMEA 3CXSA 1I6XA 2Z10A 3BZ6A 1P4WA 4LMYA 4MHDA 3CDHA 2GANA 3PP9A 2XGXA 3FXQA 3F8MA 2A6HF 4RB2C 2HKXA 2A3SA 1R5GA 2R7FA 2B4DB 1FNNA 3TE4A 1Y7RA 3SZPA 2G3AA 4L9TA 1S7FA 4KLVA 4HKFA 3R0JA 2HQNA 1PU9A 1USSA 3E6CC 2KCWA 2F5DA 4YFXF 1TW3A 3NQOA 2ZKZA 3BPVA 2RC4A 2GE3A 4M73A 2OH1A 3C1DA 3BJOA 3MCZA 3VOEA 2F5FA 3C7JA 3HTSB 4E8OA 1KU2A 2K02A 2ZCWA 3JW4A 4RB1A 2GXBA 4CRYB 4CS0B 2ZXJA 1PDNC 4AB7A 4GCVA 1G3TA 2HFHA 3WGHA 4QUSA 1LRZA 1KUYA 1S3ZA 4AVPA 2HQYA 2HR3A 4PK3A 1FY7A 1U5TC 1B9MA 2XV4S 1WKMA 2OA4A 1KQ0A 1BC8C 3GLXA 2V9VA 4M9ZA 1TLHB 2P6TA 3HYIA 4OMYA 3BJAA 1B87A 2ISZA 1VTNC 2REEA 1MDMA 1BI0A 4EVIA 1R00A 4U0YA 4HX7A 6PAXA 5IX3A 2Z99A 4A6DA 3FZVA 4QVTA 4HNWB 5L3GA 1Z4RA 1JE8A 2FRHA 5L3DA 1YG2A 5E18F 1Z91A 3RKXA 5FLXZ 3LA7A 5DDGA 4HW0A 3TGNA 2HDCA 4RB3C 4EJWA 2V6CA 1X3UA 4MI4A 3LAPA 4CGZA 5EEGA 2VC0A 1W7PA 2CNMA 2L3DA 1MGTA 1O3RA 1XEBA 1I1DA 2GXGA 1BIAA 2EFNA 2OZUA 5LRRA 4ZYDA 3GFLA 3ZJ0A 5JHUA 1DDNA 3K1PA 4CAXA 4AVAA 1FSEA 2G0BA 3QP6A 1P4XA 2QBYB 4XSZF 1IXRC 2ZW6A 2ZW5A 1W7PB 4MY0A 4FD5A 1ULYA 2VEZA 1LQ1A 2LNBA 4MTDA 4II9A 2A07F 1MJBA 1P4AA 4HX4A 4YFJA 4HF0A 3T8RA 3GY9A 4OINF 1IRFA 5HLGA 3IKTA 1DP7P 4U7DA 4IPAA 3IC7A 1S5KA 2P6FA 3VODA 1R1UA 4Y49B 1BOBA 3J80Z 1BIBA 4KVOE 5ICEA 1G3WA 4L9NA 3C26A 2W84A 4ENKA 4CDGA 4HOBA 4KOUA 1K4JA 3TDZC 1NE9A 3F72A 2HTJA 3DKWA 1OKRA 5K5QA 1YO5C 3EDPA
chains in the Genus database with same CATH superfamily
2LYCA 2E1NA 5LHHA 5FO5A 4P4IA 3BT9A 3VYUB 1ZRCA 3ULQB 3R9GA 5FGMA 4ESBA 4F6AA 3HUGA 3CZXA 3GXOA 3G71I 1VQKI 1SGRI 1OFCX 4UV8A 1MBHA 2HOEA 2LD5A 3HOZJ 2QQDA 2ZW4A 4EGYA 4KLWA 1S3JA 1YLEA 3DNSA 1ZTRA 5HDKA 2M3AA 3GFMA 4C3JJ 2A61A 3PQKA 2ID3A 4IQJA 4BAYA 2DBBA 2H1LA 5CVVA 3W6VA 5L3EA 1O3TA 1H89C 4U0WA 4BD9A 3F22A 4UB8C 1FOKA 3M8FA 1ON2A 2OQRA 2NSMA 4JXRA 3GUXA 2BXZA 3S6GA 2ZNYA 3GIUA 2V6EA 3L00A 4RBOA 2KZVA 2W7NA 3EUHC 3QAHA 3J80K 2FD5A 2KZGA 3O2PE 5L3BA 4XPKA 3M8EA 4E7KA 1HA8A 1K7AA 1YLFA 2IGKA 3FMQA 3HOWJ 2VXDA 5KCMA 5DD4A 1K6OA 1BI3A 1W1WE 3FXMA 1S9HA 4C3HJ 4B6DA 3H4QA 4KOYA 5CVUA 3RQIA 4IX7A 2M5WA 3QYFA 3OYJA 5AG7A 4B14A 1IC8A 1JUSA 3GWZA 2FMYA 4Q48A 3MAJA 1SC7A 5E3RA 2P0WA 2R7ZJ 2PJAA 4A0XA 4AVZA 2M2EA 4W1UA 2CJJA 4ZDPA 1UFHA 2JEVA 5M3MJ 3BJ7A 2Q4ZA 1YX3A 3GZNB 2XAUA 3CCMI 3N05A 1NH3A 1P2FA 1OYIA 4A93J 1M44A 3I9SA 3G3ZA 1HW1A 2PJ3A 1RZ4A 2ACJA 4P55A 1VQ4I 3E6BA 2GFQA 2X6XA 3MZ8A 1V4RA 2CFXA 3D8PA 3KL9A 3H3ZA 1AHDP 4A5NA 3M8JA 2LRDA 1IV6A 3HH2C 3DTIA 4LITA 2IS1A 2VBXA 2O9LA 2PI0A 1XMAA 2XAQA 3HRTA 4ABZA 1LEBA 2PSWA 3L7WA 3CCLI 4NXYA 3SJXA 3F3XA 3J7AO 1TNTA 2V8DA 1YVOA 2IW5A 1IXCA 3BR0A 4FASD 4ZC3A 3CQZJ 2CQ7A 2E7WA 3FXLA 4C30A 5IYDJ 1FMWA 3ZCOA 2F4IA 4BYYA 1UB9A 1TQIA 2ELJA 5LGUA 1DU6A 1QQIA 1IXSB 2V8HA 4FD4A 4DJLA 4CICA 1F57A 5HS9A 3I0TA 4RGRA 1SFUA 3TOBA 2DOAA 5HS8A 2PJ5A 2JDDA 3M07A 3BG5A 4D0PA 4R8HA 1T0FC 3FBIB 1CF7B 2IGOA 2VQHA 4B3XA 3D1NI 1GHEA 2ELKA 5IOZA 3L2NA 1HF0A 3CF5F 5EYRA 4CYOA 5DM6F 2IS4A 3MFKA 2OPTA 4WXCA 3I9V2 2JW6A 4KIFA 4P4EA 3V8KA 3MKWB 2V1CC 2L7KA 3HKZA 2IGNA 1U8RA 1W36C 1MNMC 4KN7X 3FEEA 3F0AA 4XKVA 3UR3C 1W3SA 4CYNA 1YW7A 4P4BA 1XDSA 4KIGA 2WC2A 4U87A 3E97A 2K9HA 2FIWA 3B3TA 1BW6A 2DYSH 2LKSA 2PFBA 2VJ4A 4SGBI 4P10A 1V5EA 4MXUA 1DPUA 3UGLA 2VJJA 2X1EA 3PFIA 2KHMA 3CJNA 3R61A 2O03A 1GXPA 2JT1A 2ZW7A 1YX5A 2WBMA 4IL6C 4FAIA 1P7JA 3I71A 1SVMA 4UB6C 2JMWA 4A31A 1N78A 2BHYA 1F5TA 1BL0A 2STTA 2ZNZA 4RAFA 3JTGA 3S14J 1Z4EA 2X52A 2F4MB 1ZO0A 3BI0A 4KSAA 5JI6A 3TKYA 3J7YJ 2N1AB 2JPCA 4AVCA 1L0OC 2ECBA 3D5LA 4G8XA 1M1DA 2O8KA 3LSTA 2AFMA 2F4OB 1LR7A 1CBXA 3UY5A 4MFEA 4AM3A 1OR7A 2C6YA 1Z3YA 3LQQA 1VKCA 4X8IA 4II3A 4R3LA 1SEUA 2O6GE 2EH3A 4XNHB 4UVCA 1KZHA 2CFOA 1UUCA 2QKMB 3B6AA 4UNOA 2QQCA 1OCCH 2XASA 1IAWA 1Z0XA 1ODDA 1IG7A 5D8KB 1E0EA 5AG4A 