2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
b'RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
5KTAA 2QQ9A 4KT5C 3J80K 1FBUA 3WTUC 2HOEA 2CNMA 4BH9A 3AAFA 1ZRFA 3HRSA 1K78A 1E2XA 2Q4YA 4EJTA 2H5MA 2W84A 5FLXK 4GYIA 3QRFF 4NEXA 4CYDA 2KKOA 4A6EA 2EFWA 1XEBA 4HX4A 5CVUA 1KUYA 2COMA 4MQ9F 5DD8A 2H94A 5F47A 4G7OF 4IRIA 2QLZA 1YO5C 1LDKB 4BQAA 3EYIA 4JXQA 2QENA 5HS8A 3B8GA 3I59A 3QB8A 3BDDA 3I3GA 4KOTA 2B5GA 4MNUA 1TTYA 2FE7A 4MY0A 3KZZA 4M6YA 3FF5A 2FF4A 2ZBKA 3BP8A 4M71A 4CGZA 1Z6TA 4HNXB 5BPDA 3SXNA 4ZYHA 1QO0D 4G7ZF 5CVRA 4LG0B 1O57A 4UVCA 1FC3A 4IF4A 3EC4A 2ZO4A 2FNAA 3GWZA 2Q04A 2VN2A 3R0JA 3EQLF 2MH9A 2CWEA 4GS4A 2BEIA 4R87A 1V3FA 2VC0A 4AVCA 1RNLA 2CO5A 1R23A 3BZ6A 4KN7X 2VEZA 1SQHA 4WWCA 4YFNF 3ECOA 3P9CA 2QZ8A 1P6RA 3E6BA 5F64A 3BY6A 3O3KA 3V8LA 1UFMA 1Q2CA 2LSOA 4L9TA 5ERIA 2GZWA 1I27A 1FOKA 4CRYB 4EJOA 1J9IA 5K1YA 3CXPA 4XNHB 2KIFA 1BC8C 5D8LB 2QUFA 2EA4A 1U6GA 2M30A 3P9KA 4KVME 1XDSA 2R98A 4UWIA 1KA8A 4YGOA 4A0YA 3IL2A 5KK1A 2WWYA 5D5VB 4A6DA 4L18B 2XKOA 1DP7P 3WTXC 3FHZA 2NRAC 3MCZA 1F9NA 1Z9CA 5DWNA 2HZTA 1KYWA 3K1NA 1OPCA 2Y0MA 1S7NA 3QAHA 1R57A 1TLHB 2Z5UA 3JUWA 2KJBA 2A61A 3K9UA 1K7AA 4WXCA 5HLGA 5K5OA 3GFLA 2BL1A 4G6QA 2I79A 4ENKA 2VQYA 4UWJA 3NRVA 1J2XA 2MBFA 4HLYA 5H6RA 2OU2A 1Q2DA 1N71A 3GEZA 5BS6A 5J6XA 2OB0A 1IYLA 3R9FA 2J8MA 1Z4EA 4OIPF 2EUIA 4JWPA 4QLCU 1U5TB 2O6GE 2H09A 1IRFA 2HTJA 4KLWA 3NQOA 4MEXF 3ZP5A 2DTRA 4ESJA 1YS7A 2FXFA 4WF2A 2PI0A 3FWEA 4IVNA 4L89A 5KVRA 3HTUA 4EV0A 4YFJA 4M9ZA 4AIHA 2JTVA 3W6JB 5EEHA 4ENJA 5LGNA 1UFHA 3EDPA 2ACJA 4I49A 1R1VA 3L9FA 3ECHA 3QP5A 1YW9A 1J59A 2G7HA 2P5VA 2VBQA 3FIXA 2BV6A 3L7WA 2VI7A 2OAZA 4Q5SF 4RB2C 2XAJA 3TE4A 5LBQA 5FD6A 3T8TA 4NB5A 2A4NA 3HOSA 2Z33A 2VE8A 4XPDB 1IICA 1QSNA 1OYYA 3GVAA 1S7AA 3I64A 4YFXF 1HW5A 4EJUA 1B59A 3BJ7A 1R1UA 3WTVC 4Y49C 2F5CA 3BJ8A 1LNWA 1G3YA 3OOPA 1KU2A 4K2EA 2EV5A 1C0WA 2STTA 1R58A 3VWEA 1HKTA 3K69A 4U0WA 4I7HA 4UA3A 3MZHA 2EA2A 2HYGD 3GYAA 3GFJA 5DCMA 1KZFA 4KA4A 1XSXA 3GX4X 1HKQA 4EMSA 1J0RA 3SQNA 5F48A 1PUEE 2R7HA 5ED4A 2QIRA 3H92A 1H9TA 1OYWA 4ZYDA 1IXSB 3P2FA 1ZARA 2ISZA 3F6OA 2XVCA 2M1BA 3GY9A 5EC4A 3JAMZ 4GYGA 5IT9Z 2Y48A 3RJPA 4IHTA 3U1DA 1EH6A 3KFWX 4CDGA 1TIQA 5C82A 4QC6A 3DP7A 2J5OA 3DR8A 2XRNA 2FMYA 3E5UA 4EGZA 2QWWA 4R1HA 4RAYA 2VOOA 5CVJA 4O3MA 3JAMK 3DEUA 4MEYF 5IT9K 2JT1A 4KOVA 1E17A 4NSQA 3DNSA 3BLNA 2AS5F 2NS0A 2HYFA 1O7FA 1XN7A 3TO9A 3DR6A 2JZYA 2XAGA 2ZMEA 3WTSC 1RI7A 3WTYC 4OMZA 3L09A 1FBQA 1QQIA 2OBPA 3U9GA 2MD5A 3I5UA 2FMLA 5HS7A 2QVOA 4B8XA 3RYOA 4U9ZA 1XMKA 1FZPB 4KOSA 4NF1A 2R1IA 2UWMA 3R1KA 2RNJA 4M85A 2HQYA 1K4JA 3LQQA 4DNCA 2CNTA 3VODA 3VEPA 2OZHA 3HRTA 1OR7A 5K5QA 2HQRA 3N7ZA 3IC7A 4BHPA 4B09A 2RV8A 1ZRCA 1MD0A 5EBVA 3D8PA 5IB0A 2B4DA 1YREA 1YYVA 3I71A 1MJ9A 3S6HA 1B9NA 3W6KB 1FYMA 3EO4A 4LG0A 2F5FA 5HH1A 5BMZA 2F5DA 3WTWC 1YIOA 1IN4A 2Z10A 1RUNA 2V1XA 4MTDA 3S6KA 3F6VA 2Q0YA 3RYPA 2W24A 4U0YA 3FXUA 2IRFG 2VT2A 4XSXF 1R5HA 4ZZLA 1P4NA 4EM2A 1BC7C 4NQWA 4IPAA 1M1DA 4L8AA 1FBSA 4LK0F 2Z11A 2LDUA 5D5WB 3ZMUA 4JXRA 2A6EF 3CJNA 1XGNA 1S29A 2ZCWA 1FPQA 5LEJA 2QECA 4U88A 5ILUA 1S8NA 4OOIA 3WE2A 4O6JA 4ONUA 5ICEA 1Y9WA 3TO7A 2ZW5A 1W5TA 4R3KA 5H6QA 5L3BA 4U0VA 1LEBA 1A04A 2DU9A 1XCBA 2LF7A 5L3FA 4HDVA 4HDUA 4HF0A 3CO6C 3VWDA 4HNWB 1KYZA 3E6MA 3COAC 2J5PA 1OKRA 4JK1X 2MC3A 5A2QZ 4LMYA 2UXNA 3S6GA 4U9YA 4ESBA 5JPHA 4E70A 3SHPA 2HS5A 1XD7A 2JPCA 4UV8A 1FP2A 2OZGA 3LSTA 1HSTA 2G7UA 4JJXA 5DWMA 1Z6RA 1I1SA 5LRSA 3IRQA 5A2QK 1XMTA 4FX0A 1ZYRF 2CSOA 3V7SA 3R96A 2XROA 2HUZA 2P6GA 3C18A 3BWGA 3LWFA 1I21A 3CTAA 4HYEA 2G0BA 5EEGA 1YW8A 2P5LC 4JLYA 4LFUA 4EJVA 4R3LA 4PDKA 4AVPA 3J80Z 3F8NA 2YU3A 1Z7UA 4OIRF 3NEUA 2PDOA 3V4GA 2NAZA 5CNPA 2QYOA 2XIGA 5D8KB 2FQ3A 3I9SA 1NHAA 2FBIA 4F7ZA 4M73A 5KTCA 3FMRA 3CUOA 4CS0B 1T98A 4MI4A 2FSRA 4L0YB 1ZH5A 3ZJ0A 3WTTC 2ADUA 2GA1A 1O7LA 2VXKA 2JEVA 1BOBA 2M8EA 1QSMA 1V0CA 1U5TA 1VHSA 4RB3C 2EFOA 4ZYEA 4HF2A 2PN6A 1IN8A 5CLSA 4A2UA 3C1DA 2VONA 1RXTA 1WWXA 4WXHA 2V1UA 3DDDA 5HVQC 2Q8KA 2JRTA 2B3UA 3TO6A 4HLXA 3KP6A 1O3SA 3S2WA 1HXDA 3ABTA 4FHTA 4IRGA 5D6EA 2ZW7A 2NMTA 1GXPA 4OU0A 3CUQC 5DUIA 3E3VA 5BQTA 2B4DB 2FXAA 2IJLA 3I0TA 3RPQA 2DPDA 3TCVA 4E2AA 1YGHA 5D5UB 4QB9A 2B0LA 2A68F 4I2OA 1YQAA 2ZXJA 4M9SA 1RUOA 4PCQA 3F21A 3E5QA 5LRRA 4CAVA 1QSRA 3ZMTA 3M8FA 5DV5A 3E6DA 4Q4ZF 4IRHA 4RS2A 4D0PA 3LQRA 1OZPA 3UY5A 3IHUA 3L2CA 1XB4A 2FCKA 3NE7A 2FEZA 1DPRA 5LHIA 1BO4A 1KGSA 3TFYA 5HLHA 1BN5A 3WU0A 2ATRA 4HX8A 4M9XA 4WCGA 3EYYA 2UZKA 4HW0A 3H3UA 3HHHA 4M74A 4PK2A 3PFIA 4MJ8A 1B6AA 5DUKA 3R0AA 1VTNC 1K6OA 4LUAA 2L54A 5DD4A 5HLIA 1P0HA 2ZNZA 2P6TA 1R1TA 1UCRA 5J8CA 4PGHA 4G6DA 5HS9A 3KLNA 4YIFA 3G73A 3QPHA 1ZG1A 3WGHA 2Z99A 2P0WA 2M87A 2KIMA 4WXDA 4HQEA 3F23A 3VB2A 3T0YA 2YPRA 3F8KA 4ENNA 1FT9A 2ZJ2A 4I09A 4KOXA 3LA3A 1BIAA 1R5GA 1B1BA 4S05A 2L01A 3WE3A 5FD5A 3Q5FA 3SZPA 2P5KA 1WSUA 3EETA 2OQRA 4N0BA 1FSEA 3W6SA 5AIPA 1SD4A 1KQ9A 2Q44A 5J8FA 1H0MA 4OLLA 5IX3A 3ZPLA 1R00A 3TOBA 1TQIA 3DPTA 4G8XA 2A6HF 2G3AA 4AG7A 5HDNA 4QUSA 1IIDA 3F8BA 5E20A 