2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
4HBLA 2BEOA 1U2WA 6PAXA 1CF7A 4LX9A 1B59A 4K2EA 1AWCA 3P2FA 4I98B 1SMYF 2EFQA 2AS5F 5H6RA 3BJAA 2GIVA 2Z99A 2ADUA 3SFZA 1HKTA 2QBYB 3J81K 2R7DA 2JDCA 3R9GA 2VEZA 3T9YA 2IRFG 2ZW5A 3WTTC 1LB2A 4IUSA 1PUAA 2EFNA 2FXAA 2QQ9A 4IHTA 5HS8A 3WE3A 1S7FA 3ZMUA 5CVIA 3ZMSA 3RPQA 2DFIA 4AVCA 1OPCA 4Q47A 5J6XA 3RTRA 1P0HA 1K78A 4UV9A 2DU9A 1ZRCA 2PN6A 2VZZA 5DCMB 4ZBGA 4U7DA 2W57A 1S7KA 3I9SA 1KQ8A 4RI1A 2H6CA 3I58A 3EQLF 4E8OA 3HSFA 2K86A 2JSCA 4CGZA 3FXQA 1I1GA 1WKMA 1FBQA 3HSEA 1HKSA 1R5GA 2NNNA 3ZJ0A 1J75A 3E97A 4EM1A 3RYOA 1EH7A 1YQAA 3M8EA 1KU3A 4WXHA 4F0YA 2Y75A 1SMTA 3L9FA 2MLKA 2VXKA 5KK1A 3E6DA 3MEXA 1H9GA 4KOXA 3K0LA 2NS0A 5D5VB 5CVRA 2L01A 5HS7A 2VQYA 3QAHA 3IWGA 4MQ9F 2FBKA 2XAHA 2JTVA 3KP7A 3G8WA 4BMHA 3SXYA 4UWJA 2COMA 4ESJA 1BBYA 4AVBA 2JPCA 4XPDB 4UWIA 5K5OA 3TT2A 2EB7A 2VBYA 3C26A 3H4QA 4NQWA 1QBJA 1YO5C 3T5XA 4OINF 4LB6B 1BO4A 3WTWC 1S7OA 1LRZA 4B8XA 1T0FA 2CNTA 3L09A 4R1HA 2GWRA 4KZTA 2HYFA 1ULYA 2VBXA 4HA8A 4IJAA 3K9TA 5AONA 4YFXF 3R4KA 2ZCWA 4KOSA 2PBIA 2R8VA 2EK5A 5ICCA 1XMKA 3H3ZA 3LSTA 5FD6A 3F21A 5I0CA 1D8JA 2HKXA 2QENA 2JLMA 5H20A 3G73A 3KP2A 5LRRA 4ZZLA 4BYYA 1PP7U 1MK4A 2RGVA 2V79A 3K1PA 2BUEA 4FD5A 2HYGD 2F2EA 1Z05A 2LF7A 3GW2A 1GVJA 3QPTA 2Z33A 5A2QK 3COAC 4EVIA 1OYWA 3ZQ7A 3PFIA 3GVAA 4H0EA 2CNSA 2IJLA 3REOA 4MEYF 2XHKA 3CTAA 4N9HA 4CAVA 2CW0F 3S2WA 4A5MA 2PLYA 1STZA 5CVVA 4L9VA 4TV7A 1ON1A 3QU3A 5HDKA 1C0WA 5BOXA 4E2AA 2Z9OA 4CZZA 3I71A 1Z7UA 1W5TA 2FMLA 3GZ6A 4A2UA 4HQEA 4YG2F 4KUBA 1YVKA 2HKOA 2R7HA 1YK3A 3O2PE 2AJ6A 3JAMK 2FNAA 4EJVA 1R1VA 1I21A 3BJ8A 1TQPA 3G3ZA 4RB0A 3ZPLA 4F6AA 2CNMA 2HQRA 2B4DA 4RGSA 2K7LA 5E1WA 3PZJA 1Q2YA 3T8RA 2XAFA 3KZZA 1QNTA 1P4WA 3E0KA 1Z4EA 3R9FA 1T98A 3GLXA 4CAWA 1YTYA 4KDPA 1YS6A 2OQRA 2XKOA 4JXRA 3F72A 3IHUA 3WTSC 3CO6C 1W4MA 4A0YA 2OZUA 4ZYEA 4M6XA 1ZHFA 1YREA 1X3UA 1FYLA 2TDXA 3R61A 2REFA 5K5RA 1KYWA 2STWA 4EVYA 2QUFA 2J8RA 3VEPA 4WK8F 1I12A 2HQNA 1SFEA 3QU6A 1B9MA 2RKHA 4BHPA 4QVTA 4J3GA 3T0YA 3MWMA 1BI3A 2GXGA 4E70A 5KTDA 1RI7A 2L02A 2P6GA 1S29A 2MA3A 5IT9K 2WC2A 2V6CA 1Z6TA 1IIDA 4KICA 2Y48A 4G7HF 5E1ZB 1M4IA 2Q4YA 3T1BA 1FP1D 1BIAA 3T8TA 2O03A 1SQHA 3N4MA 3LAPA 1K79A 3ROUA 3IL2A 1FBUA 3B02A 4WXCA 5FD5A 1Z1DA 2F5IA 1FSEA 4L9NA 2IA1A 1Z91A 1ZLJA 5CNPA 1OMIA 4A0ZA 3SZPA 3GX4X 3MQ0A 2E1CA 4D0PA 1CM0A 2VONA 2XKPA 2ZNYA 3RPUA 4ETSA 3KLNA 4WX9A 2LF8A 2P0WA 2IT0A 4UVAA 3V7SA 4XPKA 2PR1A 1RZ4A 2QMLA 2GA1A 2CWEA 3FXTA 4KLVA 3M7GA 1IICA 3E6CC 3O6BB 1W5SA 4KUMA 3D2MA 3RKXA 2K4BA 2QIRA 3IKVA 3SHFA 2BBYA 5HOOA 3QOPA 2O6GE 1FY7A 1HKQA 1P4XA 5IB0A 4DNCA 1DP7P 1L0OC 3IRQA 2YU3A 3BDDA 3JVNA 1O7FA 2ZO4A 3KFWX 3FM5A 3M9AA 3CUQA 3BWGA 3I54A 2PJPA 4U0YA 3GYAA 3EUHA 4MNUA 3NEUA 2B58A 4PDKA 1S5KA 4A5NA 2Q2EA 2DTRA 2Q44A 2JPBA 2H09A 4U9ZA 3EETA 3T90A 1LNWA 2E7WA 4I7HA 3P2HA 1XDSA 4A6DA 4M9SA 4MQVA 3GEZA 1XGOA 1CF7B 4IPAA 4M74A 4P9UA 1BC7C 1KQ0A 2MBFA 3JW4A 4O6JA 2PR8A 4P96A 3V8KA 3P9KA 2A68F 2VOOA 5IT3A 3NQOA 1OYYA 1PDNC 2XIGA 4MEXF 4MY3A 2G7UA 1ZAOA 2FU4A 4YFKF 4Q4ZF 1ON2A 2P6SA 1K78B 1ZGJA 3B73A 3GZ5A 5L3GA 2PRBA 5D8LB 4CDGA 4GO1A 4MTEA 5D8KB 3KP3A 4EJTA 2QWWA 2NAZA 3F8NA 2UWMA 1MJBA 4YGOA 4II9A 3ZN1A 5J8FA 2DK8A 1S7LA 4UHTA 2X7BA 3P7NA 4EGYA 3R95A 2NMTA 2A3SA 4KIFA 3J80K 3G3SA 3V8JA 2PEXA 4OMYA 3GFLA 5AIQA 1BI1A 4GYIA 2RDPA 4AVAA 3TKYA 1EV7A 2I79A 1XGSA 3WTVC 3N97A 2KKOA 4HDVA 4L5IA 2R7FA 2DPUA 1SD6A 2OZHA 3KETA 3Q9SA 1WWZA 3OV8A 3CDHA 4NHJA 5E20A 2Q7BA 3FNCA 3I59A 3DXJF 5JQ4A 1DPRA 2H5MA 4RS2A 2EJRA 4ENKA 1J9IA 4OIRF 1SD5A 1U6MA 5DWNA 3TO7A 1HSJA 3FX3A 1ZG3A 1ZRDA 4CO8A 5EEHA 3CO7C 3GKRA 1G3SA 5LLQA 2GXBA 4XRFA 4KA4A 4OAEA 5HH1A 4KIGA 2BSWA 4E0AA 4PZJA 3OOPA 3D0SA 2VBQA 2ZXJA 3K9UA 1HW2A 2F5EA 5BQTA 3GWZA 3GFJA 4IRGA 1XGMA 2FE3A 1A04A 5LRSA 3RYPA 5E8IA 2XASA 4I2OA 1IW7F 4Q48A 3HUGA 2Q04A 2B3UA 3MAJA 4KOWA 5HVQC 3F22A 2FIAA 3WTZA 1QSNA 1JXSA 5CYVA 1BN5A 1H9TA 5HLIA 1QGPA 3DNSA 1K6OA 1MJ9A 3L7WA 1R22A 1IYLA 3TTHA 4KLWA 3U2RA 1YLFA 4KOUA 4DQ2A 3R6SA 4HX8A 2GAUA 1LVAA 2B0LA 3BROA 3I5UA 4MGRA 1XSDA 1F1ZA 4EM2A 1P4NA 3WTYC 3LFKA 1O3RA 3QRFF 4FHTA 2ZMEA 4AIJA 2HZTA 3KCCA 2D4OA 2V1DA 2W84A 1RUOA 2R98A 4B5PA 4R57A 3VWEA 2FNPA 1QSMA 4EM0B 1XN7A 1S3JA 2HTJA 3VB2A 2EV6A 1ONVA 2FCKA 1YLEA 4KVXA 2PSWA 1R58A 3EY5A 4QLCU 2B4DB 2DT5A 5LEKA 5L3FA 2RC4A 2C6YA 3V8LA 1KGSA 2NYXA 4PK2A 4NXYA 5E8GA 1JE8A 4HNWB 4KUAA 4HF1A 2VE9A 3DKWA 4I0BA 1OYIA 2XUBA 5K1YA 3WE2A 1TBXA 3FMRA 