4K3NA 4EWTA 2CMPA 1MT1A 2C27A 2HZDA 3LOCA 5ICFA 4D1QA 1SAXA 3CUOA 4QWQA 2EFWA 3RJPA 1R9TJ 5J4YA 3LNQA 9WGAA 2E5ZA 4ETSA 3KP7A 2R92J 4LGWA 5E3MA 4H0EA 1DS3I 4B11A 2NU2I 3B2YA 3VWEA 1NSAA 2V26A 2O61A 4JLYA 5M5XJ 3FMSA 5D4SA 2OZHA 3IRQA 3JREA 3BG3A 5JHWC 1I27A 4RGUA 2LBFB 1RNLA 2PJ8A 1R7JA 2Y75A 5GTIC 2PX9A 2IS2A 1R1TA 3S1QJ 3FXOA 5BMZA 2L8EA 2R5ZA 5F0HA 3FWEA 1U0JA 3CLQA 2ME6A 2EB7A 1ULMA 3OYCA 4H2KA 2MSYA 2X6OA 2HTSA 4IHXA 2EFPA 1AYEA 1IZ1A 2XKPA 2KMRA 3OYBA 1R6RA 1Q7LA 1FTZA 4BJ5C 4XLPF 3OS1A 3E3VA 3F8BA 4PGGA 2QPOA 3VYRB 4B5PB 3S9LA 2BGCA 4PPZA 4ZJZA 2D2WA 2QZ8A 2IA1A 2G9WA 3DTKA 1N71A 2G7HA 5AONA 4NGQA 2MW8A 5EGOA 2HKOA 2W25A 2K9QA 4BKXA 3GO5A 2AFWA 3VSKA 2RNJA 2IMOA 4R6TA 3EPZA 3PIPF 3EYYA 1W36D 2P6AC 2EPFA 3IEHA 4NJQA 1QZZA 5C82A 4OVOA 3EYIA 3WR7A 1DGWY 1Q1HA 5F64A 2H8RA 3ABKH 3MQ0A 2M0MA 3LWUA 1WJFA 3H92A 4WWVA 4CPAA 3K4BA 4MQ9F 4YIRX 2SGEI 3SZTA 2XRCA 2CW0F 3KX2A 1PUAA 2ESHA 1CP6A 4IK2A 2X1CA 2HGCA 4P6YA 2Z3OA 4KOXA 4WXHA 1MIJA 3MVPA 1V55H 1Y9WA 1ZLIA 2RDPA 2MA3A 3FXRA 3BC8A 1B8IA 4JJXA 2P7CB 2QUFA 1E3OC 4BY1J 3O3KA 1ZHFA 4QB9A 2P5VA 2J5PA 2W57A 1ETWA 1WWXA 1FOWA 2Q8KA 2ZXHA 5GTHC 2EFQA 1JKOC 9ANTA 1HPTA 2RIJA 1TIHA 4JD6A 1X1PA 1FOXA 3HPHA 1CE3A 1D8KA 2AFSA 2CNSA 3H8FA 4Q47A 3DEWA 3EY5A 1KQ9A 3F8CA 1A6IA 1MNEA 1UHAA 4K30A 4NGTA 5ELYA 4ZZDA 1WZ2A 4QBJA 3A0HC 3HTUA 3H3VK 3B3VA 3CDLA 2QM3A 4RLQA 4HA8A 3PUBA 2EV5A 4OIOF 1IY6A 4KOVA 3HBLA 3J81Z 4C9YA 3RKYA 1PYVA 1BUSA 3QYBA 2WA0A 3AL0C 3JTHA 2DPUA 4G7OF 3DBRB 4RI1A 4CCOA 1T33A 1P6RA 1XSDA 4E1PA 1ZGAA 2L0KA 1FAQA 3CZ6A 5IYBJ 2HZTA 4ZX8A 4UUSB 2M7BA 5B66C 2YSRA 4PCQA 1TWCJ 1R4MB 2OQGA 1B4AA 2GKTI 4EATA 2GXAA 1MDMB 3CO7C 4P4JA 4PSWA 3R5CA 1RIOH 1TT0A 4ENMA 3DF8A 5GADJ 1CSOI 1PCEA 3IJ3A 3W3CA 1S7LA 1K6YA 4AG7A 2VL8A 3OYHA 2J87A 1Z7UA 4UCNA 4B13A 1I5ZA 1Y7EA 3TTHA 2IXSA 2N8GA 3S9NA 5HNHA 2VZZA 3BDDA 3B02A 5LBQA 1M4IA 4ZBGA 5K8MA 2PJ6A 4OMEA 4A2ZA 5LRKA 3KEQA 3K69A 1B6AA 1XX5A 4EM2A 4Y13A 1G6NA 4WWCA 1NUBA 4NHJA 1Z8LA 4H4KC 1LNWA 4JZ0A 3OIQA 4E2AA 3GZ5A 1JHHA 5FFXA 2HYGD 2RGVA 4JP0A 2E1OA 4F52A 3KQZA 1CT2I 4IRGA 3T1BA 3IWZA 2Z11A 3FDYA 2NOGA 2IVMA 2H27A 2O4HA 2DMTA 3IU1A 3ZMUA 1QQ9A 1RXTA 1BJAA 5DCFA 5J4VA 1MMAA 1LDDA 4X2TA 3BOQA 1MJ9A 2W48A 2JZYA 1D1BA 3K70C 1TC3C 2H1KA 1JJ8C 3S16J 2G3TA 3SI2A 4OC1A 3UKGA 4DYOA 5I4MA 3EUAA 2GKRI 3C2HA 2A4NA 2GLJA 4DOZA 1IN5A 1ZGJA 4DZJA 5GPAA 3H0DA 3UFFA 1G4DA 1W0UA 4KNYA 2OCEA 4KA4A 2N17A 2PR1A 1HKQA 1K61A 3LFKA 3RCOA 4M3SA 2HXIA 2A20A 1HXDA 3DKXA 3JRCA 1WK4A 1LR9A 3ZOBA 3KZYA 2WGCA 3D66A 2A69F 3C2GA 1CT4I 3JUWA 1Z5RA 4MHPA 3M1EA 4OWRB 4F55A 5CVIA 4KMUX 5EEAA 2NU0I 1V0CA 3H8EA 1HKSA 2IP2A 5LHIA 1QPMA 1XGSA 2ZMEC 4C3IJ 3RYPA 1YR0A 1SGPI 4ZYGA 1RI7A 2Y0MA 4MHGA 1FBUA 2DO7A 3SHFA 1ETKA 1IOIA 3DLJA 4NFRA 1NXUA 4AU7A 4BEHA 1MKMA 3AAFA 1RTQA 3SJGA 3CP2A 4HBLA 3ZXSA 2JQ7A 2HVRA 1FYMA 2SGQI 2JTVA 3TDUC 4MPIA 1FWZA 2GLFA 2KRFA 3KASA 1IDYA 3M4OJ 3BR1A 1XMXA 4XLAA 1XJOA 2HV2A 2EJRA 4NCZA 2HQAA 4RM3A 2FVGA 2CSOA 4EJUA 2WAQN 3UNGC 2WPWA 5H86A 2GA1A 5D4RA 2MD0A 4PJNA 2GOMA 2KKOA 1UWYA 2L7ZA 2EFOA 3DBLB 3RTRA 4Q5SF 1XA6A 4HV5A 3AG3H 3R9EA 2GIZA 3TW6A 2NU1I 4R57A 4BBSJ 3F8NA 1SFKA 3MKZA 4A3IJ 4A3GJ 1HOMA 4HEA2 4UEEA 3KY9A 2XEJA 3BCBA 3HSRA 4KT5C 2J9RA 4WXDA 4B1RA 4DW6A 2H6BA 5FRMA 4MFQA 3OSFA 2Q04A 3KQXA 1Z8TA 4ZYQA 3BR6A 4Z65A 2RAEA 3OY9A 3DEUA 2HB6A 2VQCA 1I3AA 4P5OA 1WJBA 4R87A 1JUMA 3A01B 4N9IA 4OIDA 1SVOA 3R9FA 1ZGWA 4G9YA 5A2QZ 2DFIA 2ELIA 1DE4C 5CPAA 1I50J 1MBJA 1QZYA 3DPLC 2BUEA 4HSRA 2Q51A 3LFUA 3KYCB 2P6EA 2B0UC 2KIQA 7WGAA 3ZN0A 5AG5A 3NEUA 3VDUA 1ZG1A 1PJUA 2P6GA 2XEFA 2ZELA 3CCRI 2G0EA 1XMKA 5FKNA 3W91A 4LIVA 3R96A 3LSIA 1CJWA 3T9YA 1Z3XA 1OJLA 3Q5FA 1TUSA 3L09A 2W85A 1L0CA 2F5IA 3ZQLA 5FLXK 4UWJA 1LDKB 