5AONA 4TV7A 4II9A 3W91A 4LJZF 2XKPA 3S6FA 3M9AA 2IVMA 3GYHX 2WPWA 5CVIA 1HQCA 4ETSA 3RTRA 2XHKA 2DBBA 1P92A 2VT3A 1DDNA 1W7PD 1XF8A 5F6FA 4OADA 1NMTA 1P4WA 4IUSA 2EV0A 3GKRA 5JR3A 2WPXA 4HV6A 5TRDA 4RGXA 5JHUA 3GO5A 3WG9A 5F1RA 1QGPA 4BXUA 5H84A 3ZMDA 3HSFA 2HV2A 3MWMA 3ULQB 5ILSA 2B4BA 4YRHA 1J75A 4Y49B 3V8IA 3F72A 1Z4RA 1RZ4A 2E7XA 4KNYA 2ETHA 2RDPA 1G4DA 5L3GA 1F5TA 4JQFA 4KIBA 2JLMA 2YSRA 2CG4A 2O28A 1Y0UA 2FNPA 2CQKA 5D5XB 4ENMA 1Z1DA 3TKYA 2W57A 2L4AA 3MAJA 1GHCA 2FIAA 4G7HF 3K0LA 1GXQA 3FX3A 3ROUA 5FFXA 5K5RA 3HOTA 1IN7A 2K27A 1B9MA 3SFZA 1LQ1A 2A5YB 2DW4A 1XGOA 3IWGA 3FZVA 3ZZIA 1TQMA 1USTA 2O8XA 1O3QA 5HDGA 5CYVA 2KIUA 3IWZA 4ASNA 3KKWA 4IJAA 3KEQA 1H9GA 1LDDA 3BOQA 5KTDA 3GFIA 2LNBA 2D4PA 3QU3A 3IKVA 4FD4A 3GFMA 1HKSA 4R9MA 2P6EA 2LF8A 3WGIA 5H86A 1LVAA 3HRMA 1EV7A 3C26A 2CGPA 3HTSB 1LB2A 1SAXA 1OMIA 1U5TC 4ZZDA 4LGWA 2DI3A 2R3SA 2X4HA 2Z0ZA 4CICA 1W7PB 3P7NA 2D4OA 2KCWA 4PSXA 3GXOA 1TBXA 3DKWA 1P4AA 1T38A 4KIGA 4Q48A 5CJ9A 3QPTA 3LAJA 1P4XA 3R95A 4A5MA 2VE9A 1T2KA 4BYYA 1ZHFA 1YFHA 3CDHA 1CF7B 2QM3A 3E5XA 4GXOA 4HAMA 2WC2A 5E96A 4L9JA 3T5XA 2HDCA 4EM1A 4M6XA 1WQ2A 4KVOE 5JI6A 1O3TA 4KIFA 2HKXA 1SFUA 3R9GA 4EVYA 2DK5A 1D5VA 5JFRA 1R7JA 4XPDC 1ON0A 4MQVA 2DQRA 1JHHA 2O03A 4O5VA 2FS5A 1IXCA 2PFBA 2AJ6A 2HR3A 4HZFA 2BBYA 3VOEA 2K86A 4XLPF 1MGTA 2CNSA 3QOPA 3BJAA 1QNTA 1I1GA 1HBXG 3F8CA 3KEOA 2R8VA 1EH7A 4KUAA 3LA2A 4RB1A 3G3SA 1XMAA 3RDIA 2K4JA 5ISVA 4AB7A 1Q1HA 4I0AA 3FNCA 3RIRA 2K7LA 3ZMZA 1BBYA 3PGPA 3DV8A 1XE4A 1Y7RA 1O3RA 5FB2A 2JDDA 1ODDA 3BROA 2GAUA 2WV0A 1S3ZA 1QSOA 2HQNA 3T90A 4KN4X 2VBYA 1KQ8A 2R7FA 1FSHA 2K5TA 2EFQA 5D4RA 3E97A 2VODA 2Q7BA 4HBLA 2IA2A 3EY5A 3H4QA 4B5PB 5E1WA 4HNYB 4RS8A 2XAHA 1XSVA 2E1NA 2V1DA 3RYRA 3CXQA 3FBUA 2A3SA 3DF8A 4Z2YA 1G3SA 4KZTA 4KVXA 2DAOA 1F1ZA 3TT2A 4CO8A 2ISYA 2PG4A 1AOYA 1KUXA 5FVJA 4BNCA 5ILVA 4QVTA 2W85A 3MFKA 2QMLA 3HIFA 2MA3A 4GGGA 4I0BA 4B5OA 2GWRA 4KICA 3H3ZA 3CXSA 3KE2A 1Y9KA 4M72A 3WGGA 4BHBA 2HKOA 2H27A 3G3ZA 4P9UA 5F46A 5L3EA 5LLQA 2EJRA 5D4SA 4E8OA 3K9TA 3HHGA 1Z05A 4U5YA 3RKXA 2ZKZA 3I4PA 1I1DA 1S7LA 3V7RA 4OIQF 1B6BA 4XPKA 1T6SA 1CJWA 1ZN2A 2VBZA 4MGRA 3TDZC 3Q9SA 2KRFA 3ERED 1S6LA 1DPUA 2FIWA 2MH2A 3HSEA 2GANA 3SHFA 5H20A 4WX9A 4G94A 4P96A 1L0CA 4P55A 4U7BA 4ON0A 2ZW4A 2RN7A 2PLYA 2P6FA 1FYKA 3EFAA 3SXOA 1ZREA 2BEOA 1JE8A 1W5SA 4N9IA 4XRFA 1BM9A 1SFEA 1U2WA 5JVTA 2BSWA 2P7VB 3RKYA 5HOOA 4HV5A 2FSWA 2A07F 4KDPA 2PBIA 1ULYA 1LRZA 1KUVA 1R22A 4KFCA 1D8JA 1FWZA 1BOAA 1S3JA 2RVCA 3D2PA 2O3FA 3PP9A 2GA2A 3CUQB 2VXZA 1NE9A 1SD6A 3ZN1A 2ZW6A 3FM3A 3K1MA 4UBRA 4LLGF 4PZJA 1JHFA 2NYXA 1IB1E 3IGRA 5LGTA 4Q47A 3KCCA 1U8RA 1TW2A 2VOPA 3J81Z 3JVNA 1I5ZA 2X0LA 2FBKA 1MDMB 4A0XA 1GVJA 4HX7A 2OQGA 3KLOA 3DFGA 1J7KA 1RO5A 3JSPA 4GCVA 3BPVA 1I6XA 1SFXA 1F4KA 3G8WA 4YG2F 2PEXA 3J7AO 2M5WA 4RGRA 1L0OC 4FX4A 1ZAOA 1TW3A 5JQ4A 4KORA 1U3EM 2OZUA 4G9YA 1XSDA 3J81K 1J5YA 5BOXA 1G3TA 4M3SA 2XAFA 4KUBA 5F49A 1MJBA 4A5NA 3WU1B 1IUYA 1IN5A 3WODF 3DXJF 5DCFA 3KP2A 4I02A 2NNYA 3K2ZA 4BAYA 5DYMA 5ICGA 3WTZA 1D3YA 5L3CA 2RKHA 4OAEA 2EV6A 2FU4A 6PAXA 3BJ6A 4LLLA 3T9YA 4CZZA 4CHUA 2ZNYA 1YW7A 2I00A 1K79A 1REPC 3T8RA 3JW4A 4HOBA 2VBWA 1QBJA 1M44A 4LK1F 1FY7A 3LFKA 1IZ1A 2CYYA 2Y75A 5FO5A 5BPIA 2Z9OA 4BHCA 4IHSA 2YX4A 1MZBA 3T1BA 2DT5A 3F0AA 2B58A 4ZYGA 1ZG5A 4KLVA 2FOKA 4Y13A 4X5KA 1EH8A 1CGPA 1W7PA 1QSTA 3KZYA 4UVAA 3P9IA 2FT0A 1P2FA 2IT0A 3FMQA 2EWNA 1YK3A 3V8KA 4QWQA 2DFIA 4XBFA 2XUBA 2GXBA 3K1PA 2G9WA 1CF7A 4UNOA 3FXTA 5E8IA 3F3XA 1KU3A 1R36A 2GQQA 4RGUA 2XASA 1JXSA 1D8KA 2V9VA 2PJPA 4YIIA 3L00A 2B3VA 2C6YA 4FD7A 4ESFA 4L5JA 2TDXA 4MTEA 4EGYA 2QBYA 1ZGJA 4R79A 3PZJA 4OINF 1HW2A 4KYWA 3OWCA 2K02A 3KP4A 3IKTA 2DXQA 3CLOA 3ZMSA 1QZZA 4XPLA 4ZBGA 1LDJA 3SXYA 4LB5A 4EM0B 1V4RA 3KP5A 3TOAA 4CRZB 3I53A 3R4KA 3ML6A 3C7JA 4JD6A 3HRUA 2CW0F 3ZN0A 1YVOA 1XGSA 2GE3A 3MEXA 1TQPA 2KJCA 2P8TA 1FYLA 2MLKA 2VBXA 1WWZA 5FFZA 2K4BA 2RQPA 4H0EA 1TNSA 1IW7F 4XNHC 4XSZF 4LB6B 1YS6A 2QQBA 2O0YA 1YX0A 4PGGA 2HFHA 3LAPA 3JTGA 2JSCA 2C27A 4PV6A 1M4DA 5AIQA 4L9VA 1YR0A 2W25A 2EFPA 3LA7A 2G3TA 1ONVA 2ESHA 4H6ZA 2ZFWA 4B5PA 3IRRA 1BI0A 4AIJA 1FLIA 2CY2A 1QPMA 2LKPA 2DK8A 3GZ5A 4UUVA 4YFKF 1CM0A 3TTHA 1M4GA 1IXRC 2GIVA 3OV8A 4RGSA 4OMYA 1BIBA 3REOA 2BGCA 3HUGA 1K78B 3ISPA 1YLFA 2FE3A 5HMNA 5ICFA 2IW5A 4PSWA 3V7CA 3D2MA 3VFZA 2DO7A 1STZA 1XIXA 3ZQ7A 1J4JA 4H89A 3P2HA 2FRHA 2PMHA 2FL4A 2IA1A 3IWFA 1LEAA 2EB7A 5IT3A 1SMYF 1ZG3A 3I59B 2F5IA 1AWCA 2CFXA 2PR1A 4FD5A 3R60A 3ELKA 1S60A 1MKMA 4WK8F 1YTYA 1I12A 2REEA 2B5GB 4K30A 3HSRA 4L9NA 1Z9UA 4P5OA 4HA8A 2XV4S 1NSLA 1KU7A 2BYVE 2PQ8A 1WI9A 2M45A 4ZH4F 5LGUA 4A12A 5E17F 2GXGA 3FM5A 2ZPAA 2IP2A 3QP6A 2PMUA 3FXQA 5E1XA 3M7GA 2P7CB 2IPQX 1YG2A 2P4WA 3R9EA 1IYKA 4Y15A 2PR8A 4RB0A 3GUDA 2YR2A 3HYIA 3D5LA 2V6CA 2EFNA 4AVBA 1M4IA 2XAQA 1XCVA 2E7WA 2V79A 1B87A 5E8GA 2QQAA 1TNTA 1BJAA 2JPBA 1MK4A 3KETA 1ZLJA 3O6BB 4NCZA 4LD5A 3FB3A 1ZGAA 4MHGA 4JBAA 3ZMVA 2NNNA 4IF5A 2BUEA 1W4MA 2D1HA 1PP7U 2UXXA 2HWVA 1YVKA 1S5KA 3GLXA 2EVNA 3EUHA 3RKWA 5D6FA 