1KQ9A 1JGSA 1FYKA 2DBBA 1S7AA 3TOBA 1SFXA 1YX0A 2K02A 2P7VB 1CGPA 3MGDA 4CS0B 4Z2YA 3BOQA 4Y17A 3BPXA 1R36A 3R9EA 3HYIA 4BHBA 3GFMA 3SXOA 1B1BA 3BLNA 1LDJA 3ZMVA 3IC7A 2ZXVA 2KIUA 4PCQA 4XNHC 5BPDA 4PSXA 1ZREA 2GZWA 2P4WA 4RAYA 4ZYHA 2ISZA 2HUZA 1QO0D 3LA2A 5CJ9A 4JBAA 4WCGA 3GF2A 2HTSA 4M9XA 4FX0A 4UBRA 3EDPA 2QQBA 2D45A 4IVNA 4PSWA 1Q2DA 1DDNA 4M9ZA 3GYHX 2FOKA 2G3TA 3P9IA 5JR3A 1REPC 3K69A 4KMUX 2BE5F 3V7RA 3R0JA 4UXNA 3QP5A 5FLXK 2E7XA 2WTEA 1GHEA 2EV0A 4WF2A 4L9TA 5FFXA 1RUNA 4R3KA 1Q2CA 3V8IA 3TE4A 1EH8A 3MCZA 2EA4A 1V0CA 4GYGA 2A61A 1SD4A 1LJ9A 3FRMA 1O3TA 2ARHA 3VOEA 4EJUA 2OH1A 4AG7A 3JAMZ 4XLNF 4RAZA 2B3VA 3O3KA 2ZKZA 3FIXA 5FB2A 5LEJA 4LB5A 5LGNA 1T2KA 3F6VA 3CUQB 5F6FA 2B5GB 1R57A 5D4SA 4QBJA 5IV0A 1MD0A 2MC3A 4ASNA 4GS4A 3MZHA 1FBSA 1ZARA 4EQQA 2BEIA 3ECHA 4Y49C 2KIFA 4UUVA 3E5UA 4B5OA 3FXRA 4A6EA 1MDMA 3HRSA 2IVMA 2FBIA 2W85A 5FO5A 5LGTA 4WWCA 1Y7RA 4I01A 3U9GA 3CUQC 5KVRA 2XVCA 1IYKA 1FLIA 1MZBA 2VBZA 2ATRA 4FD7A 5LHGA 4LG0A 4UVCA 1J5YA 2PMUA 4NEXA 1HBXG 3F0AA 4RB3C 4MJ8A 4PV6A 2FXFA 2VBWA 5ICEA 4ESFA 5EC4A 4OIQF 1U5TC 5F49A 2OZ6A 2FE7A 3B8GA 3KP4A 4U0VA 2YX4A 3V7CA 3BY6A 3ULQB 1XSVA 4HQMA 4ORFA 2RQPA 2STTA 4G6QA 4AIKA 1M4DA 2LSOA 1AOYA 2HQYA 4RGXA 4XSZF 3FBUA 1I1SA 2CQKA 3J7AO 4K30A 4S04A 4I49A 1P6RA 3TQNA 3DFGA 2MLGA 2IPQX 1YR0A 3TOAA 3SHPA 1OKRA 1UHMA 4YRHA 3RIRA 5CVUA 1USTA 4HKFA 1CJWA 2A6EF 1U6GA 2F5DA 4MHGA 4YFJA 2Z5UA 1BM9A 3D5LA 5K5QA 3WGIA 3GFIA 3UY5A 2Q0OA 3U1DA 4I0AA 1P4AA 3H92A 4P5OA 1U8RA 2C27A 3I59B 1ZG5A 1O57A 2O0YA 3CJNA 5EBVA 1XIXA 4BH9A 1UCRA 3SZTA 4OIPF 1KU9A 2YR2A 5DYMA 4H6ZA 1J2XA 4GGGA 4L0ZB 3D2PA 1KZFA 2OAZA 3RKWA 4O3MA 5BS6A 4ENNA 2FSRA 2ZW4A 5C88A 1IN7A 2CG4A 4EGZA 1FNNA 4ENJA 1G4DA 2FEZA 1S3ZA 2L3DA 3FMQA 3FZVA 3NE7A 2OD5A 3IKTA 2LNBA 3LQQA 1FP2A 5EEGA 1XE4A 1J0RA 1WQ2A 3S6GA 2V9VA 4JLYA 2DK5A 2ACJA 5E17F 1J59A 2M8EA 3F8CA 3M8FA 2LKPA 3KE2A 2HWVA 2QQAA 3FF5A 3FHZA 1TW2A 2K5TA 4OLLA 3L2CA 1K4JA 2QLZA 4JQFA 4OMZA 2DW4A 5IX3A 3HRMA 3FYNA 1PUEE 4PK3A 1XMAA 1U5TA 2UXNA 3CXQA 3HTSB 1FZPB 2DI3A 3RKYA 1O3SA 4BQAA 2IW5A 2ESNA 1UHWA 3BZ6A 4CRYB 2ZPAA 3HHGA 5DDGA 4HYEA 5LBQA 1IN8A 2RVCA 4LUAA 2ESHA 2R3SA 3MFKA 3L00A 3KLOA 1M1DA 4U5YA 2VOPA 2VN2A 1WRJA 4MY0A 1LDDA 4I09A 3ECOA 2CYYA 1QSOA 3HOSA 4BAYA 1FOKA 2DQRA 4IF4A 2EVNA 2EUIA 2X0LA 4LMYA 1NHAA 5J8CA 2HOEA 4B5PB 2Q0YA 1XDUA 4LFUA 4Y13A 5F47A 3JSOA 1ZH5A 2H6BA 2WV0A 4P9FA 2P6TA 4RGUA 3F23A 1I6XA 4N9IA 3ZMDA 1SAXA 1H0MA 2XV4S 1W7PA 2BGCA 2G9WA 1UFHA 1ZN2A 3LA7A 4OU0A 4MHDA 1ZGAA 1T38A 2P5KA 4HLXA 3WR7A 3BP8A 2KJCA 1XD7A 1ZLKA 3WU0A 1TNSA 3R96A 1G6NA 1TW3A 2FIWA 1Z6RA 3WTXC 5F64A 4QB9A 5DWMA 4OADA 3ERED 4KOYA 2AXLA 2Y0MA 5ISVA 2Z0ZA 2A5YB 2J8NA 2P8TA 4XSXF 4YIIA 4G8XA 2ZBKA 4LGWA 1EH6A 3W91A 2DXQA 5DUIA 4L89A 5LHIA 1RIOH 1G3YA 2HFHA 1IF1A 2OZGA 2YPRA 3VODA 2QVOA 1BIBA 1TTYA 3DPTA 2JEVA 2D1VA 3D3SA 2CY2A 1QSTA 4FD6A 1XF8A 2M5WA 5D5UB 3WGGA 1E2XA 5LHHA 4ENMA 4NB5A 4AVPA 2O3FA 1YS7A 2CO5A 3EYYA 2GQQA 4LLNA 1HW5A 5FVJA 3E5QA 1IB1E 4RGRA 2IA0A 2P6EA 4A0XA 3J81Z 1R23A 2OBPA 2ZJ2A 2CFXA 2Z11A 1YVOA 1FC3A 3F6OA 4LK1F 2R1IA 4H89A 2MH9A 4R3LA 5H86A 2QYOA 3IWZA 3ZZIA 4KOVA 4ESBA 4ZYDA 4ZH4F 2I00A 3KP5A 1GHCA 2BYVE 3I53A 2FA5A 3DPLC 5D6EA 4BXUA 2OB0A 2FBHA 1U78A 3LD2A 1F4KA 4KVOE 3TDZC 5JPHA 1RXTA 5E18F 1P2FA 3MZYA 3I0TA 2G0BA 3FM3A 3KZYA 2DQLA 3E6MA 1E17A 5GCNA 1YG2A 4IHSA 4L8AA 2VT3A 2J8MA 4X5KA 3GO5A 3KP6A 4AB7A 3W6XA 3S6HA 1BI2A 1J7KA 2W24A 4PGGA 3F5BA 3S6FA 3EC4A 1TQMA 3WU1B 1YW9A 1MJAA 4BNCA 1MGTA 1MDMB 1T39A 5E1XA 3I4PA 2WWYA 4F7ZA 2XRNA 2IP2A 1RNLA 4FT8A 3CXPA 1F9NA 5CVJA 2A69F 1D8KA 2VI7A 1S7NA 4XLPF 2DO7A 4M3SA 3VFZA 3GUDA 4LG0B 3DSBA 3PQKA 2HDCA 3FXUA 1DUXC 3W6SA 4O5VA 2GE3A 3CUOA 3FMSA 2DLLA 5L3DA 2D4PA 2ELHA 3DR8A 3JTGA 1IXRC 1NE9A 5FGMA 3R0AA 2RV8A 4WXDA 1BC8C 4M72A 1QPMA 3ML6A 4AD9A 1W7PD 4HLYA 3TO6A 4G6DA 2J5OA 3ZMTA 3HRUA 5HDNA 1OZPA 3HTUA 4ON0A 1UFMA 3JTHA 1G3TA 1I5ZA 4XNHB 4LD5A 3WODF 2J5PA 1KA8A 4EMSA 4HAMA 1BJAA 3DV8A 2FL4A 4KORA 2HGCA 1KU7A 4KYWA 3EXNA 3IWFA 3HOTA 3EYIA 1S60A 4QUSA 2A6HF 3ISPA 1YIOA 2EV5A 3TO9A 3JSPA 1YW7A 2H94A 1TIQA 5FLXZ 4R9MA 5DUKA 1GXQA 4QWQA 2UZKA 1FPQA 2XROA 4RB1A 2PFBA 3DR6A 4ZZDA 4U9YA 1T6SA 4L5JA 4R87A 1I1DA 1IN4A 4GXOA 4PGHA 2H27A 4M85A 2ZW7A 2FQ3A 4ZYGA 4KIBA 4HNYB 4LJZF 1ON0A 4IXAA 2G7HA 4L9JA 5A2QZ 2PI0A 4XPLA 2V1UA 4G7OF 3PQJA 1HW1A 2ETHA 1K7AA 3ABUA 2JZYA 2VODA 1HXDA 4NCZA 1XEBA 2LDUA 3IRRA 4HV6A 1JHHA 2JDDA 1R1TA 1V3FA 1IN5A 