4M9SA 4A39A 2Y30A 3K1MA 5IB0A 1XC5A 3MN2A 4N0BA 5IPAA 1TBXA 2JVGA 5ED4A 3F23A 4GXHA 4AIKA 2WYRA 2R0QC 2JSPA 2LBFA 2WB1N 2ANPA 3T8WA 4CXFA 4MLOA 3S6FA 3V7RA 3NAUA 1EV7A 2JDCA 3ZMZA 3ISXA 4RUHA 2AHQA 3FF5A 2FL4A 1DP3A 4MFJA 4CAVA 2FA5A 1D8JA 3BXMA 2FE3A 2W24A 4I02A 4LK1F 2RKHA 4BHPA 1ON0A 1CP7A 3NH8A 4OC5A 5LGTA 2JA1A 3R5BA 3PBBA 1FZPB 4JYWA 3UOEA 2HYFA 4U7BA 4L89A 3L2WA 3CMEI 1USTA 3E0KA 2L02A 3DFGA 5LRSA 3TOAA 1XPXA 1JKPC 2GZWA 4AYBN 4Y7NJ 2EVNA 3K7AJ 2UXNA 3KP6A 2XGCA 2BOAA 3PB6X 2V9KA 5CBMA 2NS8A 3K1NA 4P1WA 4EM0B 1V1IA 2Z3KA 5ERIA 2QENA 2SGDI 3WODF 1H9TA 3KI9A 1D0XA 3KLNA 4KFCA 2Q7SA 3KGQA 3PB8X 1UZCA 4LJZF 4M6YA 1UCRA 3ZMVA 3DR6A 4XPDB 4G94A 2PCUA 3KR4A 4S05A 2AO9A 2PLYA 2PVWA 2VQLA 1MNDA 4ZY2A 1F2OA 3G6EI 2CQNA 1Z7KB 1MBFA 3IL2A 2DYRH 3F9KA 4IRIA 4IHTA 4X1EA 2X3TA 1KUVA 1P0HA 4OIQF 2VOPA 2X7BA 3JAMK 1TBOA 1ELLP 4I7HA 3GF2A 4XPLA 3OYNA 1MW7A 2O0YA 3GUDA 2V7FA 1H9GA 4BXFA 5FJ8J 1K78A 2PQ8A 1S60A 1VHOA 3PEIA 4LLGF 1JT6A 2Z0ZA 2V1XA 4UIBA 4KT6A 5FKMA 3OOUA 4BQNA 1FT7A 1SMTA 3CT9A 1HLVA 5HOOA 2RB7A 4DNCA 2E1CA 2XSDC 3OWCA 4KUAA 3IHUA 5B1BH 4KISA 4X3RA 1X10A 1SD4A 1CX8A 1Y8FA 2MLGA 3DU6A 3CO6C 1X3ZB 2AXLA 3TX8A 2M45A 4Y4RA 4MEXF 4ZTJA 4L9VA 5DS0A 4S04A 3QWLA 2C6GA 1T38A 1XX6A 4CAFA 1BI1A 1QVUA 3D0SA 5ICGA 2FBKA 1YW4A 2GQQA 4A6EA 1BA5A 2VODA 3F8KA 2PJRA 3QPTA 1IYKA 2DPDA 3B3SA 3Q3SA 3QU6A 3BWGA 4QC6A 1W5SA 4GRIA 4N4NB 1HSTA 2DKVA 5E1ZB 1TWAJ 4E4HA 1ZYRF 3WG9A 1M1EB 3I59B 2R5YB 4UBRA 4AD9A 2E2JJ 3QNVA 1Y0NA 1IF1A 4NGMA 5EEHA 1SFOJ 4RA2A 2FIAA 1J2XA 5BPIA 2K4JA 1WKXA 3K9TA 5FUYA 3NFZA 3U1DA 2DA7A 4KIBA 2AQEA 1BR2A 1VI0A 4C7HA 1ZG5A 2CJSC 1QSRA 1P4NA 4IXAA 5DS9A 4KVXA 2EILH 2UWMA 2AS5F 5D8NA 5F0FA 1LVKA 3ZGKA 3HUGB 5AIQA 1T0FA 5K7HA 4ZYHA 4KMFA 4F9VA 4JQFA 4PJMA 1Y0YA 5IV0A 3RIRA 3D68A 3OV8A 5M3FJ 1RPWA 1S6LA 1YJNI 3LODA 4UIAA 3H0GJ 2L4AA 3K6GA 1UJ8A 2R7SA 3PNYA 4KZTA 3FMRA 3I3GA 4XL9A 1HDDC 3F0CA 5H6QA 4CRZB 4XORA 2JBKA 1KBEA 2B4BA 3D2MA 2DT5A 5AIPA 5F1RA 4KOSA 3QYEA 2ORVA 4E70A 4L0ZB 5DYMA 2AXTC 2M87A 1Q1VA 2EK5A 3G73A 1QBJA 2BYVE 3CC7I 2QJ8A 3VYTB 2M0CA 3E6DA 3I59A 2RFHA 2LF8A 4L9MA 1A6QA 2QQ9A 1MK4A 4U9ZA 2VBWA 1B72A 1JT0A 2X48A 4JX6A 5ILVA 3S1RJ 2LUYA 3G1LA 3WTSC 2O53A 5JR3A 2COMA 4CGOA 3R95A 4B5OA 2O3FA 2Y9ZA 3QPLA 5D5VB 2FXFA 5KTDA 4A3DJ 2L2OA 2XAJA 1QHHD 1YS6A 5J1UA 3FEDA 3SFIA 4ORFA 4PZJA 1GV2A 2UZ3A 1YE9A 4E7SA 2L7FP 1NSLA 1JTYA 4AXVA 4C2MJ 4BQQA 1OPCA 3TP3A 3ERMA 4ZI6A 2RNGA 2L9SA 3L2UA 4ENNA 2IL4A 4IOCF 5F1JA 4LG3A 1IRGA 3EO4A 1QZEA 2Q43A 1VQNI 3IUOA 3B7IA 5HS7A 2XROA 2L54A 2OB0A 1CHOI 1W5TA 3BR5A 3ABTA 1IICA 2E1MC 2VC1A 1CF7A 3DSBA 1X1CA 1HW5A 5DEQA 4HDVA 2XSJC 4HLXA 2YNEA 4RS8A 2PEXA 5E3NA 2ZJRF 1IOFA 1O7FA 4D5FA 3T5XA 2L9VA 1Z67A 1WJDA 5F04A 3OYMA 2JJ7A 2ME0A 4CCLA 1XGMA 1XSVA 2E7XA 1S7OA 2X6WA 3R5AA 3I5UA 4M3BA 1OMUA 2K40A 3HSEA 1UG0A 4G12A 2Q1ZB 4KUBA 5HODA 1QSMA 2B63J 1OZPA 4AIHA 2EA4A 1VQPI 4YRHA 5DWNA 4FCYA 2CUZA 2TRTA 1ZELA 1YSJA 2LKPA 4XM3A 4BH9A 5CQGA 1TTYA 1Z2LA 2DLLA 2IA0A 3D7FA 3ESWB 5F08A 2JZMA 1K83J 3HHHA 4DGWB 3D5SC 2JA5J 2QF7A 1XBTA 1Q9BA 5CVJA 3FNCA 5D6FA 3Q0UA 2F7VA 4U9YA 4B6ZA 2K9LA 3D7GA 1STZA 1Q2DA 3BG7A 4WX9A 3ZZIA 3L2VA 3LSPA 3H9GA 1LAPA 1K7VA 2DI3A 1BMOA 1IU8A 4JCVE 3A4CA 2ZEGA 1IGNA 1XN7A 1IUFA 1J7KA 1Y56A 2JSCA 2XHKA 1VQ7I 1JWQA 2VIXA 2EK8A 2PR8A 2ADUA 1P9QC 4HV6A 2D1VA 4E7ZA 2PG4A 2CWFA 2Y9YA 4EMSA 3EUHA 3KCCA 3P5JA 1QSOA 3ASNH 2O28A 5D5UB 1UMQA 3DXJF 2HOSA 3DCFA 1JQGA 2BCOA 1IDZA 3LL7A 3LMSA 4WCGA 1YIOA 2UZKA 2VI7A 4Q38A 2PBIA 4HF2A 3AG1H 1R71A 4EEFG 1EH6A 2L9RA 2NMTA 4X6AJ 4DYRA 2BEIA 4TWEA 4MGRA 1ONVA 4QTRA 4YGOA 4L0YB 1IIDA 1IN4A 1ZREA 2YQPA 1KU9A 1KYWA 2CW8A 3ABLH 4FT8A 1LKXA 3I53A 4ESFA 3TQNA 4YG2F 2AJ6A 1B59A 2ZEHA 3HOTA 2X4HA 5ILSA 1QGPA 1PVEA 