2Q2EA 1U78A 2QBYB 4AIKA 4KOYA 3BPXA 1VKCA 1XDUA 1U6MA 4KMFA 4H6UA 3W6XA 1XGMA 5CVVA 3MQ0A 3B02A 4OIOF 2REFA 3GF2A 4KUMA 4EVIA 3CUQA 4U7DA 2ARHA 1BI2A 4R8HA 3M8EA 4F0YA 1IRGA 2E1CA 1ON2A 2A69F 3KP7A 3TQNA 2Z3YA 4FT8A 4GO1A 1UB9A 2IL4A 1T39A 5LHGA 4J3GA 1IAWA 1WRJA 3E6CC 3PQJA 2VZYA 1MDMA 4R57A 3JTHA 4I98B 2F2EA 2J8NA 1X3UA 2J8RA 4AD9A 1UHMA 3LODA 4A0ZA 3E0KA 1SMTA 2WTEA 4S04A 4CAWA 2FA5A 4MHDA 1KU9A 5LHHA 2L4MA 4FD6A 4CAXA 5HDKA 5TJJA 3TDUC 4NXYA 3D0SA 3TGNA 1FNNA 1UHWA 3R61A 1T0FA 1HW1A 1YLEA 5FGMA 2VC1A 4L5IA 4LLNA 3F8FA 3B73A 3F8MA 3FXRA 2ZXVA 4NHJA 4UXNA 4CXFA 2MLGA 5IV0A 1IN6A 5L3DA 2D2WA 3D3SA 2PC1A 4MY3A 3JSOA 2F5EA 2HEOA 2IA0A 2OZ6A 4HQMA 3N4MA 5GCNA 3RPUA 1QZYA 5E1ZB 4L0ZB 1SD7A 5LEKA 1B4AA 2P6SA 3DPLC 3I54A 2L02A 2OD5A 1KQ0A 4MBUA 4UHTA 1IF1A 1DUXC 1USSA 2BE5F 4RI1A 5DEQA 4AWXB 2D1VA 4KOWA 2RGVA 1BI1A 3DQVC 1S7KA 1OYIA 4HKFA 1LJ9A 5E18F 2ESNA 3BJOA 2AE6A 2HTSA 1SD5A 1PUAA 4XLNF 3GW2A 5DDGA 3O2PE 4KMUX 1S7OA 2R7DA 4KOUA 3MZYA 2Q4VA 1HSJA 1WKMA 4P9FA 3KP3A 2H6BA 5ICCA 3SZTA 1ON1A 1G3WA 4AG9A 4QBJA 2EK5A 3PQKA 2D45A 2ELHA 2RC4A 2DPUA 1S7FA 1MJAA 2PRBA 5DCMB 3GZ6A 1WK4A 3R6SA 1FP1D 3C3WA 4AVAA 2DQLA 3N97A 3V8JA 1ZRDA 4ORFA 4UVBA 2JDCA 5C88A 4E0AA 1FX7A 1G6NA 2STWA 3EXNA 4Y17A 4LX9A 2L3DA 3FRMA 1PDNC 2AXLA 2YX7A 4UV9A 1GHEA 2X7BA 3QU6A 3DSBA 4RAZA 2O61A 2H6CA 1RIOH 3LD2A 4EQQA 4IXAA 2PSWA 4PK3A 2XGXA 3MGDA 4F6AA 1BI3A 1PP8F 4HF1A 2OH1A 1JGSA 3Q9VA 3WR7A 3F22A 4DQ2A 3U2RA 2Q0OA 3FMSA 2VZZA 4N9HA 3F5BA 3FYNA 1ZLKA 4BMHA 3M1EA 3I58A 3ABUA 2FBHA 5FLXZ 1Z91A 2DLLA 2OA4A 3CO7C 1Q2YA 2HGCA 4I01A 3RI4A 1PU9A 1L3LA 4EJWA 5I0CA 2ZMEB
chains in the Genus database with same CATH superfamily
5KTAA 4F92B 2QQ9A 2QQEA 1YTPA 4BE0A 3H9JA 1PYTB 4KT5C 3J80K 4FE7A 4C2XA 1FBUA 1W4RA 3WTUC 4BDYA 4OVOA 2HOEA 2CNMA 2ERWA 2ANPA 4BH9A 3AAFA 3CCYA 1ZRFA 5IP7J 1T33A 3HRSA 1K78A 1E2XA 3TC8A 3W6VA 1VIXA 4EJTA 2Q4YA 3OMYA 4LITA 2H5MA 2W84A 3A03A 5FLXK 4GYIA 3QRFF 4NEXA 3SJGA 4CYDA 5K8MA 2KZGA 1TF8A 3EUHC 2CH0A 2WB1A 2KKOA 4A6EA 2EFWA 2QVPA 1XEBA 2PE3A 4HX4A 5CVUA 3JRFA 1KUYA 2ENNA 2COMA 4MQ9F 5DD8A 1TZLA 2H94A 3CCVI 1Z8XA 3NFZA 5F47A 1TT5B 1U9NA 4IRIA 4G7OF 4JYKA 2WAEA 2QLZA 1YO5C 2VL1A 1LDKB 4BQAA 3A4CA 3EYIA 2R7XA 3OL0A 4E1RA 2M7AA 4JXQA 2QENA 2VI6A 5HS8A 3B8GA 5EGOA 3KHXA 3I59A 3VARA 4DIQA 3ESWB 3QB8A 4A93J 3BDDA 3I3GA 4KOTA 1WJAA 3C2HA 5F1JA 1Z77A 3JRAA 1A31A 1MSEC 2B5GA 3G1LA 1TTYA 4MNUA 2K9SA 3VE5A 2FE7A 2DJIA 3VDXA 4YELA 4MY0A 1NG7A 3KZZA 4C30A 4M6YA 1X4PA 2L9VA 2FF4A 3FF5A 2KPMA 5H2FC 2ZBKA 2JVHA 1APLC 3BP8A 4M71A 2CUJA 4CGZA 2EO8A 3FC3A 2BOAA 2VQLA 1Z6TA 1UG0A 3MKLA 4WP4A 4HNXB 3D7GA 5GAGJ 5BPDA 3A0BC 3Q0UA 4ZYHA 3HOYJ 2I5UA 1QO0D 4G7ZF 3SXNA 5GPAA 5CVRA 4LG0B 1O57A 2IXSA 1H8AC 2M0MA 4UVCA 1FC3A 2ZXIA 4IF4A 3S2DJ 3EC4A 2ZO4A 1TBOA 5TGTA 9WGAA 2AFSA 4JZ0A 5CPRB 2FNAA 3GWZA 2NSMA 2Q04A 2VN2A 3R0JA 2XB5A 1MH3A 2CWEA 2MH9A 3EQLF 1LFPA 4BQQA 2FOWA 4CGLA 5AG4A 4EATA 4GS4A 2JMWA 2BEIA 2DMUA 4UUTA 1SVLA 4R87A 1V3FA 1WGXA 2VC0A 5FKMA 4A3IJ 4AVCA 5LD2C 1RNLA 1V5FA 2DF5A 2CO5A 1R23A 3BZ6A 4KN7X 4CCLA 2VEZA 3NWSA 3H3VK 1SQHA 1PJRA 4WWCA 3UGLA 2CS3A 4YFNF 1UVFA 3ECOA 3P9CA 1ZK8A 5LRKA 3CDXA 2DMTA 2QZ8A 3PO3J 1TKHA 1P6RA 3VYUB 4NQWB 4QIWN 3E6BA 5IOYA 2Z1DA 4AC0A 3A0HC 3A9LA 4CA0A 5F64A 3BCBA 3BY6A 4H2KA 4EEFG 2R7RA 2CU7A 3QQAA 3O3KA 5HXDA 4LOCA 4DGWB 2E2HJ 2DB6A 5M3FJ 3V8LA 1UFMA 4XICA 2AFUA 3VATA 2R7TA 2JK3A 1Q2CA 1XRYA 2PJ2A 4X8IA 2IBDA 2F4MB 2X1EA 2LSOA 1OCCH 3BR0A 3CP8A 1ZG7A 4OC1A 2ELKA 4L9TA 5ERIA 1WJBA 2GZWA 1I27A 1N25A 2NXNB 1FOKA 4CRYB 5B66C 4EJOA 3L2RA 1YLOA 1J9IA 3GTOJ 4HSTA 5K1YA 3CXPA 2Q43A 3GUXA 1SGDI 3H5RA 4XNHB 1A6IA 2KIFA 3R5DA 1BC8C 5D8LB 2QUFA 2QQ8A 2CUFA 1QU3A 1X3WB 2EA4A 1U6GA 2M30A 3P9KA 1YW4A 4HGUA 3SI0A 1W36D 1IGBA 2K3PA 1XDSA 4KVME 1YSJA 2ID6A 3D66A 4MO7A 2R98A 1KWMA 3D00A 4NFRA 1JUPA 5FRMA 3HG9A 4C7IA 3H8FA 2Y0SN 3CJRB 5E3QA 2COBA 4IK2A 4UWIA 3O8HA 5HODA 2PCUA 1Y8FA 1KA8A 4YGOA 5BNGA 4XR6A 4A0YA 3HDDA 3IL2A 2ZSIB 2BY1A 2FX0A 3DKYA 5KK1A 2WWYA 1LE8B 2FD5A 3B3WA 1G8XA 4ZJZA 3B3CA 4A3MJ 3RU0A 2DTZA 5D5VB 4OIDA 3H36A 4A6DA 4NC8A 4DZJA 4CCJA 4L18B 1HEVA 3DLJA 2CW8A 5A27A 2JEWA 2XKOA 3CC4I 1TWAJ 5E3RA 1DP7P 4QTRA 3WTXC 1JKRC 3FHZA 4IZZA 3MCZA 3ZQHA 2NRAC 1VQLI 5JHWC 1F9NA 1W3SA 1Z9CA 5DWNA 5HQ8A 2HZTA 3N5FA 5TISC 1KYWA 1K7VA 5J1RA 1WFXA 2DA7A 4MFLA 3K1NA 2QQ0A 3EUAA 1Y39A 2L2OA 1OPCA 2Y0MA 4NGMA 2BUSA 1S7NA 3QAHA 1R57A 2ZEDA 1YI2I 2X48A 1TLHB 3HH2C 2Z5UA 5EG0A 3VDUA 3AG4H 3ZOBA 3JUWA 2KJBA 3A1YA 4C7HA 2A61A 3GTLJ 3K9UA 1K7AA 2UUZA 3VSKA 2NVTJ 2YNEA 4WXCA 3OYCA 2ME6A 1TKFA 2AFMA 2LP0A 3I9V2 5HLGA 2PJ0A 2NVXJ 2X6YA 5K5OA 5J1UA 3GFLA 2BL1A 4G6QA 2ZXHA 2I79A 4PXBA 4ENKA 2VQYA 4UWJA 2V8DA 1DU6A 3NRVA 4IO9F 1J2XA 2MBFA 4YWYA 5K8NA 4HLYA 2MSYA 5H6RA 3HOZJ 3OYBA 2GLFA 2CW7A 2OU2A 1Q2DA 1LUJB 1Y1CA 3CJTB 2PJRB 1CQTA 1N71A 1EA3A 3GEZA 5KNLA 1JT0A 5BS6A 5G1ZA 5J6XA 3BTJA 2DA4A 1IYLA 2J8MA 2OB0A 3R9FA 1WH7A 1Z4EA 4OIPF 3S3OA 4KT6A 2EUIA 4JWPA 1SGYI 3Q0WA 4QLCU 1U5TB 2O6GE 2H09A 1IRFA 2HTJA 4KLWA 1IJWC 1RETA 