5LGUA 2O61A 3GY9A 4QC6A 4XPDC 3VWDA 3HRTA 1IRFA 3HSRA 2VE8A 1XB4A 4ONUA 4RB2C 3DQVC 1XCBA 3DP7A 1USSA 1IRGA 4HOBA 4KN7X 4KFCA 2FRHA 1IXCA 4Y49B 2ZFWA 4YIFA 4NSQA 3AAFA 2OA4A 2M45A 5HLGA 2ISYA 2F5FA 4AIHA 5KTAA 1JHFA 2OQGA 4HF0A 4JWPA 5F1RA 1GXPA 1KUVA 1NSLA 3I64A 1U3EM 1FSHA 5ICFA 2EFWA 1LQ1A 3PP9A 1MKMA 2O8XA 3LA3A 1YYVA 2PC1A 2VZYA 2QZ8A 2XGXA 1XMTA 2EFPA 5BMZA 3BJ7A 2Q8KA 1U5TB 2QBYA 1YGHA 3K1MA 2L4AA 4KNYA 4HZFA 5FFZA 1D3YA 2Q4VA 4NF1A 4UNOA 5HLHA 1M4GA 1M44A 3FB3A 1IUYA 5HMNA 2VC1A 4G7ZF 1ZG1A 5DCFA 3BJ6A 1B6AA 4IF5A 4AWXB 4L18B 2HEOA 1L0CA 3M1EA 5IT9Z 5DCMA 2NRAC 3LQRA 3SXNA 3WG9A 3N7ZA 4MTDA 2FF4A 2RNJA 1IZ1A 1HQCA 1Z9UA 2M1BA 5HS9A 1LEBA 5CLSA 3ZP5A 5HDGA 3D8PA 2REEA 5D5XB 4M73A 5L3CA 3ZMZA 2D2WA 4KVME 3LAJA 1QZYA 1W7PB 5DEQA 5ILSA 4HW0A 2L4MA 1TNTA 1BOAA 4Y15A 4OIOF 2MH2A 4JXQA 3CXSA 2E1NA 3E6BA 4GCVA 3TFYA 2PG4A 5L3EA 1B9NA 4N0BA 3S6KA 4EV0A 3EO4A 2GA2A 2PDOA 1S8NA 4IRHA 2JT1A 2K27A 3LWFA 1UB9A 2D1HA 4Q5SF 5H84A 3GXOA 1B4AA 3W6JB 4KT5C 3RI4A 2IL4A 4EJOA 5DD8A 1TLHB 2OU2A 2EA2A 4JK1X 4U88A 2YX7A 1WSUA 1VHSA 3RDIA 2Z3YA 5JI6A 2JRTA 1QSRA 3E5XA 5ED4A 4M6YA 1QZZA 3ELKA 2M30A 4G9YA 3JUWA 3QPHA 2GANA 2DPDA 1Y0UA 3NRVA 1KU2A 2F5CA 5JFRA 5ILVA 2FT0A 2PQ8A 3DF8A 4CHUA 5DV5A 4HNXB 1R5HA 4FD4A 1KUXA 2KIMA 2M87A 5L3BA 4HF2A 3F8BA 3KEQA 1Z4RA 3FWEA 1O7LA 4CICA 5ICGA 1S6LA 1FYMA 1XSXA 1L3LA 1Y9WA 3TDUC 1VTNC 3PGPA 3LODA 4JD6A 5JVTA 2KRFA 2X4HA 1TQIA 4S05A 2WPWA 1QQIA 2P5VA 2AE6A 2UXXA 3TCVA 4YFNF 1SFUA 5KTCA 3OWCA 1IAWA 2ZNZA 3ZN0A 2B5GA 1ZRFA 4OOIA 4UV8A 5ILUA 3WGHA 4CRZB 4UA3A 1RO5A 5DD4A 1B6BA 5C82A 5BPIA 4EJWA 3Q9VA 2XAJA 1BOBA 2NNYA 1DPUA 1P92A 3KEOA 1I27A 4IRIA 4R79A 1G3WA 3J80Z 1WWXA 2DAOA 4U0WA 5TRDA 2ZMEB 3TGNA 1D5VA 2CGPA 1NMTA 1VKCA 4R8HA 1FX7A 1F5TA 4KOTA 4A12A 1J4JA 2XAQA 1ZYRF 2HV2A 1HSTA 3CLOA 1R00A 4B09A 4L0YB 4M71A 2B4BA 2O28A 4H6UA 1Z9CA 1IXSB 3W6KB 4LLGF 4CXFA 2RN7A 2VC0A 4HX4A 4KN4X 3P9CA 1WI9A 3H3UA 2K4JA 1BI0A 4XBFA 3BPVA 3F8FA 2BV6A 5H6QA 2KJBA 1ODDA 2PMHA 1IN6A 1R7JA 2VXZA 5F46A 5D5WB 5D6FA 2FMYA 3ABTA 1LDKB 1OR7A 4JJXA 3Q5FA 3RYRA 4P55A 2W25A 4I02A 5AIPA 5E96A 4HDUA 3DEUA 4BHCA 3E3VA 4LLLA 2QECA 3V4GA 3SQNA 2XAGA 4AG9A 2G3AA 1LEAA 2V1XA 3KKWA 1YW8A 4HX7A 5ERIA 1KUYA 4RS8A 3K1NA 1FT9A 3RJPA 2Z10A 5JHUA 1XGNA 4FX4A 1SD7A 1PP8F 4U7BA 3C3WA 3C1DA 3I3GA 3C18A 3R1KA 1O3QA 4KMFA 2L54A 1FWZA 3F8MA 2EWNA 2A4NA 4G94A 2FS5A 2P5LC 4MI4A 2ZW6A 1Q1HA 1XCVA 3QP6A 1B87A 3EFAA 1Y9KA 5D4RA 2P7CB 2KCWA 2MD5A 3K2ZA 2A07F 5F48A 4CYDA 2VT2A 3HIFA 3C7JA 3F3XA 2QM3A 2CSOA 3QB8A 2EFOA 2HS5A 5TJJA 3DDDA 1PU9A 4HV5A 3WTUC 3HHHA 2HR3A 1R1UA 3R60A 3BJOA 4MBUA 2P6FA 2WPXA 3IGRA 1N71A 4CAXA 1KYZA 2BL1A 1WK4A 1V4RA 4LK0F 2FSWA 2YSRA 2IA2A 1YFHA 4UVBA 3F8KA
chains in the Genus database with same CATH superfamily
2ZSIB 4HBLA 4F9VA 4H4KC 3OYDA 2BEOA 1U2WA 4XK4A 1CF7A 2ZJPF 1FJLA 6PAXA 4DOZA 4LX9A 1B59A 4K2EA 4F93B 1AWCA 3P2FA 4R76A 4I98B 1SMYF 2EFQA 3GMEA 2AS5F 4G1PA 5H6RA 3BJAA 5LYIA 2GIVA 2XAUA 2ADUA 2CFOA 2Z99A 3SFZA 1HKTA 2QBYB 3FHNA 3J81K 1Z0XA 1Y8QB 4A94A 3N5FA 2R7DA 3L2VA 2JDCA 3R9GA 2VEZA 4XMYA 3BI1A 2XPUA 3D68A 3T9YA 2HOTA 2IRFG 2ZW5A 4B10A 3WTTC 1LB2A 3MRUA 4IUSA 2N52A 1PUAA 4EWTA 2EFNA 2FXAA 2QQ9A 3BZCA 4IHTA 5HS8A 1UJ8A 3NWTA 3QWLA 3WE3A 2DMNA 5CVIA 3ZMUA 1S7FA 3PUBA 3ZMSA 2Z2SB 3RPQA 2ENZA 2DJIA 5LRJA 3TL4X 4UUTA 2DFIA 4IEJA 4AVCA 2E19A 2XSJC 1U8BA 2NU4I 1OPCA 1AHDP 4Q47A 2X3TA 5J6XA 3RTRA 5F04A 4Q7AA 5IP6A 1P0HA 3DWLE 1ULKA 1K78A 2LYCA 2DU9A 4UV9A 1R4MB 1ZRCA 1UG2A 2PN6A 4UXHA 2VZZA 1Y0RA 5DCMB 4ZBGA 1FAQA 1H88C 4U7DA 2W57A 3OIQA 4A3DJ 4F91B 3MVPA 1CPXA 3HKZA 1S7KA 2WAFA 3I9SA 1DE4C 3NWSA 4NC6A 3AG1H 2GLFA 1KQ8A 4RI1A 3K4LA 2H6CA 3I58A 3EQLF 4E8OA 3W2AA 1PCAA 1FTTA 3HSFA 2K86A 2LBFA 4B3XA 1W36C 2I3CA 4A37A 2XF5A 2JSCA 4NUBA 4CGZA 3FXQA 1I1GA 2DEAA 1WKMA 2KMPA 4C2YA 1FBQA 1QVUA 1LFWA 2EIJH 3HSEA 2QQ8A 1HKSA 3MKLA 2XSDC 5JHWC 2KHMA 1R5GA 2NNNA 2L9VA 3ZJ0A 1APLC 1Z3XA 1J75A 1OCZH 3E97A 4EM1A 1H89C 1XMBA 3RYOA 1EH7A 1YQAA 3M8EA 1KU3A 4WXHA 2HPMA 2L5QA 2PIZA 4F0YA 2Y75A 3S15J 1SMTA 1FIAA 3L9FA 2MLKA 4GI3C 4A95A 4XORA 1VQOI 1ARLA 2OR4A 2E5RA 2VXKA 5KK1A 1T56A 3E6DA 3MEXA 2ZEPA 2E34A 1BW6A 1H9GA 4KOXA 1M4LA 3K0LA 2NS0A 8CPAA 5D5VB 4E6KG 5CVRA 3ZCOA 2L01A 4GM5A 2ID6A 1ETOA 4B1RA 5HS7A 2VQYA 2V8HA 3S1RJ 3QAHA 2BO9A 1BL0A 2M5XA 2DTZA 2X51A 2C1CA 5EX0A 3IWGA 3LSGA 1OCPA 4FWUA 3X2QH 2PMZN 4MQ9F 1D5YA 2FBKA 2XAHA 4BEHA 5D8NA 2JTVA 3A9LA 3OYJA 2BZTA 5FKMA 3KP7A 