2OBPA 3HUVA 1UELB 3RZOJ 4AUXA 3JSOA 4WF2A 1Q2CA 4HNYB 3HGYA 1LJ9A 3PNTA 3AG2H 2QSFX 3ZRGA 3D5RC 2F5EA 1MBKA 2R7WA 4BXXJ 1BM9A 3RPUA 2F6CA 4A3JJ 1VQLI 1KONA 4HAMA 1YW8A 2CV2A 4RAYA 5F09A 2NXNB 1IYLA 4ZGYB 3WTYC 2YX7A 4P4DA 5B1AH 3V7CA 3P2FA 4XKBA 4P9FA 5DUIA 1VDDA 1O3QA 5HMNA 3GTQJ 1Z9CA 3BG9A 1WJAA 3GYAA 1LB2A 2RQQA 2IPQX 3FKJA 3ZQGA 2YUUA 1QRYA 2Q0YA 3P9KA 3K4MA 5DWMA 2WTEA 1FNOA 1Z6TA 1X4PA 2BV6A 4S0HB 2PJ2A 1P92A 5J1QA 3B35A 1WI9A 2Q7BA 4Y49C 5JH9A 1ACIA 3KP5A 1H0MA 1T56A 1AU7A 3OVOA 4XN3A 3COAC 1YTPA 2Q44A 1FIPA 3ERED 3VWBA 1ZR4A 4GS4A 1U5TA 4DZPA 4Y3OA 1YHQI 5DM7F 2KRHA 4F3QA 4R8FA 2J8NA 2M8EA 5EC4A 5DCMB 3F5BA 3KE2A 2LY1A 4NC8A 3PRTA 1VQOI 3DU5A 1GUUA 2LSOA 4ANJA 4BE1A 1A31A 4H6UA 1IGBA 2ZOFA 2ZEOA 5EMIA 1SFXA 1ULKA 1O57A 2KFDA 1IW7F 3OR1C 1F1ZA 3CC4I 5K5RA 3DP7A 3A0BC 4FTHA 1N77A 3I56I 4HQMA 2IT0A 3RKWA 1VQ9I 3EFAA 1S8NA 4ZTFA 1X58A 2GAUA 2Z3PA 3GKRA 1KU7A 3E5QA 2FCKA 3HDDA 1XCBA 3IWEA 1SD6A 5E20A 1LUJB 2E19A 3IH4A 2V4JC 1LE8B 2FUG2 2QYOA 2XAGA 1HEVA 2ID6A 3QRFF 4IHSA 2AFZA 4MJ8A 3W6XA 2KPMA 2Z1DA 4UUTA 5E96A 4UA3A 1X1DA 1QMUA 2GLOA 1UVFA 2X1DA 2K85A 4KJZA 4JK1X 2Z3LA 2JUCA 4I49A 3OWTA 5EZHA 4HSTA 2VE8A 4E7IA 2EA2A 1GDTA 5J8CA 3S17J 1YQEA 3FSYA 3FMCA 3ZQHA 1Z2IA 2WUUA 4Q7AA 3IH2A 1T39A 3CC2I 1OVOA 2ERWA 3FB3A 2R7HA 3OYIA 3ZP5A 5IP9J 4B5PA 3JTKA 3LSJA 3CDIA 4QPQA 4CYCB 2YNCC 3RU0A 1PUEE 1OISA 2CUFA 3KP2A 2ZXWH 1JHFA 3WTVC 1ZRFA 3BZCA 1DPRA 3WTTC 1GT0C 3H5RA 4C2UA 4IZZA 2GWRA 3P2HA 1TKJA 2ZC2A 4JWPA 4XRFA 2OZ6A 4RN7A 2BEOA 1XDUA 1E2XA 3R5DA 4A37A 2IJZA 2CTCA 1WQ2A 3LQRA 2Y48A 3LSRA 3OXFA 2JEWA 3A9LA 2CWEA 3EUKL 3FKIJ 1Y39A 2ZMEB 1ARLA 2VBYA 5F6FA 5HLHA 2QEXI 5CCMA 2AFXA 3DDDA 1U2WA 1JXSA 3WTWC 4YEJA 2KDZA 4XOPA 2LVSA 2NOJB 4A0ZA 3S3NA 1WCMJ 3W6JB 4KORA 5E3LA 1XG1A 3CDXA 4NC6A 1UHSA 3OL4A 1ON1A 3BJ8A 4KDPA 5A27A 1X74A 4P9UA 3ABMH 2Z33A 4MEYF 2DT6A 5A2QK 3GTPJ 1HKTA 3CJRB 1D0YA 3ELKA 2MC4A 2ZEDA 3IWFA 4A3FJ 1SGDI 2OOTA 2ECCA 4HX8A 2J9AA 3NA6A 3ZPLA 2ELHA 2X6YA 2VN2A 2C1CA 2FU4A 5DUKA 2P5LC 1M4LA 4OAEA 5M5WJ 1SMYF 3F8FA 3KYDB 3OXLA 2HYJA 1R58A 3WABA 4F9UA 1ZN2A 2ZFUA 4IEJA 4A3KJ 4EFDA 2PJCA 5IB9A 3RPQA 1TF9A 1JTXA 5H20A 1UHWA 4ENJA 2LH9A 4XOTA 2TDXA 3VATA 1KU3A 4FD7A 1PJRA 2JPBA 2LK2A 1B9NA 1W4MA 3DWLE 3ROUA 1H8AC 1ORKA 4HNXB 4D5CA 2CQXA 2PE3A 3DTEA 2ISYA 2KL4A 5J6XA 2GREA 2E5RA 3RAMA 3OSGA 4DUKA 3TP0A 4V2FA 1XGOA 1HJAI 2OU2A 3GX4X 1Z8XA 2D4OA 2PVVA 3PB7X 4LX9A 4NF1A 4HG2A 4N4OB 4XLNF 2D5VA 3VDPA 2FF4A 5TRDA 3OYAA 2VL1A 2K4BA 1H8LA 1RKWA 3TJQA 2LDUA 3HOSA 3BQZA 2E2IJ 2XB5A 4WJBA 1GV5A 1FEXA 2AE6A 2HC9A 3V8IA 1RKTA 2QQBA 1UHMA 4F7ZA 1YVKA 3HPGA 4R79A 2QQ0A 3D3SA 3DKYA 4ESJA 4Y52J 4G1PA 1S29A 2Z16A 2YR2A 3QB8A 4ZDLA 5IT3A 2OV7A 5FKLA 2Y2ZA 4M74A 4D7MA 3EC4A 1LAMA 1R3NA 3FXTA 5FLMJ 3O8HA 1YRNA 3RKQA 2V53A 1XF8A 3LD2A 1OCRH 2DK8A 4FE7A 3LWFA 4XN0A 5DV5A 4WK8F 3V8LA 2HUZA 2XRNA 3A02A 2OJED 1BN5A 1TWHJ 3PL8A 4MQVA 4FISA 1G8XA 2NVQJ 2K5TA 2BW3A 2V1DA 3WC5A 2VBZA 3FHNA 3GVAA 3H35A 2ESNA 5HDGA 1YX0A 4XPDC 2WY7Q 5DD8A 3H5ZA 1G59A 4KSIA 2QIRA 4NC7A 1B72B 2HNHA 4ZX9A 4HPSA 3N5FA 3TO9A 5HQ8A 1NK3P 4EJTA 3VE5A 3E5UA 2PC1A 5FKKA 1RFHA 1IUYA 3KP3A 4CGPA 4M6XA 1MD0A 1OMIA 4UXJA 2RV8A 2CQQA 3RSNA 4RB0A 1EH7A 4CCJA 1H88C 4CSWA 5HXDA 1GHCA 5C88A 1K7TA 4V2GA 3K9UA 1D3YA 4NBQA 3T90A 4U88A 1X19A 4O5VA 4IF5A 1TL8A 1CPSA 4DYQA 5CCLA 4PK2A 3S2WA 5B3SH 4M3DA 2N52A 4HLYA 5L3FA 2QVOA 2OD1A 4KS9A 5H84A 1XSXA 4CZZA 1G3YA 3ZN1A 5CYVA 5M5YJ 2ZENA 3I54A 1KUXA 5J47A 3CLOA 2K27A 4EV0A 1QVTA 3OYFA 2VONA 2IEKA 4CO8A 1V54H 2JRTA 3PM1A 2WZNA 3WU1B 4MO7A 4GYGA 1ETYA 4CCKA 3S3MA 2Q4YA 4HGUA 5ILUA 3RYRA 5G20A 1WJ5A 5K7ZA 3JRHA 1AA7A 1REPC 2MC3A 4XBFA 1BO4A 4M6HA 1PTQA 2EQRA 2RVCA 4RAGA 1JI8A 3LMMA 2FT0A 1XS9A 2LF7A 4YWYA 