3NQOA 1UELB 3ZP5A 4MEXF 2DTRA 4ESJA 1YS7A 9ANTA 2FXFA 3H5ZA 4WF2A 4RBOA 2GLOA 2PI0A 4AM3A 2E19A 3FWEA 3OYHA 4IVNA 4L89A 5KVRA 3HTUA 1ETYA 2EIMH 2M8GX 5E3LA 4EV0A 4J01A 4MFQA 4YFJA 4M9ZA 4AIHA 2JTVA 3W6JB 2CV1A 4TNUA 2B9SA 5EEHA 2DFEA 2R5YA 2F8HA 4ENJA 5LGNA 1I6HJ 3LSGA 3D7DA 1UFHA 3EDPA 2ACJA 1XG1A 3K2KA 1IDYA 4I49A 1R1VA 2BVLA 3L9FA 3ECHA 3QP5A 5GAHJ 3FK7A 2SGQI 1F2PA 4E7IA 1YW9A 1J59A 1Y7EA 3CMEI 2G7HA 4MCPA 2P5VA 2VBQA 4RM3A 5JLXA 2CV2A 3FIXA 2BV6A 3L7WA 2VI7A 2OAZA 4Q5SF 4RB2C 2XAJA 5C4XJ 3Q0VA 1AKHA 3HB9A 3CMMA 1Z3YA 4YU9A 5LBQA 3TE4A 3PB9X 3SJEA 5FD6A 3T8TA 3CC7I 2SGDI 4NB5A 4CPAA 5FKKA 3SI1A 2A4NA 3HOSA 4UIAA 2Z33A 3WC7A 2PMZA 2VE8A 1ACIA 4XPDB 2E5ZA 1IICA 5D8NA 1QSNA 1OYYA 4X2TA 3GVAA 1S7AA 3I64A 4YFXF 1SAUA 1HW5A 4YRVA 4A3FJ 3PNVA 1BMOA 4RMNA 2NOGA 4XRSA 4A94A 2CQXA 1PTRA 2VQHA 4MCSA 5ELYA 3DTEA 2E2JJ 4EJUA 1B59A 3BG5A 2LMDA 3BJ7A 5DM7F 1R1UA 3IP4B 1MT1A 3WTVC 4Y49C 2F5CA 4A24A 4CCMA 3BJ8A 4WJBA 1LNWA 1G3YA 4GM5A 3OOPA 1KU2A 1Z67A 2EV5A 4K2EA 1C0WA 2STTA 1X12A 2PJCA 1R58A 1DU0A 1LPQA 3VWEA 1HKTA 2BW3A 3BR2A 4AYBN 3OIOA 3K69A 1PCEA 4U0WA 3H8GA 3PBBA 3S15J 4I7HA 2VKDA 1O4XA 4C3JJ 4UA3A 4A30A 4UXJA 2NVUB 3MZHA 2EA2A 2HYGD 3GYAA 2L7KA 1OFCX 3BQZA 3GFJA 3IAM2 5DCMA 3K70D 1KZFA 4KA4A 1XSXA 4FQGA 2Y31A 2HU9A 3GX4X 3ZQCA 1HKQA 2QKLB 4EMSA 5J4YA 3OS2A 4ZTJA 4DYRA 1J0RA 3S3NA 3SQNA 5F48A 2B7EA 2DIPA 1PUEE 2R7HA 1Y0YA 3IEHA 2NVYJ 4S0HB 1RESA 2BY3A 5ED4A 2QIRA 2VXDA 3OL4A 2LEOA 3H92A 2X6XA 1XMBA 1H9TA 1OYWA 4ZYDA 1OMUA 2DN0A 1XBTA 2EWBA 3CXLA 1ELLP 1IXSB 3P2FA 4MHPA 4M6VA 2A05A 1ZG9A 1ZARA 2ISZA 3CCMI 3F6OA 4E7HA 2XVCA 1NH3A 2M1BA 2BHYA 3GY9A 4M6IA 4TWEA 4W1UA 2I3CA 5EC4A 4I76A 3JAMZ 4GYGA 5IT9Z 1TURA 2ZEFA 2Y48A 3RJPA 3QTLD 4MCRA 4BJ5C 4IHTA 4CCNA 3U1DA 1BUSA 4MFKA 3ABMH 3MD2A 1EH6A 3KFWX 3Q3SA 4CDGA 1TIQA 5C82A 3SDGA 4QC6A 3DP7A 5CQGA 2J5OA 2R92J 3K4CA 2EK9A 2HQ5A 3OYJA 3KR4A 3DR8A 4BXXJ 2KL4A 2XRNA 2FMYA 3HJEA 3E5UA 5KAIC 1Q7LA 4EGZA 1DQUA 2CMPA 2QWWA 2M7BA 4CUGA 4R1HA 4RAYA 1HDLA 5E3PA 3UKGA 2R7OA 3S16J 3PFOA 5KCMA 2VOOA 5CVJA 4O3MA 3JAMK 1YX5A 3DEUA 3GMEA 4FETA 2JT1A 4MEYF 1YJWI 5IT9K 1KBFA 4KOVA 3RZAA 4BD9A 5KAFC 2RREA 2ZXWH 3D5SC 1E17A 3FXMA 2XB0X 4NSQA 1HA8A 1HDUA 3DNSA 1ELMP 2W00A 3BLNA 2V26A 2M4KA 3HZJA 3UNGC 2Y2ZA 2AS5F 3TBIA 2DJNA 4FASD 3H1CA 2NS0A 4G12A 4X6AJ 5JM6A 2HYFA 1O7FA 5GAEJ 3BQYA 1N75A 3OOUA 4QPQA 1N77A 2R7ZJ 1LR7A 1XN7A 4C2ZA 2EIKH 4ABZA 3TO9A 1VHEA 3DR6A 2JZYA 4CSWA 2XAGA 4RLFA 2J9RA 3DLAA 1RPWA 2OUMA 4EMEA 4PXEA 2C6GA 2ZMEA 3DCFA 3WTSC 4P4EA 1RI7A 2L5QA 3PM1A 3WHBA 4OMZA 3WTYC 3T8WA 3L09A 2PVWA 3HGYA 1FBQA 3OIQA 1QHHD 1OCZH 1QQIA 2XEFA 1KMAA 2Z3OA 2W82A 2KDOA 3KHZA 2LLKA 2OBPA 3U9GA 1NTCA 2MD5A 3VPRA 2PJ1A 1B72B 4UF4A 4P44A 3I5UA 2FMLA 5HS7A 2QVOA 3PDNA 2FVGA 4B8XA 1EJ9A 2O53A 1SGPI 2B8TA 3RYOA 3FH4A 4U9ZA 4BGDA 1XMKA 1FZPB 2LY1A 3JR9A 1BR2A 3OR1C 3L2WA 1SGRI 4KOSA 4NF1A 2R1IA 2WB1N 2GM4A 1H8LA 2UWMA 3R1KA 2GBYA 2RNJA 2HC9A 3GTKJ 4M85A 2HQYA 1TBNA 1K4JA 3LQQA 3DEWA 2YNCA 1KBEA 4A32A 4DNCA 1IOIA 2CNTA 3PUFA 4BBRJ 3VODA 3AL0B 3VEPA 2OZHA 3HRTA 4HEA2 1OR7A 5EZHA 5GP9A 5K5QA 2HQRA 2M4GA 3N7ZA 4IHMA 4ONWA 2KMOA 2V1NA 3IC7A 4BHPA 1BAVA 3HL2A 2AHQA 4OC2A 4A3KJ 4B09A 2RV8A 1ZRCA 1MD0A 2CTCA 5EBVA 3IH3A 1VQKI 3GTQJ 3D8PA 5IB0A 4F3QA 2B4DA 1ETOA 1YREA 1YYVA 3QYBA 4XRMA 2PJAA 5EMIA 3I71A 1MJ9A 3BZCA 4QSHA 3TL4X 3S6HA 1B9NA 2E71A 4ZY1A 3W6KB 5KHDA 1FYMA 1GYTA 3EO4A 2Z3MA 2BHZA 2Q4ZA 1KZHA 4LG0A 2F5FA 2ENZA 5HH1A 4XLFA 5BMZA 2F5DA 1S20A 2YS9A 2WYRA 4PJLA 3WTWC 2V8VA 1YIOA 4NJRA 1IN4A 2Z10A 2ZEPA 1WJ5A 1RUNA 2V1XA 4MTDA 2CV0A 2QSHX 4XKCA 4BY1J 2NU0I 3FEDA 3F6VA 3S6KA 1K7UA 1SGQI 4ZY2A 3R5BA 2Q0YA 2X51A 3RYPA 2GXAA 2VUMJ 2W24A 2RNGA 4U0YA 3FXUA 2IRFG 3BJIA 2VT2A 4XSXF 4BQNA 2LKXA 1QA6A 3RZOJ 1N13A 2ROWA 1BPNA 3FX6A 2IS6A 1R5HA 4ZZLA 1P4NA 3QNVA 2EILH 4EM2A 1BC7C 1TC3C 1Q1VA 4DJLA 1ZG8A 4NQWA 4IPAA 1M1DA 2ODFA 2WAQA 4UB8C 4L8AA 3SJFA 1FBSA 4LK0F 2Z11A 2LDUA 2ELJA 3QPSA 1R6RA 3B35A 3D5RC 3ZMUA 5D5WB 2GVIA 2F3CI 4JXRA 3ZQIA 2A6EF 1ITYA 5JGFA 3IH4A 3CJNA 2LVSA 1XGNA 1S29A 2ZCWA 1FPQA 5LEJA 3WU2C 3I4MJ 2X52A 1XJOA 2EZLA 2QECA 4F93B 5D29A 1ZO0A 3LNQA 4U88A 3QWLA 4PXCA 5ILUA 1S8NA 3CF5F 4OOIA 3MN2A 2OCEA 3FXLA 4RAGA 3WE2A 4O6JA 1TWGJ 4PK4A 2J9AA 1JWQA 1HC8A 4CYPA 5FKNA 5DM6F 4ONUA 5ICEA 4H4KC 1X10A 1Y9WA 3L2NA 4CYOA 3TO7A 1BL0A 2ZW5A 1W5TA 4BS9A 4R3KA 5H6QA 4I99C 5L3BA 2Z3KA 5EJCA 4U0VA 4MHNA 1LEBA 1A04A 3HUVA 2DU9A 1XCBA 2HXIA 4CYNA 2LF7A 5L3FA 4HDVA 4HDUA 4HF0A 3CO6C 2HOAA 3OYNA 3VWDA 2V1CA 1WVRA 2L9SA 1KYZA 3E6MA 3HGGA 3COAC 1VQ7I 2OTLI 4HNWB 4FBEA 2J5PA 2HPIA 1TBQR 1OKRA 4JK1X 2MC3A 1JKQC 1FARA 5A2QZ 1LFUP 3FSXA 3K4MA 4BL0B 3FECA 4L9MA 2ZB9A 4LMYA 2ID3A 1OQYA 2UXNA 2P81A 3S6GA 4U9YA 1MMNA 5BWAB 1R9TJ 4F0XA 3B6CA 1LE8A 4ESBA 5JPHA 2WY8Q 4E70A 2GU2A 1UVGA 3SHPA 5M5WJ 2HS5A 4P1WA 2QPOA 1XD7A 2JPCA 4UV8A 4XM3A 1FP2A 1QHGA 1FOWA 2OZGA 3LSTA 1HSTA 2G7UA 4JJXA 5DWMA 1Z6RA 1I1SA 5LRSA 3IRQA 1IDZA 1MBHA 4M3BA 2ZEMA 5A2QK 1XMTA 5G21A 1IC8A 4DZPA 4FX0A 1ZYRF 2CSOA 1QRYA 1XMXA 4KSFA 1NXUA 2XC7A 