3CCJI 5KNLA 2W1OA 3SXYA 3G8WA 4UWJA 2COMA 4BMHA 2Z3LA 1GV2A 3RCOA 1YMEA 5FRNA 2RREA 4ESJA 1BBYA 2M34A 4AVBA 3S2HJ 3FX6A 4OC1A 2JPCA 1GYTA 5KAIC 4XPDB 2YS9A 4UWIA 5K5OA 1N25A 1VI0A 3OYHA 3TT2A 2EB7A 2OV7A 2Q4ZA 2EIMH 3HG9A 2VBYA 1UELB 3HPHA 3C26A 4MFLA 4MPIA 4CGNA 4XQFA 3H4QA 1Q9BA 4NQWA 4CGPA 1QBJA 1ETXA 1YO5C 1QQ9A 3VPRA 1LAPA 3T5XA 4QTRA 1R4NB 2IS4A 5B1BH 5CCMA 1YW6A 4OINF 3WABA 4LB6B 1BO4A 3WTWC 3F9KA 1S7OA 3P5JA 1LRZA 4B8XA 1T0FA 2CNTA 1PUFB 3BT9A 2VPRA 3L09A 2A05A 2GWRA 4R1HA 1VDDA 2R5ZA 4KZTA 2EQRA 5FUYA 1X3ZB 3CCMI 2KRCA 2HYFA 3BTIA 4P4EA 4K3NA 1ULYA 2VBXA 2V7FA 3L2QA 4HA8A 1DQUA 4I99C 4IJAA 1Y1WJ 3K9TA 5AONA 4YFXF 3PDNA 3GTPJ 4UEZA 3HEFA 3R4KA 5B66C 2R7OA 3FKJA 4D7MA 2ZCWA 1DS3I 4KOSA 3DTEA 2PBIA 2JZMA 2R8VA 3FXMA 2EK5A 5ICCA 3A01B 1XMKA 2O8KA 1WPKA 3H3ZA 3LSTA 3H1CA 5FD6A 3K4KA 3F21A 1D8JA 4MCPA 5I0CA 2HKXA 2KFDA 4XL9A 2QENA 2JLMA 3BR1A 3BC8A 5H20A 5J4VA 2RNGA 3G73A 2E2JJ 4XN3A 3KP2A 5LRRA 1S5LC 4UUSB 3MKZA 1RETA 2OD1A 3JRAA 3E0KA 4ZZLA 4BYYA 1PP7U 1MK4A 3FXKA 2RGVA 2V79A 3K1PA 2DKVA 1RR7A 4JYKA 2BUEA 4FD5A 4X3RA 2HYGD 2BVMA 1Z05A 2F2EA 1BR1A 4IHWA 5G20A 1ETQA 5HXDA 2LF7A 2OTLI 3GW2A 1FYBA 4CAFA 4XN0A 2ME6A 1GVJA 3QPTA 4II2A 2Z33A 3GTMJ 4ITVA 5A2QK 3COAC 4EVIA 1OYWA 3ZQ7A 5KCMA 5C4XJ 3PFIA 3GVAA 4X1EA 5M3MJ 4H0EA 2IJLA 3REOA 1LFUP 4MEYF 2CNSA 2XHKA 4XOTA 3CTAA 4N9HA 4CAVA 1X58A 2CW0F 3S2WA 4A5MA 2XPWA 2RAEA 3G1LA 2PLYA 2COBA 1STZA 5CVVA 4L9VA 4F3QA 4TV7A 1P9ZA 1ON1A 2NVQJ 4C30A 3KZIC 1V1HA 2W0TA 3QU3A 1TF8A 5HDKA 1C0WA 4V2GA 3FISA 5BOXA 4II3A 4E2AA 2F7VA 3ABKH 2LEOA 1VQ4I 2Z9OA 2CIJA 4BQQA 1H8AC 1WH5A 4CZZA 3I71A 1Z7UA 1W5TA 3SEQA 2FMLA 1MMSA 2PVWA 3GZ6A 4A2UA 2VASA 4HQEA 3PUFA 4YG2F 4KUBA 5HNHA 2N17A 4MHYA 2ERWA 3H5ZA 1YVKA 2HKOA 3OYKA 2R7HA 3PFEA 1YK3A 3O2PE 1BR2A 5GADJ 2AJ6A 1VQLI 3JAMK 2FNAA 1ZG8A 2LUYA 4EJVA 1R1VA 1A2ZA 1I21A 3BJ8A 1TQPA 3UR3C 3G3ZA 4RB0A 1JT0A 3ZPLA 3E59A 3FF3A 3KL9A 2W00A 1EKEA 1VQ6I 1R3NA 2ZEHA 4F6AA 3LSKA 3EUHC 2CNMA 2AFSA 4FUUA 2K9MA 2HQRA 2X6WA 1Z7LA 2B4DA 4RGSA 5AG7A 2K7LA 5E1WA 4UXIA 4ZJZA 2V53A 1Q2YA 3PZJA 5JH9A 3TP3A 3T8RA 1WHUA 4BXXJ 1FIPA 2XAFA 3KZZA 2CQXA 1QNTA 1P4WA 4FE4A 2LR8A 1BPMA 2VLAA 1Z4EA 1T98A 3GLXA 2CJJA 4BE2A 2P6AC 3R9FA 4CAWA 3PFYA 1YTYA 4KDPA 1XBTA 2GVIA 1YS6A 2OQRA 5E3RA 2KL4A 2XKOA 2Q43A 2GBYA 3J7AY 2Y2ZA 3IAM2 4JXRA 3F72A 3IHUA 3WTSC 3LSRA 5G22A 3OIOA 1HC8A 3SJFA 3CO6C 3D00A 5E3QA 1W4MA 1Z67A 2NSMA 2Z3OA 2GXAA 4A0YA 2OZUA 4ZYEA 4M6XA 3V42A 1ZHFA 2K40A 1YREA 1U9OA 1X3UA 2TDXA 3R61A 1XC5A 2Y0SN 3E1SA 1FYLA 4B6DA 4DJLA 4CSWA 5FKNA 5K5RA 4ZDOA 1MBFA 2REFA 1KYWA 1MBJA 2D5VA 2STWA 4EVYA 3PIOF 2QUFA 1NK2P 2J8RA 3VEPA 4WK8F 1I12A 3NARA 2HQNA 1SFEA 3ZOBA 3QU6A 1B9MA 2RKHA 4BHPA 3M3YJ 1CHOI 2JSPA 2W48A 4GXHA 2M9HA 3TEDA 3SGQI 4J3GA 4QVTA 5G1ZA 1VQMI 3OYEA 1LOKA 3DCFA 3T0YA 4PJNA 3MWMA 4QSHA 1BI3A 2GXGA 3KPHA 3F0CA 4E70A 1IV6A 1Z21A 2NYQA 1RI7A 2K3FA 5AG5A 5KTDA 2L02A 4Z65A 4NBQA 2BHYA 1NG7A 1WGXA 2P6GA 3CZXA 1S29A 3IO1A 2DPTA 2MA3A 3S93A 2CV1A 5IT9K 2GOXB 2WC2A 3ASOH 2V6CA 1Z6TA 1IIDA 4KICA 2Y48A 4G7HF 5E1ZB 4ZYAA 1M4IA 1ZO0A 1MH3A 2Q4YA 3T1BA 1FP1D 1BIAA 2M8GX 3T8TA 4A39A 2O03A 3HB9A 3OOUA 3I4NJ 1SQHA 5FJ8J 3N4MA 3D66A 3LAPA 1TBNA 5EJCA 2ANPA 3AG4H 5EYRA 2V77A 1K79A 3ROUA 2XGDA 1IRZA 3IL2A 2V6EA 4FASD 1FBUA 3B02A 3LSMA 4WXCA 2LP0A 5FD5A 4PXCA 3K70D 2X6YA 5J4YA 1Z1DA 2AFMA 2F5IA 5EX3A 1FSEA 2Y69H 1P9GA 4L9NA 2GU2A 2IQ6A 5EDNA 3BG9A 2F4OB 2IA1A 2CU7A 1Z91A 4DBQA 2CJSC 4D7NA 1ZLJA 5CNPA 2NU3I 1OMIA 4A0ZA 4E1RA 2ABZA 3SZPA 3GX4X 5IYDJ 3MQ0A 2E1CA 4D0PA 1MT1A 3S1NJ 2E60A 3G1OA 1CM0A 1X4OA 2VONA 2XKPA 2YUSA 2ZNYA 3RPUA 4ETSA 1YI2I 3KLNA 2AFWA 3RZAA 2VXDA 4WX9A 2R5YB 2IGOA 1SFKA 2A5WA 2HNHA 4QPOA 3LSPA 1CGII 2LF8A 1YE9A 2P0WA 3VDXA 2IT0A 4UVAA 2F3CI 2LY9A 2KPMA 3V7SA 4XPKA 2PR1A 1RZ4A 4D1QA 4DGWB 2GA1A 1K7TA 2QMLA 2ZXHA 2CWEA 2PJ9A 3CDXA 1GV5A 2XEJA 3FXTA 5FUWA 3A0BC 2DFFA 1GT0C 4KLVA 4NGQA 3M7GA 1IICA 3E6CC 3O6BB 1W5SA 2QF7A 4D9JA 4KUMA 3D2MA 2V4JC 2K4BA 1SVMA 1I3QJ 3RKXA 1R43A 3IKVA 3SHFA 2QIRA 1Y6IA 2BBYA 4DW6A 5HOOA 4X0GA 3QOPA 4LG3A 5IY5H 2JN6A 4XICA 2O6GE 1FY7A 4E1PA 2NS7A 1ETYA 1HKQA 1P4XA 2R7ZJ 4DUKA 4DNCA 1DP7P 1NG6A 5IB0A 2EH3A 4XKWA 2PJ3A 3AL0C 3SJEA 4R8FA 1L0OC 3IRQA 2YU3A 2B63J 1WFXA 3D5SC 1TURA 4UEFA 3BDDA 3JVNA 1O7FA 2ZO4A 3KFWX 2X9DA 3FM5A 3B35A 3M9AA 4MFJA 3CUQA 3BWGA 3I54A 5THWA 2PJPA 3K4BA 4AYBN 1JKQC 3RU0A 3GTQJ 3M07A 4QIWN 1M1EB 2WBMA 4U0YA 3GYAA 3S17J 3EUHA 4MNUA 2LB7A 4DYQA 3WC7A 