2MH9A 3KPHA 4BL0B 1M8CA 5F46A 5JQ4A 2DDBA 1SFEA 2V79A 1U3EM 1CQTA 1X3WB 2SGPI 1MJAA 1NTCA 3RDIA 1XE4A 4EMEA 2V9PA 2W82A 2DTZA 2KJBA 4ON0A 2PMZA 1DUXC 1WGCA 3ISZA 4UEFA 3GYHX 3SYTA 1J0RA 3LAJA 3V4GA 4I2OA 1SGQI 2QECA 4G7HF 2VKHA 2XKOA 5FD5A 4UXIA 3QWPA 4GI3C 5FKOA 1EE3P 3WT4A 4B3AA 5JPHA 2BVMA 2BHZA 4EVYA 4YFKF 1TBRR 3S9MA 4R1HA 3FECA 2E36A 2DA1A 2EZLA 3SXYA 2FNPA 3ZMTA 4IAVA 4RDUA 4FBEA 4OKOA 1OMTA 2HVSA 5HVGA 5LYLA 4F0XA 4B4CA 5D8LB 4A3MJ 1J59A 3CXPA 3DPTA 4XICA 3S2DJ 1SAUA 2IBDA 1FPQA 2B8TA 4A95A 4MMOA 1Y1VJ 4BS9A 1FBQA 3PJRA 3FBNB 3BR2A 1FSHA 3SI0A 1UAAA 4RS2A 4EGZA 3U9GA 2QSGX 2B5GA 2JYYA 3NWSA 3SJEA 1ZG8A 1BI2A 4JXQA 1V5GA 2E73A 5K8PA 3B3WA 5K1YA 2PJ4A 2A5WA 1U6GA 3MN8A 1XIXA 4NSQA 4BMHA 4KUMA 4ITVA 2R7RA 1D5VA 1HDPA 2CF4A 3SGBI 2H6CA 4J01A 1S7AA 1Z8WA 4MFZA 1KBFA 4XR6A 5LLQA 5K8NA 2VKEA 2FQ3A 5LYIA 3P9IA 3PUFA 3DLLF 2I10A 2AQFA 4R7MA 2K7LA 2JWTA 5KAIC 5F27A 1TGSI 4MTEA 1D1AA 4Q36A 4OIPF 3D7DA 2LEOA 1IN7A 1J9IA 1WRJA 2DA5A 3L9FA 3PQJA 2VPRA 4RGXA 4XRSG 2ZJQF 3K4CA 3VH9A 1UFMA 3QOEA 1U6MA 2XPWA 4C2XA 3I64A 1YYVA 2CY2A 1KGSA 3JRGA 4MFPA 1WWZA 5TGTA 2VXKA 2FBIA 2I8DA 2Y69H 4UVBA 1VNDA 2PMUA 4CH7A 2ODDA 4UFWA 2GBYA 3KEOA 1IN8A 2I5UA 2IAIA 3FK7A 5BNGA 5KHDA 4L5JA 1WSUA 1PUFB 2STWA 4A94A 4C2TA 3Q9SA 3H5AA 1JGGA 2ODFA 2QMLA 3GBGA 4NB5A 3ZQCA 1Z9UA 4ZYAA 4OADA 2V1UA 2P6SA 2PJPA 4M85A 3RYOA 1EA3A 3MMYB 1ZKGA 2NAZA 2IA2A 2QVPA 4XQFA 4E6KG 2KIFA 1YITI 3ZR8X 2Z5UA 3SFZA 4DJAA 3EETA 4ZYEA 4G6DA 1GVJA 5LHGA 5IT9K 2F48A 2PRBA 4PV6A 4GYIA 3JRDA 5E1WA 3G8WA 2NS0A 3FYNA 1TT5B 4WP4A 4CHUA 3OYEA 3UGDA 2PRQA 3ZQ7A 1RRJA 2KQRA 2MH2A 3U2RA 4OP4A 1J75A 2XPUA 2F8HA 4C68A 2BY1A 3OMYA 4UUVA 1RUNA 5BPDA 2WAEA 2XUBA 3MEXA 3QPSA 2NNYA 4IKFA 3OXGA 4NEXA 1JKRC 2Z9OA 5JGFA 4M6VA 3N4MA 3SHPA 3HZJA 2H94A 2DEAA 1LDJA 2V8GA 1EF4A 3I4PA 2KRCA 3PFYA 3CCQI 1VQ8I 3WC6A 3RNZA 1IO2A 1LFBA 4XLFA 4RGSA 1U78A 3OYGA 1X4SA 2VJ5A 4AC0A 3S2HJ 3I3LA 4EQQA 2OCCH 2DW4A 5F0CA 3TMOA 2JLMA 3QODA 1OYYA 2XAHA 2MBFA 2X85A 1S7NA 2DA6A 4M72A 4NDLA 5IYCJ 4Y15A 1WTJA 2CUJA 2F3CI 3TCVA 1XMBA 5EG0B 2P4WA 2EV0A 1O4XA 1XB4A 2DTRA 5FLVA 4Y33A 4XMYA 3MKYB 4QPOA 4TNUA 1FP2A 1YFHA 4ONUA 1HW2A 6CPAA 1PCAA 1UVGA 5LEJA 1YQAA 4H89A 3WC7A 1FP1D 2DU9A 5BS6A 2XGDA 4UVAA 2QBYA 2JK3A 2VE9A 1HDLA 4RMNA 2BL1A 3KEYA 5K8OA 5KAFC 1P9GA 4B12A 1Z77A 1T98A 4K2EA 4M71A 2YUSA 2L7XA 2YNDA 4EM1A 1PP8F 1LVAA 4ASNA 1SGNI 2A05A 4BQAA 2VT3A 4NJRA 1Z1DA 2R7QA 2ZPAA 3CF2A 5GAHJ 3BHXA 3PSFA 3GB0A 2DQLA 2GIVA 5IP7J 4I09A 2DA4A 4X5KA 2W00A 2PMHA 2DA3A 5F49A 1W7PD 3QP5A 2DMUA 3QTLD 3CCUI 1HCRA 4HNVA 1TQMA 2CGPA 4UXHA 1R4NB 1Z7LA 3MD2A 2IQ6A 3CTAA 3EQLF 5EG0A 1PP7U 3NARA 2P8TA 4HYEA 4PXBA 2JRMA 4Q4ZF 2NVYJ 4PDKA 3CMYA 2VZYA 4A2UA 2HS5A 4YIFA 2EWNA 4E7HA 5AGEA 2QWWA 3VB2A 4ZZLA 2B3VA 1MMNA 1QO0D 2ZO4A 1K4SA 1IRZA 2MABA 2EBJA 4G6QA 1LEAA 2DFHA 3CESA 3O6BB 2KIMA 2NYXA 2VQGA 3PSIA 5HVQC 1OYVI 2ENNA 1VHEA 2O8XA 1K79A 2MG4A 1U8BA 4UUSA 2OUMA 2KLOA 2VRWB 1IB1E 2JBJA 3G2BA 2EWBA 5E79C 1AOYA 2H5MA 4OC0A 2DOEA 2CQKA 3IAS2 4GO1A 2N71A 1FX7A 2PJRB 2GOXB 2KJCA 2M4KA 4PXDA 4LUAA 1LE8A 5HVFA 2DT7B 1RETA 2GA2A 5E8IA 5J1YA 1KYZA 4FX0A 3WU0A 1CGPA 1EKEA 4M3GA 3TL4X 2NVTJ 3OYLA 1NG7A 3KFWX 4XONA 2NU4I 2VPLA 2QGUA 3WE3A 4ONWA 2CG4A 1MH3A 4CUGA 1ZG3A 2HOAA 3H36A 3BZKA 1MSEC 2R7TA 2GVIA 2QQEA 2JXDA 3DV8A 3ZMSA 1I39A 2YPRA 1FBSA 2DK5A 4QIWN 4LOCA 3V8JA 5D5XB 2WV0A 4D9JA 4BY7J 1XRYA 2LP0A 4LLLA 4UWIA 1AMPA 2Z2SB 3F6OA 3REOA 2KIUA 1MMGA 4MNUA 3V7SA 3BCAA 4AWXB 4LK0F 1YI2I 2J8RA 4I0AA 1BJZA 4OOIA 2D45A 2ETHA 2QA4I 4IVNA 1MZBA 1F43A 5J8FA 3A01A 3BY6A 1KZFA 2EIMH 4IRHA 4RAZA 4XIDA 1SQHA 3W2WA 5L3CA 2C6CA 3V7ZA 2KP6A 3CCSI 5A28A 3PFOA 2ZEEA 2X51A 2XGEA 3GOXA 4UCPA 4OLLA 3B8GA 2QQAA 3WE2A 2IRFG 3K2AA 2LR8A 