2JA2A 3V7SA 4BBHA 3R96A 2XROA 2HUZA 3KYDB 2OPTA 2P6GA 5B3SH 3CCSI 3C18A 3BWGA 3LWFA 1MMAA 3CTAA 1I21A 4HYEA 3KQZA 2G0BA 5EEGA 3KZWA 1YW8A 1IV8A 2P5LC 4JLYA 4LFUA 4EJVA 4R3LA 2OOTA 4PDKA 4AVPA 2BCOA 2XPVA 3J80Z 5EEAA 3B3VA 3DEEA 2YU3A 3F8NA 1Z7UA 4OIRF 3NEUA 2PDOA 1PYVA 2NAZA 3HBLA 3V4GA 1K83J 3C2GA 1FTZA 1VQOI 2QYOA 2XIGA 2CIJA 5CNPA 5D8KB 1Z7KB 3WC6A 2FQ3A 4GI3C 1ORKA 1NHAA 3I9SA 2FBIA 4F7ZA 4M73A 1DE4C 2Z3PA 5KTCA 3FMRA 1JUSA 3SGQI 1LR8A 3P5JA 1AA7A 1MBEA 4R6TA 3K10A 3CUOA 4B3AA 1ULMA 3JRUA 4CS0B 2R7VA 1T98A 3HPGA 1XC5A 4KITB 2PJRA 2O7OA 4L0YB 2FSRA 4K3NA 1ZH5A 2CUEA 3ZJ0A 3WTTC 2ADUA 2LR8A 2GA1A 5K7FA 1O7LA 1ZR2A 2VXKA 2JEVA 1BOBA 2M8EA 1QSMA 3OYMA 1V0CA 1HCRA 1U5TA 1VHSA 1BW6A 4RB3C 1DS2I 2EFOA 4ZYEA 1Z21A 3O8GA 4HF2A 2PN6A 1OCTC 3PFEA 3FDYA 3W2WA 3DGVA 1TBRR 1IN8A 2YUUA 3GBGA 5CLSA 4GXHA 3S1MJ 4A2UA 3C1DA 1MH4A 3PJRA 2VJJA 2VONA 1RXTA 4E1PA 1WWXA 4WXHA 4FKDA 4EJWA 5J1QA 4C9YA 3H0GJ 2V1UA 3DDDA 2BZTA 2Q8KA 5HVQC 2JRTA 2B3UA 3K4JA 4A31A 3TO6A 4HLXA 2HDDA 1IO2A 2EBJA 4DBQA 2HDWA 3KP6A 1O3SA 1V54H 1R79A 3S2WA 1HXDA 1ZQ3P 1K4TA 2KRHA 1YIJI 2O5RA 1UZCA 2VL8A 1Y0RA 3ABTA 3FSYA 3UGDA 4FHTA 3DBHB 4NGTA 3B4VC 2WY7Q 2XF6A 1SC7A 4IRGA 5D6EA 1HOMA 2NMTA 2ZW7A 1GXPA 4OU0A 4NGQA 3CUQC 3TP3A 4DUKA 5DUIA 2MYSA 3E3VA 5BQTA 3ABKH 2W48A 2B4DB 2FXAA 2IJLA 1MBKA 3I0TA 3RPQA 2DPDA 2QJ8A 1VHOA 2YUSA 4A3DJ 3CF2A 1M8CA 1ULKA 3TCVA 1YGHA 4E2AA 4Y4RA 4BU2A 2W1OA 5D5UB 3S9NA 4QB9A 2B0LA 1LFBA 1ETQA 2A68F 2V4JC 4I2OA 1Z2LA 2PMZN 2QCOA 3CMYA 1YQAA 2ZEGA 2ZXJA 4M9SA 1RUOA 4PCQA 2L7FP 3E5QA 5LRRA 3F21A 4IHWA 1QSRA 3ZMTA 3M8FA 5DV5A 3CD6I 3OYAA 3KR5A 4WWVA 3E6DA 4Q4ZF 4IRHA 2KZVA 4RS2A 4D0PA 3LQRA 2UVOA 3PB7X 4P4BA 4D5CA 4JX4A 1OZPA 3UY5A 1FEXA 3IHUA 3L2CA 5CCLA 1XB4A 1ZKGA 1QMUA 2FCKA 3NE7A 3OL3A 1S5LC 2FEZA 1DPRA 5LHIA 3J7YJ 2ZJPF 1BO4A 1KGSA 2H8RA 3TFYA 3TX8A 3PUBA 5HLHA 1P7IA 2E36A 2NVQJ 1BN5A 1NSAA 2BO9A 2DDBA 3WU0A 2ATRA 4Z65A 3DPUA 4HX8A 3CDIA 2K5CA 2VJ4A 4M9XA 4WCGA 3EYYA 4IHXA 2UZKA 4HW0A 3H3UA 3HHHA 4M74A 1X4SA 4B6DA 3I1UA 3PFIA 3CP2A 4MJ8A 4PK2A 4M3EA 1B6AA 5DUKA 2IEKA 1H89C 5LYFA 3FBIB 3R0AA 1VTNC 5IB9A 2DFHA 1HDPA 2L9RA 1K6OA 2F4OB 2CQNA 2L54A 5DD4A 5HLIA 1SGEI 2ME0A 3W3CA 3KL9A 4LUAA 1P0HA 4F9VA 3DU5A 2ZNZA 1T0FC 2MW8A 3CC2I 1WGCA 1X1BA 2P6TA 4E7SA 3UFFA 3H8EA 1R1TA 1UCRA 2XRLA 4B11A 2HQAA 4MLOA 5FLMJ 4PJNA 1W0TA 5J8CA 2DPSA 4PGHA 4G6DA 2QSGX 5HS9A 3KLNA 4YIFA 3G73A 1MBFA 3QPHA 3S2HJ 4IL6C 2CQ7A 1ZG1A 3WGHA 4B6ZA 2Z99A 3CPAA 2QKMB 3LWUA 2RIJA 3UGIA 2P0WA 5DS0A 2M87A 5IP6A 2VLAA 2KIMA 2L9NA 4XOPA 4D1QA 4WXDA 4HQEA 3F23A 3VB2A 1A5JA 3T0YA 2YPRA 1CPXA 4XNFA 3F8KA 1JT6A 4ENNA 1FT9A 2XPWA 2ZJ2A 2K40A 4I09A 4KOXA 2GKTI 3LA3A 2XF7A 3S1NJ 1BIAA 1R5GA 2LY9A 1B1BA 4S05A 3WT4A 2JVGA 2L01A 3WE3A 5E3OA 4NBQA 5THWA 5FD5A 3Q5FA 3SZPA 5JLWA 3CCEI 4MHZA 4A3EJ 1UUCA 2P5KA 3HKZA 2VPLA 1WSUA 3EETA 2OQRA 4N0BA 1FSEA 4RDUA 3IWWA 3W6SA 1UHSA 4A38A 5AIPA 3PIPF 2XDVA 2M34A 1SD4A 1KQ9A 2Q44A 3CESA 5J8FA 1H0MA 3FXJA 2IS4A 3ZPLA 1VQMI 2ORVA 1R00A 4XLAA 5LRJA 5IX3A 1OCRH 3TOBA 1TQIA 3DPTA 4G8XA 2KDZA 2A6HF 2G3AA 3K7AJ 3BC8A 4AG7A 2E1OA 5HDNA 1QPIA 4XORA 5AG5A 4QUSA 1IIDA 3F8BA 5E20A 3QAYA 1A35A 5AONA 4UEFA 5FUXA 5EX0A 4TV7A 4II9A 3W91A 4LJZF 2R7SA 2XKPA 3S6FA 1RTQA 3M9AA 2IVMA 3GYHX 4HNVA 7CPAA 2BVMA 4ZDLA 2O8KA 3DWLE 2WPWA 3BG3A 1HQCA 5CVIA 3RTRA 4ETSA 3CZXA 1B72A 2PJ9A 4BACA 2M5XA 1R49A 2XHKA 4CAVA 1YOVB 2E60A 2DBBA 4X3RA 1P92A 2VT3A 2NU2I 3GB0A 1DDNA 3LSPA 1W7PD 1JJ6C 1XF8A 1D1AA 5F6FA 4OADA 4OP4A 2N17A 4DJAA 3TMOA 1NMTA 1A2ZA 1P4WA 4IUSA 2EV0A 4DYQA 1XPXA 3GKRA 5JR3A 2WPXA 4HV6A 2V7FA 1CP6A 3V7ZA 1P7JA 5TRDA 4RGXA 5JHUA 3GO5A 1PUFB 2HOSA 3WG9A 3CDLA 3E2IA 3IUOA 1QGPA 5F1RA 4BXUA 4A3JJ 1PVEA 5H84A 3OS1A 1X1PA 1XX5A 1F2OA 3ZMDA 4LG3A 3HSFA 2HV2A 1DP3A 4CYQA 2ECCA 3MWMA 3ULQB 5ILSA 2B4BA 4PQAA 4YRHA 2KFDA 1OISA 1J75A 2AFZA 4Y49B 1RFHA 3V8IA 2A5WA 3F72A 1RZ4A 1S9HA 3MVPA 1A36A 2E7XA 1Z4RA 2GLJA 4KNYA 5DAEA 1Y6IA 3KX2A 3BLYA 3LSHA 2ZJRF 2ETHA 2TCTA 2RDPA 1G4DA 1LAMA 3OYFA 1Z8WA 3ERMA 3H0DA 4XLCA 5L3GA 1PCAA 2LTPA 5LRGA 1F5TA 4JQFA 3EPZA 4KIBA 2KCXA 2JLMA 2YSRA 2CG4A 3DTKA 2O28A 2ZOGA 1Y0UA 2D5VA 2K9MA 4B10A 2FNPA 2CQKA 5D5XB 1WJFA 4ENMA 1U8BA 2PJ4A 1Z1DA 3TKYA 1BLLE 1AMPA 2W57A 4J19A 1U0JA 2L4AA 3MAJA 5HNHA 3BI0A 1GHCA 2FIAA 1HJAI 4G7HF 3K0LA 2ARPF 2RQQA 2Y30A 1GXQA 2Z3NA 3FX3A 4JX5A 5FFXA 3ROUA 5K5RA 3HOTA 1JKOC 1IN7A 2K27A 1XS9A 1B9MA 3I56I 3SFZA 1LQ1A 2A5YB 3NE8A 2DW4A 5FKLA 3IV5A 2RB7A 2WV1A 4G6TB 4B12A 1XGOA 2PJ5A 3IWGA 3GTMJ 3FZVA 1CGII 3ZZIA 1TQMA 3ABLH 1USTA 1XFOA 4RN7A 1FAQA 2O8XA 1X1DA 4OC3A 1O3QA 2WAQN 5HDGA 2JRMA 5CYVA 2KIUA 3IWZA 5K7HA 3SEZA 4ASNA 1EF4A 3KKWA 4IJAA 4LIUA 1WJDA 3V38A 3KEQA 1K4SA 1H9GA 2L7ZA 2HOTA 1E0EA 2LKSA 1LDDA 1TP4A 3BOQA 1K61A 5KTDA 3CCLI 3KZIC 4BBSJ 3U1KA 3GFIA 1SVMA 2LNBA 4C2MJ 2D4PA 3QU3A 5HVGA 3IKVA 3IWEA 4FD4A 3GFMA 3PSFA 2R93J 1JJ8C 4B47A 1HKSA 2QSFX 1N78A 2P6EA 4R9MA 4A3GJ 2LF8A 3WGIA 3WG7H 3S93A 1LVAA 2QA4I 2SGEI 3HRMA 1EV7A 3C26A 2NS7A 3FXKA 2EH3A 2GOXB 2H8WA 4FCYA 1WKXA 1CPSA 2ZJQF 