3NEUA 2B58A 4PDKA 5FROA 4TNUA 1LFBA 1S5KA 4A5NA 2Q2EA 2DTRA 1I6HJ 3VYUB 2JPBA 2PJAA 2H09A 2Q44A 4F9UA 4U9ZA 3KX2A 3EETA 3T90A 1LNWA 2E7WA 4KSIA 2K85A 4HGUA 4I7HA 1Z2IA 3P2HA 1XDSA 4XLHA 1ETWA 4A6DA 4M9SA 4MQVA 1BUSA 3GEZA 4JZ0A 2BXZA 4CCOA 1XGOA 1CF7B 3IJ3A 3N05A 2DMPA 4IPAA 4M74A 1X4SA 1OISA 3G1MA 1UWYA 1NK3P 4EEFG 4P9UA 5C3EJ 1BC7C 2HDDA 1KQ0A 2WB1A 1Y0YA 2MBFA 3JW4A 4O6JA 2CUZA 1TWHJ 2OCCH 3K4JA 2PR8A 4P96A 3HXLA 3V8KA 3HOZJ 1WVRA 2ZEOA 2L7XA 4E7IA 3DBRB 3P9KA 2L0KA 2A68F 2VOOA 2ZJRF 5IT3A 4IHXA 3NQOA 4B4CA 1DP3A 2LH9A 2YNEA 3NH8A 2WV1A 1OYYA 2PJ5A 3HH2C 4EFDA 2M2EA 2XIGA 4CYCB 1PDNC 4MEXF 1V1IA 2XEGA 4MFQA 4CYOA 4JCVE 4MY3A 2G7UA 2YU9J 2IS1A 2CV0A 2LG4A 3OWTA 1ZAOA 2J87A 2FU4A 2IBDA 2EPFA 4YFKF 3G71I 4Q4ZF 1ON2A 2P6SA 1W3SA 1K78B 5HVHA 3PJRA 1ZGJA 1G59A 1XX6A 9WGAA 3B73A 3GZ5A 5L3GA 2PRBA 2XRLA 4KITB 2E1MB 5D8LB 5JVGF 4CDGA 4GO1A 1QA6A 4MTEA 5D8KB 2WAQN 3KP3A 4EJTA 2NU2I 4FTHA 2QWWA 2FX0A 2K5CA 2NAZA 4FETA 3C2HA 2AQFA 4X6AJ 3D7GA 3F8NA 2UWMA 2LBFB 1ULMA 2L2OA 1MJBA 4OC0A 1YSJA 4YGOA 4II9A 4MMOA 3ZN1A 5J8FA 2DK8A 3OMYA 3VYRB 2JEWA 2DB6A 1S7LA 4IOCF 1A36A 4UHTA 4B13A 2X7BA 3P7NA 4EGYA 4A32A 3R95A 2JA8J 2NMTA 2A3SA 1ZLHA 3DEEA 5CQGA 4KIFA 3J80K 3HDDA 3G3SA 3KIOA 3BR0A 3V8JA 2CUJA 4E4HA 3HOWJ 4FKDA 2PEXA 4OMYA 1SGEI 3GFLA 3PEIA 2YUUA 4H2KA 1T95A 1TWFJ 5AIQA 2MD0A 1CPSA 3I4MJ 1BI1A 2WADA 4GYIA 1AN1I 2DA1A 2RDPA 2SGEI 4AVAA 3SYTA 3TKYA 1EV7A 2I79A 1XGSA 3WTVC 3N97A 1VFCA 2KKOA 1KBEA 2L9SA 4HDVA 1SVOA 2DA7A 4CUGA 4L5IA 2R7FA 4RBOA 1SD6A 2DPUA 2WA0A 3KETA 2OZHA 3Q9SA 4M6HA 1LKXA 1WWZA 3OV8A 3CDHA 4NHJA 3BG7A 2HVQA 5E20A 2CS3A 1SFOJ 2KMUA 2QQDA 3FNCA 2KCXA 3I59A 2Q7BA 3DXJF 3BG3A 5JQ4A 1DPRA 2FQ4A 3LNQA 1FOWA 4BEHB 2H5MA 1VZ0A 4ZC3A 3C2GA 3RO0A 5FKKA 4RS2A 2EJRA 3LSHA 4ENKA 2FD5A 1RKTA 2DA5A 1J9IA 1AUGA 1QPIA 4OIRF 1LCPA 1SD5A 3RKQA 1U6MA 3TBIA 1CQTA 3CZ6A 3TJQA 5DWNA 3TO7A 2Z3KA 2CH0A 2XGCA 5F09A 1HSJA 3FX3A 1ZG3A 4AIDA 1XX5A 2Z1DA 1ZRDA 4CO8A 1QVTA 2DN0A 5EEHA 4FISA 1X12A 1SGRI 3CO7C 3GKRA 1G3SA 1QHHD 5LLQA 2GXBA 2E73A 4OP4A 4XRFA 1HJAI 3SJGA 4KA4A 2LKSA 1JJ8C 4OAEA 5HH1A 4KIGA 2BSWA 4NQWB 2GKRI 4E0AA 4PZJA 4NGTA 1PJRA 2FOWA 3RPUD 3CF2A 3OVOA 6CPAA 2POKA 3OOPA 4YEJA 5BWAB 3D0SA 1OFCX 2VBQA 4E7SA 1VQ5I 1IDYA 1JGGA 5HVGA 3AG3H 2KLOA 2XEIA 2ZXJA 3K9UA 3KZWA 2V9PA 3VYSB 3CPAA 4ZI6A 1YTPA 1MSFC 2R5ZB 2I10A 1R79A 1HW2A 3QWPA 3PRTA 2F5EA 1OQYA 5BQTA 3GWZA 3GFJA 4IRGA 1XGMA 2FE3A 1A04A 5LRSA 2KZVA 1IUFA 3RYPA 5E8IA 2XASA 1ZR4A 4I2OA 2PJ7A 3KHZA 1VIXA 1IW7F 4Q48A 1PYVA 3HUGA 3GB0A 2Q04A 2B3UA 3MAJA 4KOWA 5HVQC 4HPSA 3F22A 2EZLA 3OXLA 5D29A 2FIAA 4W1UA 3WTZA 3FEDA 1QU3A 1QSNA 1JXSA 4KSFA 1B72A 2E1OA 5EG0A 2WVJA 5CYVA 9ANTA 2LLKA 4B6ZA 4OC5A 1BN5A 1H9TA 5HLIA 3AG2H 4XONA 2G0EA 4BJ6C 1UVGA 4P10A 4XLEA 2ME0A 1IC8A 2M3AA 2ZEDA 5GPCA 1QGPA 2GIZA 1LR8A 3DNSA 3IEHA 1OLTA 1K6OA 1X1AA 1MJ9A 3L7WA 1R22A 1IYLA 3TTHA 2QYVA 2KDZA 4KLWA 2KMQA 3U2RA 2HOAA 1N78A 1YLFA 4KOUA 2X52A 4DQ2A 3R5BA 3R6SA 3NA6A 4PJ0C 4C7IA 4HX8A 1PJUA 2GAUA 1LVAA 3QODA 2WZNA 2B0LA 1OCCH 4C2TA 4CGOA 3FKIJ 3BROA 4AC0A 1BAVA 1WZ2A 4BBSJ 3I5UA 2LC2A 2M7AA 4MGRA 1F1ZA 4EM2A 1XSDA 1P4NA 3WTYC 5HNFA 4SGBI 5EEAA 2LD5A 3LFKA 1O3RA 4FQGA 3QRFF 2M0MA 4FHTA 2CTCA 1V5FA 2X1CA 2ZMEA 4A3GJ 1BMOA 1TWCJ 2GREA 2KISA 4AIJA 2HZTA 3OR1C 2CQQA 1HA8A 3KCCA 2KT0A 3FBIB 2H8WA 3OYGA 2D4OA 2V1DA 3HUVA 1YX3A 2JBJA 2W84A 2DMUA 1RUOA 2R98A 3HLPA 4EATA 4BE1A 4B5PA 3AKZA 4R57A 1Y7EA 3H0DA 3VWEA 2FNPA 1CT4I 2BY3A 1QSMA 1E3HA 5GP9A 4EM0B 4UCNA 3NFZA 1K6YA 3JRIA 2X6OA 4HSRA 3PM1A 1XN7A 1S3JA 2HTJA 4XNFA 3VB2A 2QJ8A 2WAQA 4FE7A 2EV6A 1ONVA 2FCKA 4A3EJ 4IHVA 2ZEFA 1Y1CA 1YLEA 3PB9X 4KVXA 2PSWA 1R58A 3EY5A 4QLCU 1SGPI 1DTDA 3PBEA 3K2KA 2B4DB 1SAUA 4XIDA 2R92J 1H0ZA 3ISZA 2QSGX 2PCUA 2DT5A 1W1WE 3MD2A 5H2FC 5LEKA 1F36A 3PNVA 2RC4A 4BJTA 5L3FA 2C6YA 3OS1A 4DJAA 5CPRB 1YIJI 4C3IJ 2F6CA 3O8GA 3V8LA 4M3EA 2ELJA 1W0TA 5K8OA 1KGSA 2XGEA 3BZKA 2NYXA 4PK2A 4NJQA 4NXYA 1ZTRA 1SC7A 5E8GA 2OUMA 1JE8A 2V1NA 1RC9A 3S3MA 4HNWB 4NJRA 2LY2A 1PCEA 2JVGA 4KUAA 2HB6A 4RDUA 4HF1A 2QEXI 2XF6A 2VE9A 3DKWA 1LE8A 4I0BA 5CCLA 1ETKA 3BR6A 3C2BA 4Q38A 1OYIA 2XUBA 5FUXA 3UNGC 3WE2A 5K1YA 2V8VA 1TBXA 3CD6I 4OAYA 3FMRA 2M7BA 1KQ9A 4A30A 1JGSA 1VQ9I 3CC4I 1FYKA 1YX5A 2DBBA 1S7AA 4YIRX 3TOBA 2JMWA 2OVOA 1SFXA 1YX0A 2K02A 1RESA 4U87A 2P7VB 1DS2I 1CGPA 3MGDA 4CS0B 4Z2YA 2LK2A 1JKOC 1KWMA 3CT9A 3BOQA 4Y17A 3IIBA 3BPXA 1R36A 4D5FA 1VGYA 4LQGA 2HDWA 3S9LA 3R9EA 3HYIA 4BHBA 