1R1VA 1YRNB 5FUVA 3S6KA 1ETXA 1XGNA 4AIJA 4O3MA 2Q4VA 4F0YA 2KMUA 3DEEA 3FH4A 5FVJA 3E0JB 2CXAA 3HSFA 2I79A 4ZDOA 3TEDA 2E1MB 2OC6A 3QU3A 4LG0B 4XLCA 4XRMA 2IS6A 1V3FA 3SGQI 1F4KA 1TZLA 3OL0A 1WGXA 2EV6A 4MY3A 1S5LC 2Y31A 3PNVA 3VEPA 4BDYA 4KVME 3S1NJ 2ABZA 2DXQA 2QLZA 4M9XA 1T2KA 4AMLA 1I12A 2CTBA 5EDNA 4MBUA 3M9AA 3VYSB 1O7LA 4EJOA 1ZARA 3WHBA 2VI6A 1POGA 3GLJA 1U9NA 1TP4A 5FUXA 4FE4A 3BTJA 3SJFA 4TV7A 2CV0A 1ULNA 3J7AY 2M34A 2RQPA 2L4MA 5LFAA 2VQYA 2NVUB 2P81A 2PMZN 3BJ6A 3IWWA 3GTKJ 5D6EA 3G1MA 3W6SA 1R43A 1OYWA 1ARMA 2E34A 2ZJ2A 1WFXA 3K4JA 2A6EF 1T6SA 5JFRA 1WPKA 5THWA 8CPAA 1DS2I 3GEZA 4LLNA 1VQMI 3FM5A 3TO6A 2E5NA 4XLEA 3MEKA 4KSFA 3HJEA 3LA2A 3CCJI 1TQPA 1AKHA 2FOKA 2A6TA 4RM2A 2MFZA 3OIOA 3OYKA 1VFCA 2GU2A 2WADA 5CPRB 2OTLI 1V5FA 1S20A 1WHUA 4XSXF 3CD6I 3HRUA 4B44A 4F92B 4OU0A 1MSFC 3R4KA 2DF5A 2UVOA 4W9YA 4DBQA 1IY5A 3HRMA 1YU6C 5GPCA 2DQRA 2GKVA 1ZK8A 2L01A 4XKCA 3HL2A 2VKVA 4XK4A 2DXIA 4P44A 2OR4A 5G21A 1S72I 4B43A 3I55I 4A3LJ 1M4GA 2CWHA 3R6SA 2HQRA 1TF8A 4A33A 3HOUJ 4UV9A 1XBUA 3ML6A 3CXQA 1OCOH 2OAZA 1Y0RA 3IC1A 4Y17A 1IN6A 1B1BA 2LOOA 2NVXJ 2JA8J 3SJMA 4CYQA 5LRGA 2ATRA 4HDUA 2LG4A 2FSRA 3E7LA 4MFKA 5BOXA 3CUQC 2JA2A 1F9NA 2Q2EA 3VWDA 1FC3A 1Y9KA 1P7IA 3I1UA 3RBUA 1XCVA 3I4NJ 1WGTA 2K86A 1QPIA 2D1HA 4R9MA 3RPUD 1NHAA 1C0WA 4F8ZA 5K5OA 1ELMP 4C7IA 3SXOA 3JCUC 2CH0A 1P9ZA 4H6ZA 3S93A 1D0ZA 4BXUA 4OMZA 1U5TB 1G2HA 2V77A 1TNSA 5C4XJ 3DGVA 3PO2J 3SDBA 4JBAA 1YW9A 1PYTB 1X2MA 3HC7A 1R49A 5F47A 4KVOE 4ZY0A 3CCVI 1Z05A 4R76A 5ISVA 3MRUA 1ZLJA 3ZMDA 4DQ2A 2AFUA 3H9JA 5H2FC 4OIRF 1Q2YA 4UHTA 4L18B 3VPRA 4UY8I 4UXNA 3H9QA 3HOXJ 3KIOA 2I3CA 4CGLA 1QSTA 5LRJA 5HLIA 2OZGA 3LSMA 4JX4A 1QA6A 1ETOA 1WJCA 3JRFA 1OCPA 5KNLA 1FARA 2EIKH 2R7VA 4RLFA 5E3PA 3IKVA 3KZZA 4MCQA 3SXNA 4NGNA 2MLKA 2RREA 1YJWI 3HRSA 3HKZN 2DCEA 4HPQA 3GMEA 3S32A 1ENHA 2QQ8A 4DIQA 1ZAOA 5EZGA 4A32A 4E1RA 2EINH 4CA0A 4YU9A 3QPHA 4FHTA 1F36A 3L1PA 4A69C 4B09A 2EZKA 2Q0OA 1WVRA 3JRIA 3G1OA 5CKTA 4A3CJ 2XEIA 2PJ0A 2E60A 2FE7A 3K2KA 3NH5A 2ZJPF 1LR8A 2HDWA 2K9SA 3Q0WA 4KITB 2DAOA 3KZIC 3IFEA 4NGPA 1HSJA 2M9HA 4A0YA 4M3FA 5KK1A 3OS2A 3CXLA 3KKWA 3KZWA 4U0VA 1CPXA 2BE5F 4FUUA 2DOFA 3MWMA 4IHYA 3JVNA 5B5EC 2NS7A 3WG7H 1TBNA 1I21A 3HM5A 4A12A 3C2BA 1ZLKA 4QSHA 3NRVA 3HIFA 3SEKC 4CGNA 4LG0A 3FHZA 3ABUA 2K3PA 4CCMA 2CO5A 4MHZA 2R7OA 3A1YA 4BE2A 2DMQA 5GCNA 1I3QJ 2FBHA 2XVCA 2R1IA 1ETQA 1N75A 2L5QA 2ZXIA 2BSWA 4HNTA 3QAYA 3IV5A 4GFBA 1E3HA 4L8AA 2DIPA 2ZEFA 3CUQA 2FNAA 3HG9A 5DAEA 3ZQFA 1ZQ3P 2KCXA 4FQGA 3UEJA 3ZQIA 1J4JA 2CNTA 2VLAA 3IGRA 2R7DA 3T8TA 2ROWA 3IIBA 4UF4A 3JAMZ 4MHNA 3FXUA 3FM3A 5FRNA 2Y0SA 2ZB9A 2FX0A 4I76A 4KICA 2VOOA 3D00A 2EZIA 4QLCU 1B6BA 4GM5A 1TXRA 1I1SA 2KMOA 2JN6A 5FD6A 2HWVA 4HF1A 1QSNA 2BY3A 3D2PA 2M8GX 1W4RA 1VGYA 2WWYA 1APLC 3MGDA 3IRRA 4IHWA 4LD5A 3BTLA 4BHCA 4XRSA 2ZXVA 3I58A 2Y0SN 2W1OA 5TISC 2PN6A 2HQ5A 3R60A 2HEOA 3TW7A 3FSXA 5EGOB 4CYCA 2HDDA 2J8MA 3TFYA 4AG9A 1T95A 4IJAA 3PGPA 1YREA 3CUQB 3RZAA 2XF5A 5JLWA 5IY5H 4OC4A 2BZTA 3R0AA 1D5YA 2REFA 3DPUA 1XFOA 2KDOA 5GAEJ 1FYKA 4BINA 3E1SA 2DB6A 3T0YA 1Y6IA 2YU9J 4BHBA 3JSPA 1M8BA 3WTXC 1KWMA 1YTYA 2J5OA 3W6KB 2VBQA 3G3SA 5G1ZA 5KTCA 1A04A 1R36A 2LFBA 4BBRJ 2QKLB 2LY9A 4BQOA 2OTJI 4BGDA 2B58A 5JHFA 4OC3A 1B8IB 3BPXA 2HI3A 4LQGA 1S7EA 3ECHA 5HNFA 2P5KA 2NU3I 3F21A 1I6HJ 4KOWA 2EUIA 3LA3A 1ZH5A 3WGIA 1IRXA 2LTPA 2UXXA 3RZDJ 2VT2A 3FBUA 3BQYA 5H6RA 4II2A 3IO1A 3WU2C 3SQNA 3LSHA 3W2VA 2ZBKA 2Z3YA 2VUMJ 3B73A 2PJBA 1Z6RA 3BROA 2ZFWA 2F2EA 3BI1A 3X2QH 3NE8A 1Y0UA 4JX5A 2O7OA 3JRAA 1DU0A 2CRGA 3TO7A 5E3OA 5GP9A 2CV1A 1KQ8A 1R79A 3KP4A 1RR7A 2M1BA 5DCMA 1XTAA 1MBEA 3N7ZA 2B3UA 4X0GA 1DQUA 2YU3A 1KA8A 4Z2YA 2R5ZB 1YK3A 4PJ0C 4CYDA 2VXZA 4NGRA 4PK4A 1O3SA 