5DTDA 2CGPA 3HTSB 1LB2A 1SAXA 1OMIA 1U5TC 3GTPJ 3A02A 3BG9A 2VJ5A 4RAFA 4ZZDA 1Y1WJ 4UFWA 4LGWA 1D0ZA 2DI3A 2VKVA 2AXTC 3QWPA 2R3SA 3LSIA 2X4HA 1IOFA 4RA2A 1IGNA 4UEEA 2F5VA 4C2UA 2Z0ZA 4CICA 1R5ID 4BJTA 4IEJA 1W7PB 4MFDA 5EZGA 2OCCH 1MIJA 1WTJA 2ZEOA 3P7NA 2D4OA 3L2VA 2KCWA 4PSXA 2JA5J 3NH5A 4RLQA 2JBKA 3I4NJ 3GXOA 5LFAA 2JJ7A 2OVOA 1TBXA 3DKWA 1P4AA 3ZQLA 1T38A 3BI1A 4KIGA 1FOYA 3H9QA 4Q48A 1PJUA 1D0YA 5CJ9A 1HDQA 3SEKC 3QPTA 3LAJA 1P4XA 2Z16A 2O9LA 4NC7A 1OCOH 3R95A 4UXHA 4A5MA 2VE9A 1T2KA 3M4OJ 1TIHA 4BYYA 1ZHFA 3BTIA 1YFHA 2JQ7A 1CG2A 3CDHA 1CF7B 2CXAA 2QM3A 3E5XA 4GXOA 4XL9A 2NS8A 2JYYA 5J1YA 3JRCA 3GTGJ 3K4LA 4HAMA 2WC2A 3RKQA 4ZTFA 5E96A 4L9JA 3T5XA 2HDCA 5K7ZA 4AUXA 3VWBA 4EM1A 3FJUA 4M6XA 1WQ2A 3FKIJ 4D5FA 2BXYA 2E35A 3KGQA 4PJ0C 4B48A 4KVOE 5JI6A 1O3TA 4KIFA 2HKXA 4X0GA 1SFUA 2LUYA 3R9GA 4EVYA 2N8GA 2DK5A 1D5VA 4KS9A 4NC6A 1YU6C 5JFRA 5B1AH 4PXDA 4UEZA 1R7JA 4AXVA 4XPDC 1ON0A 3GLLA 4MQVA 4P45A 3FHNA 3I3LA 2DQRA 4MI4A 1JHHA 3SFIA 2O03A 2XRCA 4O5VA 2FS5A 3JCUC 2OC6A 2DOEA 3OSGA 1IXCA 2PFBA 4L5EA 2KQRA 2EIJH 4DYCA 2AJ6A 2HR3A 2WSAA 4NJQA 4Q7AA 4HZFA 2GOMA 4V2FA 4ZDOA 2DODA 4P10A 2BBYA 3VOEA 5C44J 1Y8QB 2Y0SA 2K86A 4XLPF 4MFPA 4JCVE 1MGTA 2CNSA 3QOPA 5GTHC 4CGNA 1AUGA 3BJAA 1QNTA 1JTYA 3GOXA 2K9NA 1I1GA 2OJED 1HBXG 3F8CA 3KEOA 2K3FA 1EH7A 2R8VA 4KUAA 4ZGYB 3LA2A 4RB1A 3G3SA 2VIXA 4IHYA 3JRGA 1XMAA 2OF7A 3RDIA 5JVGF 1CP7A 3D7FA 2K4JA 5K8PA 3LMSA 5ISVA 1SANA 4AB7A 1Q1HA 2KIQA 4I0AA 3FNCA 3RIRA 1JKPC 2MGQA 2IQ6A 4ZX8A 2P6AC 4UFVA 2K7LA 3ZMZA 1BBYA 4D7MA 2YU9J 3PGPA 5E79C 3DV8A 4UCNA 1XE4A 2I10A 3TEDA 3E59A 3ZGKA 1VFCA 3VYRB 4RUHA 1Y7RA 1CSOI 3OS0A 1A6QA 1O3RA 5FB2A 2YQPA 3UOEA 2JDDA 5EX3A 6CPAA 1ODDA 3BROA 2GAUA 5G20A 2WV0A 1S3ZA 2DXIA 1QSOA 2VASA 4XLHA 1YHQI 2HQNA 3T90A 4IQ4A 4KN4X 2V6EA 4B4CA 2VBYA 2GIZA 1KQ8A 2XEJA 3WABA 2BXZA 2R7FA 4X1EA 1FSHA 2K5TA 2EFQA 2RAEA 5D4RA 3SJMA 2PIYA 3E97A 3FISA 2VODA 5A28A 5K8OA 5LYIA 1LCPA 3GIUA 2Q7BA 3H9GA 1M1EB 1TF9A 4HBLA 3BTLA 2CFOA 2IA2A 1ERDA 2WCYA 1V5GA 5IYDJ 3EY5A 4N4NB 5HLTA 3H4QA 1X1CA 3TW7A 5AG6A 4B5PB 1LOKA 5F0FA 3HPHA 5E1WA 4HNYB 4RS8A 2C6PA 2G9DA 1Z2IA 2XAHA 4CZCA 1VNDA 5F08A 1XSVA 2E1NA 2V1DA 2X1DA 3RYRA 3S32A 3CXQA 1B8IB 3FBUA 2A3SA 2R0QC 1HPTA 3DF8A 4Z2YA 5FKOA 1G3SA 2WZNA 1Z7LA 4KZTA 3HOVJ 3HUGB 4KVXA 3CQZJ 3W2AA 2DAOA 1F1ZA 1PTQA 4R76A 1TL8A 3TT2A 4CO8A 2XGDA 2ISYA 2PG4A 1AOYA 1KUXA 4HPSA 5IP9J 2H1KA 5FVJA 2PJ8A 4BNCA 5I4MA 5ILVA 4QVTA 2W85A 3F0CA 4Y33A 3MFKA 2IJZA 2QMLA 3HIFA 2MA3A 4GGGA 4I0BA 3JTKA 5AGEA 1FJLA 1AN1I 4A39A 4B5OA 2GWRA 2JA6J 1YITI 3FXOA 4KICA 3H3ZA 2LK2A 3CXSA 3BXMA 2DYRH 3KE2A 2F4IA 2VQCA 4KISA 1U5KA 1Y9KA 1RKTA 4M72A 3WGGA 4BHBA 2HKOA 2OTJI 2H27A 3G3ZA 4P9UA 5F46A 4N4OB 5LLQA 5L3EA 2EJRA 3VYSB 3BCAA 3IU2A 5D4SA 3N05A 3MKZA 4E8OA 3K9TA 1K7TA 3BR6A 4OC0A 4MRIA 1FIAA 3HHGA 1R0RI 4KSAA 3FVLA 1Z05A 4YIRX 4U5YA 1CGJI 1IG7A 2Q7SA 5FROA 5HVHA 3RKXA 2ZKZA 3I4PA 3PRTA 1YJ9I 1I1DA 2VB6A 1S7LA 1I3QJ 3V7RA 4OIQF 3L2QA 1B6BA 4XPKA 4R7MA 1K6YA 1T6SA 1CJWA 4MXUA 3IH2A 4M3GA 3H5NA 2O4HA 1OMTA 1ZN2A 5GPCA 4LQGA 1OCPA 4NNJA 2VBZA 4BE1A 3OVOA 5CCMA 1TXRA 3IU1A 2N1AB 4MGRA 2V77A 1TWCJ 4HPQA 4UCMA 5HI7A 4P4DA 2DMPA 2XAUA 4SGBI 2X1CA 3TDZC 4Q38A 1NG6A 1D1BA 3TW6A 3Q9SA 2KRFA 5C3EJ 3ERED 1R71A 3B2YA 1W1WE 3NWTA 4II3A 1S6LA 1TOTA 1VZ0A 3HOUJ 1BR4A 3KYCB 1DPUA 1CX8A 2FIWA 5AG7A 2EZKA 2MH2A 3HSEA 2GANA 5CQEA 3SHFA 3CMAI 1D0XA 4P4IA 4R8FA 5H20A 4WX9A 2KT0A 4A2ZA 1G59A 1FTTA 1YQEA 2JN6A 4G94A 1R4MB 1IRXA 2XEIA 4OIWA 1CE3A 4P4FA 2WUUA 4P96A 1L0CA 2OV7A 2XSJC 4B14A 4P55A 4U7BA 4ON0A 2DCEA 2LD5A 1YW6A 2ZW4A 2DMQA 2RN7A 3V42A 5B1BH 2PLYA 5FLVA 3R5CA 2P6FA 1FYKA 4D9JA 3EFAA 3DU6A 3SXOA 3BTCA 1ZREA 2BEOA 1JE8A 1I39A 1W5SA 4N9IA 4XRFA 2XF5A 3JREA 1SGNI 3I55I 4EWTA 1BM9A 4C2YA 1SFEA 1U2WA 1BR1A 2E1MC 2P7VB 5JVTA 2BSWA 3RKYA 2Q2EB 5HOOA 2ODDA 5FUVA 3RPUD 4HV5A 3QYEA 2FSWA 3LSKA 2A07F 4KDPA 2PBIA 4M3FA 1MW7A 1ULYA 1LRZA 1KUVA 2V8GA 1R22A 4KFCA 3DBRB 2R7WA 4C3IJ 1D8JA 1WGTA 3D7HA 1FWZA 2H1LA 1BOAA 1S3JA 2RVCA 3D2PA 2O3FA 3PP9A 2FNFX 1ZELA 5EF6A 2B63J 2GA2A 3CUQB 2VXZA 1NE9A 1SD6A 4A3LJ 3ZN1A 2AQEA 3FM3A 2ZW6A 4BKXA 4DOZA 1Y0NA 3K1MA 4UBRA 4LLGF 5B5EC 4PZJA 1JHFA 5EYRA 2HZDA 2HVSA 2PJBA 2NYXA 1IB1E 3S14J 4A95A 2EZHA 3IGRA 5LGTA 2QF7A 3BG6A 5IOZA 4Q47A 3KCCA 4JX6A 1U8RA 3VDPA 3RNZA 5M5XJ 4II2A 1TW2A 1PUFA 2VOPA 2KMPA 3J81Z 2I8DA 2JA7J 4ZYAA 2EK8A 3JVNA 1I5ZA 4CCKA 2X0LA 2FBKA 2LBFB 3ASNH 2HVQA 2PJ7A 4NGPA 3ZQQA 4U87A 3UR3C 5FUWA 4NGRA 4CGMA 5J40A 1MDMB 4A0XA 1GVJA 4HX7A 2OQGA 3KLOA 4E7JA 3DFGA 1J7KA 1RO5A 3JSPA 4GCVA 3BPVA 1I6XA 1SFXA 1GT0C 3LFUA 1F4KA 1R43A 3G8WA 2VQGA 2PEXA 4DW6A 4YG2F 1R4NB 2M5WA 4RGRA 3J7AO 1Q9BA 3S9MA 1L0OC 4OC5A 4FX4A 1ZAOA 1TW3A 2R5ZB 5JQ4A 2X9DA 4KORA 1U3EM 2OZUA 4G9YA 2F6CA 2DA6A 3J81K 1XSDA 4IQJA 2E34A 1J5YA 5BOXA 1G3TA 4M3SA 1DTDA 2CF4A 2XAFA 4OAYA 1RC9A 3IJ3A 4KUBA 4FUUA 1WCMJ 1T8IA 1VGYA 5F49A 1MJBA 4A5NA 3WU1B 3NA6A 3AG2H 4F55A 3S1QJ 1IUYA 2IS2A 1IN5A 3WODF 2DOAA 1RKWA 4O23A 3DXJF 5DCFA 3HOWJ 3KP2A 4I02A 2NNYA 2ORWA 3K2ZA 