2X6XA 3GFMA 3UOEA 3SXOA 1N13A 5LYLA 1B1BA 1AA7A 2O7OA 3BG5A 3BLNA 1MMAA 1FTZA 1LDJA 1W4RA 3LOCA 3ZMVA 3IC7A 2ZXVA 4UXJA 1KBFA 2KIUA 4PCQA 4XNHC 2QKMB 4PSXA 4ZTFA 5BPDA 1ZREA 2PX9A 2GZWA 2P4WA 3MKYB 3GTGJ 1NUBA 4RAYA 3VDPA 4ZYHA 2ISZA 1DGWY 2HUZA 4I76A 1QO0D 3LA2A 5CJ9A 4JBAA 4WCGA 1RTQA 4XKBA 3GF2A 2HTSA 1LUJB 4M9XA 2BW3A 4FX0A 4P4JA 4UBRA 2LREA 3MZ8A 1NSAA 1SGQI 3EDPA 2QQBA 4PJLA 1VQKI 2JBKA 2D45A 4IVNA 4PSWA 4DIQA 1Q2DA 1DDNA 1E3PA 4M9ZA 3GYHX 2FOKA 2G3TA 3P9IA 5JR3A 1REPC 1SVLA 1TKFA 2WAEA 3E0JB 1WJ5A 3H5NA 3K69A 1EF4A 4KMUX 4Y52J 1TBOA 2BE5F 3V7RA 4C2XA 4MHPA 3R0JA 4UXNA 5EGOA 3UEJA 1YRNA 2XC7A 3KGQA 3VARA 3QP5A 5HVFA 2VI6A 2A20A 4BBHA 3SEKC 5FLXK 2E7XA 2WTEA 1WCMJ 4C3HJ 1OYVI 4PPZA 3E7LA 1GHEA 2EV0A 3VYTB 4WF2A 2K9QA 4L9TA 5FFXA 1RUNA 1Q2CA 2WUUA 4R3KA 1EH8A 3MCZA 3V8IA 3TE4A 1IJWC 2EA4A 1XTAA 3DKYA 1V0CA 4GYGA 2IS2A 2A61A 3IUOA 1OCTC 1SD4A 4ZX9A 3L1PA 3VATA 1JUMA 1DU0A 1LJ9A 4F55A 3MKWB 2R7QA 5E3PA 2BUSA 1O3TA 3FRMA 2ARHA 4YELA 3NE8A 3VOEA 1MW7A 4EJUA 2OH1A 4AG7A 3JAMZ 2M4KA 2ZXIA 2IEKA 4XLNF 3CCUI 4RAZA 4S0HB 4V19K 2B3VA 4X8IA 1XMXA 1V5GA 3O3KA 5F27A 2ZKZA 2SGDI 2VB6A 2R7VA 3FIXA 5FB2A 4GRIA 3S8PA 2RFHA 5LEJA 3RZDJ 4LB5A 5LGNA 4XM3A 3FJUA 1RPWA 3WG7H 4ZY1A 3BQYA 3ONQA 1T2KA 3F6VA 3FXOA 5B3SH 1XJOA 4TWEA 3CUQB 5F6FA 2B5GB 2OTJI 5D4SA 1R57A 4QBJA 5IV0A 1MD0A 2MC3A 4ASNA 4CA0A 3BR2A 4ABZA 2ZEGA 4GS4A 4BE0A 3CJTB 3MZHA 1FBSA 1ZARA 2IGMA 4MFDA 4EQQA 2VQCA 3A4CA 2VL8A 2BEIA 3QPSA 4Q36A 4R7MA 3ECHA 4J19A 2Q2EB 4PQAA 4Y49C 4C68A 2KIFA 4UUVA 3E5UA 2FUG2 1IDZA 4B5OA 1Z8TA 3JR9A 1TF9A 3FXRA 4A6EA 2Q51A 1MDMA 1MIJA 3HRSA 2IVMA 2FBIA 2W85A 5AG4A 4Z6YA 2VKHA 4ZDPA 1LPQA 5FO5A 5LGTA 4WWCA 2Y9YA 3A03A 4RLFA 5C44J 2CUEA 5FKOA 1SGDI 3PFOA 1Y7RA 3PB7X 4I01A 3U9GA 3CUQC 5KVRA 3ESWB 4Y7NJ 2XVCA 4C9YA 1FLIA 1IYKA 3DU6A 1MZBA 2E35A 2VBZA 2ATRA 4FD7A 3SDGA 5LHGA 3LSJA 4LG0A 2PJRA 3RZOJ 3OL4A 3ABMH 4UVCA 2DT6A 2WB1N 1J5YA 2PMUA 4NEXA 1HBXG 3F0AA 5DTDA 3FEEA 5E3MA 4B14A 3BTJA 4P4IA 4RB3C 4ANJA 4MJ8A 4PV6A 3HOVJ 2ECBA 2FXFA 3W3CA 2VBWA 5ICEA 3TC8A 2QA4I 4E7KA 4IK2A 4ESFA 2HVRA 3VSKA 2QPOA 3HGGA 5EC4A 1CSOI 4OIQF 1U5TC 2MG4A 5F49A 2OZ6A 2AXTC 3FVLA 2FE7A 2ZENA 4XR6A 3B8GA 3KP4A 4U0VA 2YX4A 3V7CA 4C2ZA 2EILH 3BY6A 3ULQB 1XSVA 3OR2C 4IAVA 3S9NA 4HQMA 1WKXA 3LACA 4PJJA 5GAGJ 2RQPA 2STTA 4ORFA 4BS9A 1YW4A 4RUHA 1HCRA 4G6QA 4AIKA 1M4DA 1CBXA 2LSOA 5GTHC 5EF6A 4J01A 4RGXA 1AOYA 2HQYA 2KMRA 2DA3A 3FC3A 2XDVA 4XSZF 3D4UA 3FBUA 1I1SA 3GLJA 3ZQHA 1I39A 2DFEA 3ZRGA 1IY7A 2DF5A 2CQKA 3J7AO 3HOXJ 4S04A 3NH4A 4I49A 4K30A 1P6RA 2HVSA 2FJ1A 3TQNA 3DFGA 1XG1A 2MLGA 4IHYA 2Y9ZA 5DM6F 4KT6A 5TISC 2IPQX 5M5YJ 1YR0A 3TOAA 1N77A 3SHPA 3JRDA 2XRCA 3IU2A 1OKRA 1O4XA 2ZB9A 2H1KA 1ULNA 5IP7J 1UHMA 4BL0B 2K9NA 1UVFA 2F4MB 3RIRA 4YRHA 5CVUA 3OSFA 3Q0WA 4W9YA 1CT2I 1USTA 2E36A 2NVUB 2JQ7A 2JA1A 4HKFA 1JT6A 2E5ZA 1HLVA 1I3AA 1CJWA 4BACA 3BCAA 2DOFA 2A6EF 1U6GA 2LTPA 2F5DA 2LFBA 2JYYA 4MHGA 4YFJA 2Z5UA 2CQ7A 1BM9A 3D5LA 5K5QA 2O9LA 3M1CA 5KHDA 1RRJA 3WGIA 3GFIA 3UFFA 2BOAA 3UY5A 2Q0OA 1V55H 2DOAA 1MNMC 3IWWA 3QYEA 3U1DA 5GAHJ 4ZYQA 4I0AA 5G21A 5LRKA 1P4AA 3H92A 4P5OA 1U8RA 1H8LA 5GAEJ 2C27A 3I59B 5KAFC 1ZG5A 1V54H 1O57A 2SGFI 2EK8A 2HPIA 2O0YA 3CJNA 4MCQA 5EBVA 1XIXA 1TP4A 4BH9A 1UCRA 3SZTA 4OIPF 1ARMA 4AU7A 1KU9A 2YR2A 5DYMA 4BQOA 3OYLA 4H6ZA 3ASNH 1J2XA 2VJJA 4GGGA 4PJMA 5F0CA 4UB8C 1RR8C 4L0ZB 3H3VK 1KZFA 3D2PA 2OAZA 3RKWA 2NS8A 1VQ8I 4O3MA 3GIUA 2NOGA 3H9JA 2H1LA 1X1CA 3AL0B 5BS6A 4ENNA 3H35A 3RAMA 1PTQA 3MMYB 4XRMA 1Q1VA 3L2WA 2OC6A 2ELKA 3IH3A 1SANA 2R7XA 3H9GA 1A31A 2FSRA 1TT0A 1KMAA 2ZW4A 2O53A 2DXIA 1QRYA 4N4OB 5C88A 4E7ZA 1IN7A 2CG4A 1FOYA 1FNNA 4EGZA 4ENJA 2E71A 1G4DA 1HDQA 2FEZA 1AMPA 3BTCA 4JX5A 1S3ZA 2W4SA 2L3DA 1S20A 3FMQA 2VJ4A 3FZVA 3NE7A 2OD5A 3HM5A 3PBBA 3IKTA 4CYPA 2LNBA 1ZGWA 3LQQA 1S7EA 1T33A 1FP2A 5EEGA 4IO9F 1HDUA 3FBNB 1IW4A 1XE4A 1IOIA 2I5UA 1YLOA 1J0RA 1G8XA 1WQ2A 4DZJA 4IOAF 5FUVA 2PJBA 1R5ID 3S6GA 5IP9J 4A31A 2V9VA 2HQ5A 3DLJA 3OS2A 3K10A 2E5NA 4JLYA 2V8GA 1X10A 3TMOA 2DK5A 1YJNI 2KIQA 2F8HA 2ACJA 5E17F 1W0UA 2HU9A 1J59A 5EMIA 4NDLA 2ZJQF 2M8EA 2ZOGA 5IOYA 3SFIA 3VH9A 1TBRR 3EUKL 3F8CA 3M8FA 3PB4X 2LKPA 3KE2A 2J9RA 4MFZA 2HWVA 3BI0A 2QQAA 1OJLA 3HUGB 3FF5A 3FHZA 1BR4A 4IX7A 1TW2A 2F48A 2K5TA 4OLLA 3L2CA 2F5VA 5LYFA 1K4JA 2ZELA 1WGCA 2LRDA 3R5AA 4OKOA 4AXVA 2QLZA 4JQFA 2NU0I 1WTJA 1B72B 4OMZA 3I3LA 5A28A 2DW4A 5EG0B 5IX3A 4UB6C 2DT7B 3HRMA 1PUEE 3FYNA 2IJZA 4PK3A 1XMAA 