1GXQA 5LYFA 4DYCA 1V1HA 3D4UA 1RR8C 3FIWA 5LEKA 2FSWA 1Z21A 2NNNA 5JVTA 5C44J 4FKDA 2HOTA 4NQWA 2Z3MA 4FD6A 4UCMA 1RO5A 3WTUC 3OS0A 5DTDA 2B0LA 1R22A 4FETA 3JRUA 4C2YA 4DBRA 3CPXA 5LGNA 3L2CA 1ZR2A 2XB0X 1TIQA 3Q9VA 2M5XA 4BUPA 2P7VB 2XIGA 1OCTC 3C18A 1DTDA 2RN7A 5BQTA 5CVRA 5E17F 1BBYA 1NMTA 3SDGA 5LD2C 3HOVJ 2EK9A 4KOTA 4ZH4F 4CCNA 3FXKA 5EX3A 4JOMA 4U5YA 3K0LA 4MFDA 1E3PA 1LCPA 4I6ZA 1HBXG 4IF4A 2DFEA 3K2ZA 3K4NA 1G3SA 3IWGA 2G7UA 4I99C 3KHXA 1RESA 2E35A 4GGGA 1J5YA 2B5GB 1ETVA 3MZYA 4CAWA 1K7UA 4GXOA 4NQWB 1BW5A 3Q0VA 1VF9A 4EJVA 3OL3A 2COBA 5HH1A 5J3LA 1VQ5I 4MCRA 1YS7A 1R57A 2V8VA 1WH5A 3AFHA 4CYPA 4E0AA 1EJ9A 4A30A 1E17A 3C3WA 2XPVA 3BP8A 3P7NA 2E2HJ 3H8GA 1SVLA 3BLYA 1DGRM 3FK6A 3FX3A 4GDFA 3A2KA 4A3BJ 1A2ZA 4HQEA 4I0BA 2VJIA 3G4SI 1BC7C 2C6PA 2KMQA 5J1RA 5HVHA 1YW6A 1LFWA 3N97A 2PIZA 3KETA 1JKQC 1LANA 3S6HA 5EJCA 4LFUA 1YGHA 4D7NA 5KTAA 3WHCA 1LOKA 3KHZA 1BR4A 1R5HA 4I98B 4LIUA 4L9JA 2DPTA 4BJ6C 3J7ZI 2FS5A 2FJ1A 1BOAA 3DQVC 1W0TA 2M30A 4O6JA 5CJ9A 1X2NA 3MKLA 1K78B 3M3YJ 4P96A 4A5MA 4PUSA 1LPQA 4L5EA 1ZRDA 1YOVB 2WAFA 2LLKA 5ICCA 3HEFA 3D67A 3EXNA 5G22A 1SD5A 2A68F 5JM6A 3H3UA 3L2QA 2CU7A 2TCTA 2XRLA 3L2RA 2FMLA 2YS9A 2JA6J 2R7XA 4YIIA 1XMTA 4O23A 3PZJA 4PQAA 1N13A 4HZFA 3CJTB 2KMPA 2F5CA 3ZQQA 5HI7A 2K5CA 1CM0A 4G7ZF 3DLAA 5CLSA 5I0CA 5KVRA 2EO8A 3K70D 3M1CA 2BY2A 4M3EA 1FYLA 3ISPA 5E1XA 1QU3A 1UG2A 3WTZA 4XKWA 4J3GA 2IJLA 4M6IA 2XEGA 3R1KA 1M4DA 3OR2C 5J40A 1U5KA 1FJLA 2BY0A 1YLOA 2OD5A 3FISA 3GFIA 5IT9Z 3ECOA 1TKFA 5CNPA 3E6MA 1Y1BA 1GVDA 3PBEA 3TBIA 4BJTA 1ERDA 1CT0I 2R3SA 3O8GA 4PJJA 4F93B 1CG2A 3NWTA 4UEZA 3VFZA 4YFNF 4B10A 1BR1A 2YGWA 1XD7A 3SEQA 1R23A 4I01A 2R98A 2V1NA 3VDXA 5CQEA 5E8GA 1MMSA 3FVLA 4XLHA 1GLNA 3GFJA 1MH4A 3WGGA 4NNJA 5HDNA 2I00A 5K7FA 3KR5A 4FX4A 4MCPA 3K4LA 4LQ6A 5F48A 2HPIA 2BBYA 3RI4A 1TOTA 4CAEA 3DR8A 1TWFJ 3QOPA 1OCZH 5D5WB 3FJUA 5D29A 2X0LA 2ZOGA 3GW2A 4L5IA 1EH8A 4AYBA 2PJ1A 2K3FA 2CYYA 5FB2A 2R93J 4G6TB 1FLIA 3OIPA 2AFOA 1VHSA 1HQCA 4N9HA 1L3LA 3FIXA 3GZ6A 4BDZA 3FRMA 4PXCA 1A35A 2LB7A 3K10A 4W97A 1JGSA 5C4JJ 4IUSA 4BNCA 1HDQA 3HGGA 3GTOJ 3B3CA 2K9NA 2B4DA 5HLTA 5EBVA 2LC2A 4M6GA 2POKA 1QHGA 4PGHA 1RUOA 2LREA 4KYWA 2A5YB 2ORWA 2HU9A 3OOPA 2WPXA 5FFZA 5BWAB 2MD5A 5FUWA 1FIAA 4R3KA 3J81K 2YX4A 4XNHC 1Y8QB 2R8VA 1OQYA 1S7KA 4LB6B 2FXAA 3BLNA 1SANA 1IY7A 3GCMA 3TT2A 5JLXA 2FQ4A 1MBGA 1TW2A 1AUGA 1VZ0A 3PFEA 4Z6YA 4HNUA 4A3EJ 4P45A 4NUBA 1RC9A 3M7GA 2WY8Q 3KYLA 3BR3A 2NRAC 2H09A 2FEZA 4PSXA 1N25A 2ARHA 3AG4H 2WB1A 3FX6A 3MZHA 4AVBA 5TJJA 3NE7A 1TWGJ 2PJ7A 1SD7A 1QNTA 2F5VA 1WH7A 1BAVA 2D4PA 3E5XA 3HXLA 2XAFA 4IO9F 3IH3A 4KN4X 3E59A 1FOYA 4B8XA 3F6VA 1I1GA 4LB5A 1NK2P 3GTGJ 1WJEA 3I4MJ 1T8IA 1AWCA 1FT9A 3CP8A 3CMMA 2PDOA 4OC2A 1U9OA 3KLOA 1Y1WJ 3P9CA 3HHGA 1BLLE 2ZMEA 3CXSA 3D7HA 1I6XA 5IOYA 2Z10A 2XC7A 3BZ6A 1FMVA 1P4WA 1AKHB 4LMYA 4MHDA 3CDHA 3DBHB 3SZGA 1YMEA 1PPFI 2GANA 2OVOA 7CPAA 1CGII 3PP9A 1SGEI 3BTIA 2XGXA 3FXQA 2WSAA 4PFOA 3F8MA 4MRIA 4J00A 2A6HF 4RB2C 3S1MJ 2EBIA 2HKXA 1H0ZA 2A3SA 3JRBA 2R5YA 2EZHA 3S15J 3GTMJ 2H8WA 4IOAF 1D1CA 1R5GA 2DJIA 2R7FA 2X9DA 2B4DB 2ICWG 2VASA 1HDUA 1FNNA 3OYDA 2Z3NA 3V38A 2BUSA 2CIJA 4UFXA 1Y7RA 3TE4A 2W4SA 2BOLA 2HVQA 3K4KA 3SZPA 2G3AA 2W0TA 4L9TA 2OF7A 1LFPA 1S7FA 4KLVA 2B7EA 4HKFA 5LYDA 3R0JA 2HQNA 5JVGF 3PDNA 1HEEA 1PU9A 1USSA 3QQAA 3E6CC 1ITYA 2Q2EB 3GTJJ 3UEYA 3PB4X 3JR9A 4IHVA 2KCWA 2F5DA 5C3EJ 4YFXF 4A38A 1TW3A 2CW7A 3NQOA 1XOVA 2ZKZA 3BPVA 2RC4A 2GE3A 4M73A 2EIJH 2OH1A 3LACA 1OR7C 3C1DA 3LSGA 4F91B 2ENZA 2HPMA 2MGQA 3BJOA 1Y1CA 3HLPA 3MCZA 4OIWA 3H1CA 3VOEA 1ZLHA 2F5FA 1WI3A 3C7JA 3E2IA 3HTSB 3CCYA 4E8OA 1KU2A 2K02A 2ZCWA 3JW4A 1IV8A 4RB1A 1R5ID 1YJ9I 2GXBA 2VB6A 4OAZA 4HRIA 1K4TA 2ARPF 4UFVA 4CS0B 