4C2TA 4BEHB 2Q51A 1X2MA 2VKEA 4BAYA 4MHYA 5DYMA 4OC4A 1FMVA 4KJZA 2CTBA 3GCMA 5ICGA 3WTZA 1D3YA 1ZGWA 4GDFA 5L3CA 1CT0I 2RKHA 3LSMA 4OAEA 2EV6A 2FU4A 6PAXA 3BJ6A 4Z6YA 4LLLA 3T9YA 4CCOA 4ZC3A 4CZZA 1BW5A 2WADA 1IY5A 2GKVA 1ETKA 1YJNI 5LYLA 4CHUA 2ZNYA 7WGAA 1YW7A 2I00A 1K79A 1WJCA 1REPC 1VQ4I 3T8RA 3JW4A 4HOBA 3LMMA 2VBWA 4JOMA 4RM2A 1UHAA 1QBJA 1M44A 4LK1F 2PIZA 1FY7A 2K9HA 3LFKA 4B13A 1IZ1A 1T95A 2FJ1A 5IYBJ 4J00A 3NH8A 2CYYA 3QODA 3BZKA 2Y75A 1S7EA 2HYJA 2X6WA 1GVDA 3AG3H 4ZDPA 5FO5A 5BPIA 5CPAA 3BR3A 2ZMEC 4BJ6C 2Z9OA 3HXLA 4BHCA 4IHSA 2SGFI 3G4SI 3MZ8A 2YX4A 1GDTA 1F57A 1NK3P 1XBUA 1MZBA 3T1BA 2DT5A 4UUSB 3F0AA 2R7UA 1ZLHA 1BJZA 2B58A 4ZYGA 1ZG5A 4KLVA 2CWGA 4V2GA 5E3MA 2LB7A 4XKWA 4F9UA 2FOKA 3PSIA 2ZFUA 2YNDA 2JWTA 3DKXA 4Y13A 2XPUA 1EKEA 2E5RA 4X5KA 1EH8A 1KONA 1VQ5I 1CGPA 1W7PA 2PX9A 1QSTA 3ZXSA 1LR9A 2ZEEA 5FRNA 3KZYA 4UVAA 3P9IA 3PFYA 2AO9A 1TUSA 1F43A 3PIOF 2FT0A 1P2FA 1V55H 4MFEA 4P4JA 2IT0A 3G71I 1XX6A 3FMQA 2EWNA 3B6AA 4BINA 3NARA 1X74A 1D5YA 4EFDA 1X1AA 1YK3A 2YNCC 3V8KA 4QWQA 4HNUA 2DFIA 4CYCB 1PPFI 3D68A 2PJ3A 4XBFA 2XUBA 5C4JJ 2GXBA 3K1PA 4XLEA 2G9WA 4BXFA 3S9LA 1CF7A 1OR7C 2F48A 2WAFA 2XGCA 2LFBA 3M8JA 4UNOA 1FT7A 3FXTA 3PNTA 4AVZA 1CBXA 2KMUA 5E8IA 2CRGA 3F3XA 1KU3A 1R36A 2GQQA 2LY2A 2XASA 3H35A 4RGUA 4XRSG 1D8KA 4BE2A 1JXSA 2E73A 2V9VA 2PJPA 5HVFA 4YIIA 3L00A 2W4SA 2W0TA 2B3VA 2ZEHA 4OAZA 2C6YA 4ESFA 4FD7A 4L5JA 1IW4A 3GTJJ 1U9OA 2Q1ZB 2TDXA 4XQFA 4G1PA 1GLNA 4CGOA 1RR8C 4MTEA 4EGYA 3A01B 2SGPI 1LFWA 2BOLA 1ZGJA 3L2UA 2QBYA 4R79A 3PZJA 1Z3XA 4OINF 1HW2A 4KYWA 4C3HJ 4XKBA 3OWCA 2KISA 2YGWA 2K02A 1DGRM 3KP4A 3IKTA 1AHDP 2DXQA 3CLOA 2OR4A 3ZMSA 1QZZA 1E3HA 2IGOA 4XPLA 3DLLF 3NAUA 4PPZA 2M0CA 4ZBGA 3G2BA 2ZC2A 1V1HA 1LDJA 2JSPA 3CCUI 3SXYA 3CJQB 1WHUA 4MCQA 4LB5A 4EM0B 2JUGA 1DS3I 1V4RA 1FYBA 3KP5A 4XOTA 3OXFA 2ECBA 3QPLA 2HPMA 4P6YA 3TOAA 2HVRA 4B43A 2X3TA 2WVJA 4CRZB 3I53A 3R4KA 3RQ4A 2LRDA 2DA5A 3PO2J 2CWHA 3ML6A 1TT0A 3C7JA 3FBNB 2NYQA 3FMCA 2KRCA 1OYVI 4JD6A 4NGNA 2Y69H 3HRUA 3ZQFA 2CW0F 1JTXA 4E7LA 3H5AA 3ZN0A 1YVOA 1XGSA 2X6OA 5F27A 2GE3A 3MEXA 1TQPA 2KJCA 2P8TA 1LKXA 3ZCOA 1FYLA 2MLKA 2VBXA 1WWZA 1FOXA 2CQQA 2TRTA 2LH9A 5FFZA 3L1PA 2JW6A 1YRNB 2QGUA 2JA1A 1R3NA 1TWFJ 2K4BA 2RQPA 4QPOA 3CT9A 5G22A 2UZ3A 1TNSA 1IW7F 4H0EA 4XNHC 2XGEA 2CWFA 1BA5A 4XSZF 3MEKA 1ETVA 2JXDA 3OYDA 3TJQA 4OMEA 4LB6B 1YS6A 2QQBA 2O0YA 1YX0A 4PGGA 2HFHA 3LAPA 3JTGA 2QYVA 2DPTA 2JSCA 2V1CC 3ZQGA 2C27A 1JUMA 2XEGA 2IGMA 3SGBI 1M4DA 4PV6A 5AIQA 4L9VA 4V19K 2W25A 2EFPA 2DKVA 1YR0A 3AG1H 5HNFA 4MFZA 3LA7A 3SJXA 2G3TA 1ONVA 2ESHA 4H6ZA 4CGPA 2ZFWA 4B5PA 2WA0A 2EBIA 3IRRA 1BI0A 3B3SA 4AIJA 2EZIA 2HI3A 1OVOA 1FLIA 1WZ2A 2CY2A 1J09A 1QPMA 2LKPA 3RCOA 1QVUA 3SZGA 2DK8A 2HB6A 3HEFA 5CBMA 3GZ5A 4UUVA 4YFKF 1B8IA 1CM0A 3TTHA 3C2BA 4B1RA 1IXRC 1X3ZB 2GIVA 3OV8A 4RGSA 1M4GA 4OMYA 1BIBA 3REOA 2BGCA 2OD1A 2V9KA 1QVTA 3HUGA 1K78B 1QQ9A 1ARMA 3ISPA 1YLFA 2A6TA 2FE3A 3ISZA 5HMNA 3AKZA 5ICFA 2IW5A 3OIPA 4PSWA 3V7CA 4A3CJ 2MFZA 2HNHA 3D2MA 3VFZA 4LIVA 3UEYA 2DO7A 3IAS2 1STZA 2VPRA 2E5NA 3ZQ7A 1J4JA 1XIXA 3D67A 4H89A 3P2HA 2FRHA 2L0KA 1SFOJ 2PMHA 2FL4A 2Z3LA 2IA1A 1Z8TA 3S1RJ 3IWFA 4BUPA 4XIDA 1LEAA 2EB7A 3IFEA 1MMGA 2HXOA 3E1SA 1IV6A 5IT3A 1SMYF 2R7QA 1ZG3A 2GFQA 5EGOB 3I59B 2F5IA 2NOJB 1AWCA 2Y9YA 2CFXA 4PFOA 2PR1A 4FD5A 3R60A 3ELKA 4PFPA 1MKMA 1W5CC 1S60A 3PB4X 4WK8F 1YTYA 1I12A 2NU4I 2B5GB 2REEA 4K30A 3HSRA 2AQFA 4L9NA 2M3AA 1Z9UA 4P5OA 3MMYB 2XV4S 4HA8A 3RZDJ 1KU7A 2CJSC 1NSLA 3LSJA 2BYVE 4MMOA 2PQ8A 2NU1I 1WI9A 2M45A 4ZH4F 5LGUA 4A12A 4HRIA 5E17F 4NUBA 1CT2I 2GXGA 1LVKA 3FM5A 2ZPAA 3SYTA 2IP2A 3JRBA 3QP6A 4E7ZA 2VJIA 3RSNA 3AFHA 3OXGA 1Y1VJ 2JUCA 2KHMA 4XKVA 4ZYQA 2PMUA 3FXQA 4BDZA 5E1XA 5F09A 2LG4A 3M7GA 2P7CB 2IPQX 1YG2A 3HC7A 2WBMA 2P4WA 3R9EA 4KSIA 1IYKA 3X2QH 3FIWA 2V53A 3K2AA 4Y15A 2PR8A 4RB0A 4XONA 3DTIA 2YR2A 3GUDA 3HYIA 5E3NA 3D5LA 2V6CA 2EFNA 1YMEA 4AVBA 1VQPI 1M4IA 2MG4A 3PEIA 4UFXA 3EUKL 1JQGA 3M1CA 1DGWY 2XAQA 4DYOA 3OY9A 1XCVA 2E7WA 2V79A 1POGA 5F0HA 2IMOA 1XOVA 1B87A 1I3AA 4ZI6A 2DEAA 2CJJA 5E8GA 1W36C 1GV5A 2J87A 2QQAA 1M8BA 1TNTA 3BR5A 2DA2A 2DFFA 1BJAA 1S72I 1LANA 8CPAA 3GZNB 3KIOA 3G1OA 2JPBA 5GADJ 1MK4A 3KETA 1ZLJA 3O6BB 3OSFA 2LC2A 1Y1BA 1IY6A 5J47A 3PB6X 3IC1A 4NCZA 4LD5A 3FB3A 1ZGAA 4MHGA 4JBAA 4OWRB 3ZMVA 2NNNA 5FUYA 2AFOA 3MKWB 2BUEA 4PJMA 4IF5A 1W4MA 2D1HA 1T08B 3HOXJ 2UXXA 1PP7U 1AU7A 3RAMA 2KMRA 4E6KG 2Y9ZA 2HWVA 1YVKA 1S5KA 1UAAA 3GLXA 5H86A 2EVNA 2DMNA 1M4LA 3EUHA 3RKWA 2W7NA 3LL7A 5D6FA 1X4OA 2LOOA 5DS9A 3CLQA 1W0UA 1LAPA 2ZELA 4UIBA 1OJLA 2Q2EA 2B0UC 1ARLA 2EPFA 1G2HA 2F7VA 4IOAF 4BQOA 1U78A 5EDNA 2QBYB 4AIKA 4KOYA 3BPXA 3CZ6A 1WJEA 1VKCA 1CT4I 1XDUA 3CCRI 1U6MA 4KMFA 3K4NA 2JA8J 4H6UA 3W6XA 1XGMA 5JHFA 5CVVA 3HLPA 2LREA 3MQ0A 3B02A 4FWUA 4OIOF 2N52A 1P9QC 1IRZA 3MRUA 2REFA 1WPKA 4E7KA 3GF2A 2EQRA 2IS1A 1I50J 4KUMA 4EVIA 5FJ8J 4PUSA 3CUQA 3JRHA 3B7IA 4F91B 3HM5A 3KY9A 2PRQA 3UEJA 2QEXI 4E4HA 4U7DA 1WH5A 3BT9A 1BI2A 2QQDA 4R8HA 2ARHA 4FISA 3M8EA 4F0YA 2N71A 3TP0A 1IRGA 