1U5TA 2UXNA 3CXQA 3HTSB 1FZPB 2DI3A 3RKYA 3BR5A 1O3SA 4BQAA 2IW5A 2ESNA 1UHWA 3BZ6A 1R9TJ 4CRYB 3J7ZI 3S1QJ 3A2KA 2ZPAA 3HHGA 5DDGA 4HYEA 1W36D 1YJWI 5LBQA 1IN8A 2MSYA 2RVCA 4LUAA 2ESHA 1EA3A 2R3SA 3MFKA 3L00A 3KLOA 3S2DJ 3LFUA 2Q1ZB 4M3DA 2NU1I 1M1DA 4U5YA 2VKVA 4XRSG 2VOPA 2VN2A 4UFXA 3TX8A 1WRJA 3Q0VA 4CCMA 4A24A 2PJ6A 5E79C 2SGQI 2R7WA 1LDDA 4MY0A 4I09A 3ECOA 2CYYA 1QSOA 1VQPI 3HOSA 2AHQA 4BAYA 4MHZA 3ZQLA 1FOKA 2DQRA 4IF4A 3JRHA 5J1QA 1CX8A 2EVNA 3GUXA 1TWAJ 2MC4A 2EUIA 2SGPI 4MCRA 1VHOA 5JM6A 2X0LA 2DCEA 3D5RC 4LMYA 4CZCA 1NHAA 5J8CA 2PRQA 5LYDA 1UZCA 4M3GA 3HL2A 3OL0A 3RQ4A 1AU7A 2HOEA 4B43A 4B5PB 4IHMA 1CGJI 1D0ZA 2Q0YA 3FSYA 1XDUA 4LFUA 4Y13A 4NC7A 1CT0I 2YQPA 1LANA 3ERMA 3PL8A 5F47A 3ZQIA 4F92B 3JSOA 3Q0UA 1ZH5A 5E3NA 2H6BA 2WV0A 4P9FA 2P6TA 5M5XJ 4RGUA 5IYCJ 1I6XA 1ORKA 1NTCA 2P81A 3K4MA 3F23A 4JYWA 2Z16A 4N9IA 3OXFA 3ZMDA 4M6VA 1UUCA 1SAXA 3B6AA 2PE3A 1H0MA 3K4CA 2NXNB 3D67A 4ZDLA 2XV4S 2ZMEC 4BJ5C 2ZEEA 1W7PA 1QMUA 2BGCA 2G9WA 1UFHA 1ZN2A 1VF9A 3LA7A 4OU0A 2ZOFA 4MHDA 1ZGAA 3ZQQA 3ZXSA 1T38A 2RQQA 2BY0A 2P5KA 4HLXA 3RNZA 3WR7A 4DZPA 3I9V2 1TKJA 1X1PA 3BP8A 1MSEC 3S32A 2KJCA 1XD7A 1ZLKA 3WU0A 2JUGA 1JQGA 1TNSA 2F4IA 3R96A 4P6YA 3CLQA 1G6NA 1TW3A 2FIWA 1Z6RA 3WTXC 1TBQR 5F64A 4PXEA 4QB9A 1XPXA 5DWMA 1Z5RA 1EJ9A 2HXOA 4OADA 1LE8B 3ERED 4KS9A 4M6GA 3MEKA 5F1JA 1K4SA 4KOYA 2AXLA 4HNVA 2Y0MA 4ZGYB 3I1UA 5ISVA 2Z0ZA 2PJ1A 1QZEA 2A5YB 3R5CA 2HI3A 3OSGA 2J8NA 3QOEA 3GTKJ 3GOXA 1DGRM 1UMQA 5K7FA 2P8TA 4XSXF 3L2UA 4A3CJ 4YIIA 3BJIA 1VHEA 4G8XA 2R7TA 2ZBKA 3Q3SA 1FMVA 1NH3A 4OIWA 2IS6A 3T8WA 3SI2A 4LGWA 4B48A 1EH6A 3W91A 2DXQA 5DUIA 2MGQA 4IKFA 3FK6A 1BPNA 4L89A 4JP0A 5LHIA 4I6ZA 4FAIA 1RIOH 1G3YA 2HFHA 1IF1A 7CPAA 2OZGA 2O5RA 2YPRA 3VODA 2QVOA 3GTJJ 3RBUA 1BIBA 4R6TA 1TTYA 3DPTA 1TL8A 2D1VA 2JEVA 3D3SA 3G2BA 5CKTA 2VRWB 1QSTA 2CY2A 4FD6A 1XF8A 2CF4A 2M5WA 3QYBA 5D5UB 1JI8A 1A35A 3WGGA 4HG2A 2BW3B 1E2XA 2ZEMA 5LHHA 4ENMA 2HC9A 1R0RI 4NB5A 2QKLB 4XKVA 4AVPA 2O3FA 2UV1A 4CCJA 1YS7A 2L9NA 4BUPA 2DIPA 1A6QA 2CO5A 2KDOA 3EYYA 5A27A 2GQQA 2PJ8A 2VQLA 1HW5A 4G12A 2OJED 3E5QA 4LLNA 1IB1E 5FVJA 5JLWA 4RGRA 4CCKA 2IA0A 2AFOA 3U1KA 4RM2A 2P6EA 3DPUA 4A0XA 1MBGA 4IL6C 4MLOA 5EGOB 5DAEA 1KONA 1YHQI 3J81Z 1YRNB 5K8MA 1R23A 2MW8A 2OBPA 1ETVA 2ZJ2A 3E2IA 2QCOA 2CFXA 2Z11A 1YVOA 3WC6A 1FC3A 2AFUA 3F6OA 4LK1F 5C4JJ 2B8TA 4UFVA 2QQEA 3AFHA 3CDLA 4BDZA 2R1IA 4H89A 2E2HJ 2MH9A 4R3LA 5H86A 1U0JA 2HOSA 3R5DA 2QYOA 3IWZA 4P4FA 2WY8Q 3ZZIA 1HDPA 3IH4A 4KOVA 4ESBA 4ZYDA 4RLQA 3K70C 4CH7A 4ZH4F 2C6GA 2CRGA 4A93J 2I00A 3KP5A 1GHCA 4JX4A 3SI1A 2BYVE 2ENNA 1HF0A 5HODA 2N71A 1XOVA 1HDDC 3S1MJ 5M5WJ 2LOOA 3M8JA 3I53A 1IGBA 4NGPA 3KYCB 4OIDA 2QSFX 2FA5A 3DPLC 5D6EA 3SZGA 4BXUA 4RMNA 1G2HA 1M8BA 2FBHA 1U78A 3O8HA 1F4KA 2OB0A 3LD2A 4F0XA 4KVOE 3K2AA 2X85A 3TDZC 5JPHA 1RXTA 3WHCA 5E18F 3OYBA 1HOMA 3WU2C 1P2FA 3MZYA 3I0TA 2JVHA 2W82A 2G0BA 3FM3A 3KZYA 2DQLA 3E6MA 1E17A 5GCNA 1X2NA 1YG2A 4F8ZA 3CC7I 4IHSA 4L8AA 2ELIA 2VT3A 3HGYA 2J8MA 3B3TA 3D7FA 2L7ZA 4BY7J 2QSHX 1AKHA 4X5KA 3GO5A 3KP6A 1CG2A 4A3FJ 4WP4A 4AB7A 3W6XA 3H8EA 1X74A 1BI2A 1J7KA 2W24A 2BXYA 4PGGA 3S6HA 3F5BA 3W6VA 3S6FA 3EC4A 1TQMA 3B3SA 3WU1B 4A3IJ 3BG6A 1Y1VJ 1YW9A 1IV8A 1MJAA 4BNCA 1MGTA 1MDMB 1T39A 3UGLA 5E1XA 3H36A 2DPSA 1HEEA 3GZNB 3I4PA 2WWYA 4F7ZA 2XRNA 2IP2A 1RNLA 1M8CA 4FT8A 2DDAA 3CXPA 1F9NA 2X48A 2A69F 5CVJA 1BA5A 4WWVA 1D8KA 1MBKA 2VI7A 1S7NA 3CQZJ 2ICWG 4XLPF 2DO7A 4M3SA 2ZSHB 3VFZA 3GUDA 2PJRB 2X1DA 4LG0B 3PQKA 1YJ9I 3DSBA 3H8FA 2HDCA 4KJZA 3FXUA 5IPAA 4CYCA 4JX6A 1DUXC 4LIVA 4ZY2A 4BINA 3W6SA 3BXMA 4O5VA 2GE3A 4AM3A 4PXBA 3CUOA 2UVOA 1LFPA 3FMSA 1ZELA 2DLLA 5L3DA 2D4PA 2ELHA 3DR8A 3JTGA 1IXRC 5E3OA 4DYRA 3TW7A 4A3KJ 1NE9A 5FRMA 4P4BA 1GUUA 3VDUA 1JKRC 4NGNA 5FGMA 4RA2A 2DYSH 3R0AA 2XB0X 2PJ0A 2RV8A 4WXDA 4Y4RA 1BC8C 4M72A 3PB8X 2Z3NA 1QPMA 3FMCA 3ML6A 4AD9A 1W7PD 2AFXA 3CPXA 4L9MA 3K6GA 4HLYA 3D7DA 3TO6A 4G6DA 1BLLE 2X1EA 2J5OA 4HPQA 3LWUA 4LQ6A 3WC5A 3ZMTA 3HRUA 5HDNA 1OZPA 2DMTA 3HTUA 4ON0A 1SGNI 1UFMA 3JTHA 2L7KA 1G3TA 1I5ZA 4DBRA 4XNHB 2EBJA 4LD5A 3PO2J 3WODF 5J1UA 2ZFUA 2J5PA 1KA8A 3CXLA 4EMSA 4HAMA 4C7HA 1BJAA 3DV8A 2JXDA 2FL4A 4KORA 3KASA 2PJ2A 2HGCA 1KU7A 4KYWA 3EXNA 3IWFA 3HOTA 3EYIA 1S60A 4QUSA 1GVDA 2A6HF 2XF7A 3ISPA 1P7IA 3OXGA 1Z8WA 3JREA 1YIOA 4KSAA 2EV5A 3OS0A 3GTOJ 4A3BJ 3TO9A 4P45A 3JSPA 4EMEA 4G6TB 1YW7A 3OYAA 1Z8XA 2H94A 3FXJA 5B5EC 1PTRA 2XEFA 1TIQA 5FLXZ 2B9SA 5DUKA 4R9MA 3IP4B 2JRMA 