2ZXJA 1X1AA 3BTCA 3U21A 3AL0B 1PDNC 2ZEMA 4GCVA 4AB7A 1G3TA 2HFHA 3WGHA 4QUSA 3SI1A 1SGYI 1LRZA 1KUYA 1S3ZA 4AVPA 2HQYA 2HR3A 1X4OA 4PK3A 2BVLA 1JUPA 4NGSA 1FY7A 1U5TC 1B9MA 2XV4S 1WKMA 4CRYB 2OA4A 3GLLA 2XF6A 2WCYA 3FF3A 4MCSA 4B47A 1KQ0A 1BC8C 1VIXA 1PUFA 3GLXA 2V9VA 4M9ZA 5FROA 1TLHB 4IHMA 2P6TA 1IW4A 4YELA 3HYIA 3VSLA 4CZCA 3BJAA 4OMYA 3GTLJ 1FYBA 1B87A 2ISZA 1VTNC 1BPNA 1MDMA 1BI0A 2XDVA 1R00A 4EVIA 4XNFA 2REEA 2WAQA 4U0YA 4C2ZA 4HX7A 6PAXA 2DA2A 2WVJA 5IX3A 2DJNA 2Z99A 4A6DA 3FZVA 4J19A 3BJIA 4HNWB 4QVTA 1A5JA 5L3GA 2DDAA 1JE8A 1Z4RA 2FRHA 5L3DA 2CS3A 1T08B 4BU2A 1YG2A 4MIMA 5E18F 3ASOH 1JJ6C 1LFUP 1Z91A 3RKXA 3RQ4A 3V42A 4AIDA 5FLXZ 3BG6A 3LA7A 5DDGA 1J09A 3PIOF 4HW0A 3TGNA 2HDCA 3NH4A 2JUGA 3CPAA 4B48A 1W5CC 3SEZA 4RB3C 4EJWA 2L9NA 2V6CA 2KISA 3IAM2 5EF6A 1YIJI 1X12A 2ZEPA 1X3UA 4MI4A 3LAPA 4CGZA 5EEGA 2VC0A 2R4GA 1W7PA 2CNMA 2XF7A 2L3DA 2NYQA 1MGTA 1O3RA 1XEBA 1I1DA 1HC8A 3B4VC 1MMDA 3U1KA 2KT0A 2GXGA 2MYSA 3LSKA 2G9DA 4ZY1A 4PXEA 1BIAA 2EFNA 5EX0A 2OZUA 3RO0A 2HXOA 2LY2A 2ZSIB 5LRRA 4BEHB 1CGJI 1FTTA 4ZYDA 2FOWA 2DMPA 2UV1A 3GFLA 2FNFX 3ZJ0A 5IP6A 5JHUA 1DDNA 3K1PA 4BBHA 4JYKA 4CAXA 4BE0A 2JA7J 2CWGA 3S3OA 4AVAA 1FSEA 2JVHA 2G0BA 2YNCA 3QP6A 1P4XA 2QBYB 5E3QA 4XSZF 4PFPA 1IXRC 2ZW6A 2O5RA 2ZW5A 4FWUA 1W7PB 2ZSHB 1X1BA 4MY0A 2LKXA 3HB9A 2QCOA 3HOYJ 4FD5A 4E7JA 1ULYA 2VEZA 3CCEI 1LQ1A 1PTRA 2LNBA 1ZG7A 2SGFI 2DMNA 2CUEA 2E71A 4MTDA 4II9A 2A07F 1BPMA 2R7UA 1MJBA 3W2AA 1F2PA 4MHYA 2VKDA 1KMAA 3H5NA 2IGMA 3ONQA 1P4AA 4HX4A 2M4GA 2V1CA 3CMAI 4YFJA 4HF0A 2L7MP 3S8PA 3T8RA 3GY9A 4PJLA 4OINF 2PJ9A 1IRFA 5HLGA 3IKTA 1DP7P 1TBQR 1TKHA 3TC8A 2DPSA 4A24A 1IJWC 4U7DA 4IPAA 2BO9A 1AN1I 4IQ4A 3IC7A 3IP4B 3UGIA 1S5KA 2P6FA 4YRVA 3AKZA 4CGMA 4E7LA 3VODA 1R1UA 2K9MA 1GYTA 3PB9X 4Y49B 4BACA 3VARA 1NG6A 4OAYA 1Y8RB 1BOBA 1OLTA 2DN0A 2LMDA 1BIBA 3FXJA 5ICEA 3J80Z 2DODA 1G3WA 1OBRA 3IU2A 4L9NA 1A36A 3C26A 3FC3A 2W84A 4ENKA 4CDGA 2BW3B 2GM4A 5GAGJ 2B9SA 1VQ6I 1TURA 4HOBA 4KOUA 2M7AA 4V19K 3CJQB 2QSHX 1R0RI 1K4JA 2UUZA 3TDZC 2BXYA 2WV1A 1ZG9A 4MFLA 2DFFA 3F72A 1NE9A 5AG6A 3PO3J 4P4FA 2HTJA 3B6CA 1OKRA 3DKWA 5K5QA 3A03A 1YO5C 3EDPA 2PIYA 2QYVA
chains in the Genus database with same CATH topology
2E1NA 5LHHA 5FO5A 3R9GA 1ZRCA 3ULQB 4F6AA 5FGMA 4ESBA 3HUGA 3GXOA 4UV8A 2HOEA 2ZW4A 4KLWA 4EGYA 1S3JA 1YLEA 3DNSA 5HDKA 3GFMA 2A61A 3PQKA 4BAYA 2DBBA 5CVVA 5L3EA 1O3TA 4U0WA 3F22A 1FOKA 3M8FA 1ON2A 2OQRA 4JXRA 3S6GA 2ZNYA 3L00A 3QAHA 3J80K 3O2PE 5L3BA 4XPKA 3M8EA 1K7AA 1YLFA 3FMQA 5DD4A 1K6OA 1BI3A 4KOYA 3H4QA 5CVUA 2M5WA 5AG7A 4B14A 3GWZA 2FMYA 4Q48A 3MAJA 2P0WA 4A0XA 1UFHA 2JEVA 3BJ7A 1P2FA 1OYIA 1M44A 3I9SA 3G3ZA 1HW1A 1RZ4A 2ACJA 4P55A 3E6BA 3D8PA 1V4RA 2CFXA 3H3ZA 4A5NA 2VBXA 2PI0A 1XMAA 2XAQA 3HRTA 1LEBA 2PSWA 3L7WA 4NXYA 3F3XA 3J7AO 1TNTA 1YVOA 2IW5A 1IXCA 2E7WA 4BYYA 1UB9A 1TQIA 5LGUA 4FD4A 1QQIA 1IXSB 4CICA 5HS9A 3I0TA 4RGRA 1SFUA 3TOBA 5HS8A 2JDDA 4D0PA 4R8HA 1CF7B 1GHEA 4CYOA 3MFKA 4WXCA 4KIFA 3V8KA 1U8RA 4KN7X 3F0AA 4CYNA 1YW7A 1XDSA 4KIGA 2WC2A 3E97A 2FIWA 2PFBA 1DPUA 3PFIA 3CJNA 3R61A 2O03A 1GXPA 2JT1A 2ZW7A 3I71A 4A31A 1F5TA 2STTA 2ZNZA 3JTGA 1Z4EA 1ZO0A 4KSAA 5JI6A 3TKYA 2JPCA 4AVCA 1L0OC 4G8XA 3D5LA 1M1DA 3LSTA 3UY5A 1OR7A 2C6YA 3LQQA 1VKCA 4R3LA 2O6GE 4XNHB 4UVCA 4UNOA 2XASA 1IAWA 1ODDA 5D8KB 5AG4A 2C27A 5ICFA 1SAXA 3CUOA 4QWQA 2EFWA 3RJPA 4ETSA 3KP7A 4LGWA 4H0EA 4B11A 3VWEA 4JLYA 2O61A 3FMSA 5D4SA 2OZHA 3IRQA 1I27A 4RGUA 1RNLA 1R7JA 2Y75A 1R1TA 5BMZA 3FWEA 2EB7A 2HTSA 2EFPA 1IZ1A 2XKPA 4XLPF 4B5PB 3E3VA 3F8BA 4PGGA 2BGCA 2D2WA 2IA1A 2QZ8A 2G9WA 1N71A 2G7HA 5AONA 2HKOA 2W25A 3GO5A 2RNJA 3EYYA 1QZZA 5C82A 3EYIA 3WR7A 1Q1HA 5F64A 3MQ0A 3H92A 4MQ9F 3SZTA 2CW0F 1PUAA 2ESHA 2HGCA 2Z3OA 4KOXA 4WXHA