3SDBA 3SI2A 3S17J 3D1NI 3GLJA 2DDAA 2DA1A 2E1CA 4YEJA 1ON2A 2X85A 3OYLA 5J4VA 3IIBA 2A69F 3ISXA 3KP7A 3TQNA 2Z3YA 4FT8A 4GO1A 1UB9A 1MMSA 5LYDA 4XN0A 2IL4A 3VYTB 1X2NA 1T39A 2LBFA 2QQCA 5LHGA 4J3GA 4F8ZA 1IAWA 1WRJA 3E6CC 3PQJA 3OYEA 4IKFA 1MDMA 2VZYA 4Y3OA 2V8HA 1H0ZA 4R57A 3JTHA 1ENHA 4I98B 1SVOA 3A2KA 2DYSH 1ETXA 1MNDA 2F2EA 3OWTA 2J8NA 1X3UA 2J8RA 4AD9A 2VKHA 4NDLA 1UHMA 3LACA 2R5ZA 3LODA 4HNTA 4A0ZA 1HF0A 1Z8LA 1FIPA 3E0KA 1SMTA 2JZMA 2WTEA 4AMLA 4S04A 4CH7A 1OBRA 3SEQA 5EG0B 4UY8I 4CAFA 4CAWA 2FA5A 3BR1A 1UJ8A 4MHDA 1MMDA 5GTIC 3FKJA 1KU9A 5LHHA 2L4MA 3J7ZI 4FD6A 4CAXA 4UB6C 3K6GA 5HDKA 1VQ8I 2POKA 2LYCA 5TJJA 3TDUC 4NXYA 3D0SA 4B44A 3TGNA 1FNNA 2K85A 4BEHA 1UHWA 3R61A 5IPAA 1T0FA 1ULNA 1IU8A 2ABZA 1HW1A 4IHVA 1UG2A 1YLEA 5FGMA 3DBLB 2VC1A 3JRIA 1F36A 4L5IA 2AFWA 4LLNA 1VDDA 2L7MP 3B73A 3F8FA 4Y52J 3R5AA 3F8MA 3FXRA 1MNMC 2ZXVA 2ZENA 4MPIA 2DOFA 4I6ZA 4NHJA 4UXNA 4CXFA 3BG7A 3CCJI 3FEEA 2MLGA 2BY0A 4OKOA 4A37A 3LOCA 2CUZA 1RR7A 5IV0A 3S3MA 1IN6A 2ZSHB 3E7LA 5L3DA 5F04A 4XN3A 3QYFA 4HG2A 4MIMA 2D2WA 3D3SA 2PC1A 1D1CA 4MY3A 3JSOA 1IY7A 2Z2SB 2F5EA 2L7XA 2L8EA 2HEOA 2IA0A 1V1IA 2OZ6A 4HQMA 3N4MA 4AIDA 5GCNA 4MFJA 2M2EA 3RPUA 1QZYA 5E1ZB 2R5YB 4L0ZB 1SD7A 5LEKA 1HLVA 1B4AA 2P6SA 3DPLC 2E2IJ 4LQ6A 3I54A 4DBRA 3S8PA 2L02A 2OD5A 3KEYA 3OYIA 1KQ0A 3ONQA 4UUSA 2A20A 4MBUA 4B3XA 3OR2C 1XTAA 4UHTA 1IF1A 3J7AY 4GFBA 1DUXC 1UWYA 4IAVA 3KASA 4UCPA 1USSA 2BE5F 1RRJA 4RI1A 5DEQA 4AWXB 3M3YJ 4A33A 2D1VA 2AFXA 4KOWA 2PVVA 2RGVA 1BI1A 1YE9A 3KQXA 3DQVC 4M3DA 1S7KA 2EINH 1NK2P 1BPMA 1OYIA 4HSRA 4W9YA 2R4GA 2IGKA 1LJ9A 3ZRGA 5E18F 4IOCF 4HKFA 4A3BJ 1AKHB 4CAEA 4JP0A 2ESNA 1AYEA 2GREA 3BJOA 1EE3P 2AE6A 3G1MA 2HTSA 1SEUA 1SD5A 1PUAA 3RQIA 4XLNF 2E1MB 3GW2A 5DDGA 1MBGA 3O2PE 2UV1A 4BY7J 3K4KA 3VSLA 3K70C 3NH4A 4CYCA 2MC4A 1E3PA 3AL0C 1Y56A 1ETWA 4KMUX 1S7OA 2R7DA 4XMYA 5J3LA 4ITVA 1H88C 3BHXA 3MKYB 4KOUA 4Q36A 3MZYA 2Q4VA 1HSJA 4FE4A 2ZOFA 1WKMA 1ZTRA 4P9FA 3CPXA 2WGCA 3OYGA 3KP3A 1FMWA 2H6BA 1Z0XA 5ICCA 1HDDC 4OLLA 3SZTA 3B3TA 3F9KA 1ON1A 1G3WA 1UMQA 3PB8X 4AG9A 1CHOI 4QBJA 2IGNA 3ZR8X 1Z5RA 2DT6A 2EK5A 3PQKA 1NUBA 4GRIA 4AYBA 2D45A 2ELHA 2BW3B 2VRWB 2RC4A 3A01A 4XK4A 2DPUA 1XA6A 1S7FA 1IUFA 1P9ZA 5IYCJ 2IAIA 1TKJA 1MJAA 1SFKA 2DA3A 2MD0A 1MSFC 1T56A 2PRBA 3CCQI 5DCMB 3GZ6A 1WK4A 3R6SA 1FP1D 1TWHJ 3C3WA 3HKZN 2NU3I 4C68A 2M9HA 3K4BA 2ELIA 3FK6A 1MNEA 4AVAA 3OYKA 4ZX9A 4UXIA 2RFHA 2DQLA 3N97A 3V8JA 1ZRDA 4ORFA 1WI3A 2DT7B 4UVBA 2JBJA 4M6GA 4Y7NJ 1YX3A 3W2VA 2JDCA 4F52A 1P9GA 1FNOA 3WC5A 2G0EA 5M5YJ 4E0AA 5C88A 5JH9A 1FX7A 2KLOA 1G6NA 3VH9A 2STWA 1HEEA 4D7NA 3EXNA 4M6HA 1OLTA 1X58A 4Y17A 4LX9A 3M07A 2L3DA 3FRMA 1X19A 1PDNC 2AXLA 2YX7A 1VQ6I 4UV9A 4A69C 1GHEA 3LSRA 1JI8A 2X7BA 3QU6A 4FAIA 3WHCA 1GUUA 4JYWA 2FQ4A 2K9LA 3KYLA 2C6CA 4RAZA 3DSBA 1E3OC 3FF3A 3RO0A 5F0CA 2H6CA 1RIOH 2FUG2 2O61A 4PJJA 3LD2A 3PL8A 4EQQA 2GKRI 4IXAA 4FTHA 1V5EA 2PSWA 3MN8A 5CKTA 1YRNA 2C1CA 3RBUA 1QZEA 2XGXA 3MGDA 3IO1A 4PK3A 1ZR4A 1ZLIA 4F6AA 1BI3A 1GV2A 3E0JB 1Y8RB 1PP8F 4HF1A 1JGSA 3Q9VA 2OH1A 2PJ6A 3PNYA 4NGSA 3ASOH 5IY5H 2KMQA 3WR7A 2BY2A 3OXLA 2ICWG 3KPHA 3F22A 4DQ2A 3U2RA 1VI0A 2Q0OA 4W97A 3FMSA 2VZZA 4N9HA 1JGGA 1VQNI 3QOEA 3PBEA 4ZY0A 3F5BA 3FYNA 1ZLKA 1VQ9I 5M3MJ 2V9PA 4IX7A 4ANJA 4BMHA 3M1EA 3I58A 3ABUA 2MABA 3KI9A 2FBHA 5FLXZ 1MBJA 1Z91A 2DLLA 2OA4A 3U21A 3CO7C 1Q2YA 3JRDA 3D4UA 2HGCA 1TGSI 4I01A 2XSDC 3G6EI 3RI4A 1PU9A 1L3LA 2K9QA 4AU7A 2KP6A 5I0CA 2ZMEB 1VF9A
chains in the Genus database with same CATH topology
5KTAA 2QQ9A 4KT5C 3J80K 4C2XA 1FBUA 3WTUC 2HOEA 2CNMA 4BH9A 3AAFA 1ZRFA 3HRSA 1K78A 1E2XA 2Q4YA 4EJTA 2H5MA 2W84A 5FLXK 4GYIA 3QRFF 4NEXA 4CYDA 2KKOA 4A6EA 2EFWA 1XEBA 4HX4A 5CVUA 1KUYA 2COMA 4MQ9F 5DD8A 2H94A 5F47A 4G7OF 4IRIA 2QLZA 1YO5C 1LDKB 4BQAA 3EYIA 4JXQA 2QENA 5HS8A 3B8GA 3I59A 3QB8A 3BDDA 3I3GA 4KOTA 2B5GA 4MNUA 1TTYA 2FE7A 4MY0A 3KZZA 4M6YA 3FF5A 2FF4A 2ZBKA 3BP8A 4M71A 4CGZA 1Z6TA 4HNXB 5BPDA 3SXNA 4ZYHA 1QO0D 4G7ZF 5CVRA 4LG0B 1O57A 4UVCA 1FC3A 4IF4A 3EC4A 2ZO4A 2FNAA 3GWZA 2Q04A 2VN2A 3R0JA 3EQLF 2MH9A 2CWEA 4CGLA 5AG4A 4GS4A 2BEIA 4R87A 1V3FA 2VC0A 4AVCA 1RNLA 2CO5A 1R23A 3BZ6A 4KN7X 2VEZA 1SQHA 4WWCA 4YFNF 3ECOA 3P9CA 2QZ8A 1P6RA 3E6BA 3A9LA 5F64A 3BY6A 3O3KA 3V8LA 1UFMA 1Q2CA 2LSOA 4L9TA 5ERIA 2GZWA 1I27A 1FOKA 4CRYB 4EJOA 1J9IA 5K1YA 3CXPA 4XNHB 2KIFA 1BC8C 5D8LB 2QUFA 2EA4A 1U6GA 2M30A 3P9KA 4KVME 1XDSA 2R98A 4C7IA 4UWIA 1KA8A 4YGOA 4A0YA 3IL2A 5KK1A 2WWYA 5D5VB 4A6DA 4L18B 5A27A 2XKOA 1DP7P 3WTXC 3FHZA 2NRAC 3MCZA 1F9NA 1Z9CA 5DWNA 2HZTA 1KYWA 4MFLA 3K1NA 1OPCA 2Y0MA 1S7NA 3QAHA 1R57A 1TLHB 2Z5UA 3JUWA 2KJBA 4C7HA 2A61A 3K9UA 1K7AA 2YNEA 4WXCA 5HLGA 5K5OA 3GFLA 2BL1A 4G6QA 2I79A 4ENKA 2VQYA 4UWJA 3NRVA 1J2XA 2MBFA 4HLYA 5H6RA 2OU2A 1Q2DA 1N71A 3GEZA 5BS6A 5G1ZA 5J6XA 2OB0A 1IYLA 3R9FA 2J8MA 1Z4EA 4OIPF 2EUIA 4JWPA 4QLCU 1U5TB 2O6GE 2H09A 1IRFA 2HTJA 4KLWA 3NQOA 4MEXF 3ZP5A 2DTRA 4ESJA 1YS7A 2FXFA 3H5ZA 4WF2A 2PI0A 3FWEA 4IVNA 4L89A 5KVRA 3HTUA 4EV0A 4MFQA 4YFJA 4M9ZA 4AIHA 2JTVA 3W6JB 5EEHA