1GXQA 4QWQA 1IG7A 2UZKA 1FPQA 5HLTA 1YQEA 2XROA 1MBEA 3BHXA 4RB1A 4M3FA 2PFBA 3DR6A 3V38A 1JUPA 3OIPA 4W97A 3IAS2 1IRXA 2MFZA 4ZZDA 2ZC2A 1KZHA 4U9YA 3H9QA 2YNCC 2CQNA 2EZHA 3JRFA 2K9HA 4FCYA 1T6SA 4L5JA 3W2VA 2WSAA 3KQZA 1I1DA 4R87A 1IN4A 4GXOA 3PO3J 1MH4A 4PGHA 2H27A 3BR3A 1ELMP 4M85A 2ZW7A 3QYFA 2FQ3A 2IXSA 2TRTA 4KIBA 4LIUA 4ZYGA 4HNYB 3OYNA 2E2IJ 1P7JA 3PNYA 4QPQA 1U5KA 4LJZF 1ON0A 4A3JJ 1ZLIA 4IXAA 2G7HA 4P1WA 2C6CA 5FKLA 5F0FA 1IGNA 4L9JA 5A2QZ 2PI0A 2BVLA 3HOUJ 4XPLA 2V1UA 2DA4A 3CCVI 2V1CC 5AGEA 4RAFA 4G7OF 3PQJA 1OBRA 2ORVA 1HW1A 2JK3A 2ETHA 2O4HA 3QQAA 3BQZA 1K7AA 2A6TA 4FBEA 4J00A 1Y8RB 2VQGA 4IQJA 2QQ0A 3ABUA 4PXDA 2JZYA 3W2WA 4JOMA 2VODA 1HXDA 4ONWA 2JA7J 1Y56A 4ZX8A 4NCZA 4MRIA 1XEBA 2LDUA 3IRRA 4HV6A 1JHHA 2JDDA 1K83J 1R1TA 1V3FA 1ENHA 1IN5A 3DBLB 1BW5A 5LGUA 5K8NA 2N8GA 2O61A 3GY9A 3CMEI 4UCMA 3ZQFA 4QC6A 2L7MP 3PIPF 4XPDC 3VWDA 3ABLH 3HRTA 1IRFA 3HSRA 2VE8A 1FARA 1XB4A 1D1BA 4ONUA 4RB2C 3CMYA 3DQVC 1XCBA 2M4GA 2BOLA 3DP7A 1USSA 1IRGA 4HOBA 4RM3A 4KN7X 1WH7A 2FRHA 4KFCA 4LITA 1IXCA 1VQ7I 2VJIA 3FXLA 2R4GA 5K7ZA 2BCOA 2ZFWA 3B3WA 4Y49B 2QVPA 1OCOH 2DMQA 1UHAA 2ID3A 7WGAA 4YIFA 3CCRI 4NSQA 3AAFA 3KY9A 5J1RA 2OA4A 3KQXA 2YGWA 5I4MA 2M45A 5HLGA 2B0UC 2K9SA 3ZQCA 2Y30A 2QQCA 2ISYA 2F5FA 4AIHA 5KTAA 1BJZA 1JHFA 1Z7KB 2OQGA 4HF0A 2XB5A 5F1RA 1GXPA 1KUVA 4JWPA 4P4DA 1NSLA 4A2ZA 3I64A 2Q7SA 1U3EM 1B8IA 2OCEA 1FSHA 5ICFA 5EZGA 3SI0A 1TGSI 2JA5J 1PPFI 3B3CA 2EFWA 3ZR8X 3OY9A 2ODFA 3CCYA 2M0CA 3QPLA 1LQ1A 4KISA 1ZG7A 1MKMA 2O8XA 5GPAA 4BKXA 3PP9A 3LA3A 4A3MJ 3FECA 4CCLA 1ELLP 3TW6A 1YYVA 1SGYI 3B4VC 1ACIA 2PC1A 1E3OC 1P9QC 2VZYA 1WJFA 2Y31A 2QZ8A 1ZG9A 2XGXA 4HSTA 2EK9A 1XMTA 2DYRH 3KR5A 1OMUA 1TZLA 2EFPA 5M3FJ 2VL1A 5J40A 2RB7A 4M3BA 5BMZA 3BJ7A 3CCSI 2Q8KA 1DU6A 1U5TB 3RSNA 2QBYA 3FSXA 3K1MA 1YGHA 2GLJA 1ERDA 2IGNA 2L4AA 5J3LA 2N1AB 1WI3A 3GCMA 3J7YJ 4KNYA 3CJRB 2L8EA 1RFHA 4HZFA 1X1BA 3CESA 5FFZA 1D3YA 2Q4VA 3JRCA 4NF1A 4UNOA 3KI9A 5B1AH 5HLHA 3S3OA 1M4GA 1M44A 3FB3A 4PK4A 4B12A 1MMGA 1IUYA 1WJEA 2UUZA 5HMNA 3B3VA 5EZHA 2VC1A 2JWTA 4G7ZF 1ZG1A 1A6IA 5DCFA 3BJ6A 4B11A 3G4SI 1I50J 2NVTJ 3HOYJ 1TUSA 1R6RA 1B6AA 1F57A 4AMLA 4IF5A 4AWXB 4CYQA 5HI7A 4UF4A 4NGMA 4L18B 4XRSA 3KHXA 1D0XA 2HEOA 3EPZA 4D5CA 1L0CA 3M1EA 5IT9Z 5DCMA 5ELYA 2PJCA 2NRAC 3LQRA 1TXRA 3SXNA 3WG9A 2RIJA 3SEZA 2VJ5A 3N7ZA 4NFRA 2K9LA 4MTDA 1WJAA 3IU1A 1FOXA 1POGA 2Z3PA 2FF4A 2RNJA 1IZ1A 3KEYA 5J1YA 3CDIA 1HQCA 1Z9UA 3LMMA 2M1BA 5HS9A 4MFPA 1CP6A 1LAMA 2K3PA 1LEBA 1JTYA 5CLSA 4OC4A 3ZP5A 3DGVA 2LMDA 4N4NB 4OC2A 1Y0NA 5HDGA 4B47A 2KMOA 3D8PA 5CQEA 3L2RA 1HDLA 2REEA 2YNCA 5D5XB 1F43A 3H5AA 3CF5F 3CMAI 4M73A 1ZK8A 3SJMA 5L3CA 4OMEA 3ZMZA 2D2WA 2Z3MA 4KVME 3LAJA 3DTKA 1QZYA 1W7PB 5DEQA 5ILSA 4HW0A 1Z2LA 4O23A 2AO9A 1TNTA 2HYJA 2L4MA 4C2UA 1BOAA 4Y15A 4OIOF 2MH2A 1OCRH 3WT4A 4BU2A 4DYCA 2YNDA 4OVOA 4JXQA 3VSLA 3G6EI 3DU5A 2V1CA 3CXSA 4YU9A 2E1NA 2MYSA 2GKVA 2CW7A 2ROWA 1W5CC 3VWBA 3E6BA 3GBGA 4HNUA 4GCVA 3S3NA 2PG4A 3TFYA 5L3EA 1B9NA 2HZDA 4N0BA 2PMZA 2CV2A 2EIKH 3S6KA 3BLYA 3BTLA 4EV0A 3EO4A 3B6CA 5LRGA 2LVSA 2GA2A 3LMSA 1E0EA 2JA2A 1MBHA 2L9RA 1K4TA 2PDOA 2VIXA 3HJEA 1S8NA 4PUSA 4IRHA 3FH4A 2JT1A 2K27A 2J9AA 3LWFA 1UB9A 1QHGA 2D1HA 5AG6A 3HC7A 2JJ7A 4Q5SF 4UFWA 5H84A 1PVEA 1MNDA 3GXOA 2R7RA 1B4AA 1LR9A 2VPLA 4HRIA 5K8PA 2ZXWH 3IV5A 3DTIA 3W6JB 4KT5C 4A33A 1T08B 3RI4A 2NVYJ 2IL4A 4M6IA 1MMDA 4EJOA 5DD8A 1TLHB 3EUAA 2OU2A 2EA2A 4JK1X 5DM7F 1NXUA 4U88A 2YX7A 5F08A 2EO8A 2CTBA 3D7HA 1WSUA 4UY8I 1VHSA 5CPAA 3UEYA 4AUXA 5LFAA 3RDIA 2Z3YA 2VKDA 4XKCA 5JI6A 1ITYA 2JRTA 1XRYA 5IB9A 4CGLA 2DA6A 3E5XA 1QSRA 1Z8LA 1TIHA 5ED4A 1OR7C 1IU8A 1Y8FA 1SEUA 4M6YA 2C6PA 1D0YA 2XPVA 2HQAA 1PUFA 1QZZA 3ELKA 2M30A 3NAUA 4G9YA 3JUWA 4Y33A 3H0GJ 3QPHA 3OYMA 2GANA 2AQEA 4E7HA 2DPDA 1Y0UA 1Y1BA 3NRVA 1KU2A 1WJCA 2F5CA 3HZJA 4OAZA 5JFRA 3TP0A 5ILVA 2FT0A 2PQ8A 3DF8A 3H5RA 4CHUA 2QGUA 5DV5A 4NGRA 4HNXB 3CC2I 3LL7A 1R5HA 3A01A 1FT7A 4FD4A 4A69C 1KUXA 2KIMA 1OMTA 2M87A 4NC8A 5L3BA 2DJNA 4HF2A 3B2YA 3F8BA 3NH5A 3QNVA 1IO2A 3KEQA 4UUSA 2KP6A 1TC3C 4DYOA 1S9HA 4BY1J 1Z4RA 4CAEA 5K7HA 1JUSA 2OPTA 1O7LA 3DLAA 3FWEA 4CICA 5F0HA 3JRGA 2GLOA 5ICGA 1FEXA 1S6LA 1FYMA 1Q7LA 3VE5A 3PSIA 1ZR2A 1XSXA 1L3LA 2ORWA 1A5JA 1Y9WA 3U21A 3RQIA 3UGDA 3TDUC 3OYFA 3CCQI 1VTNC 3PGPA 2VUMJ 3LODA 4JD6A 2TCTA 2KRFA 2X4HA 1TQIA 5JVTA 3PNTA 4S05A 2WPWA 1X4PA 3JRBA 1QQIA 2CW8A 2AFZA 2P5VA 2AE6A 2UXXA 2R7UA 3TCVA 4YFNF 1Z77A 1TT5B 2JUCA 1WJDA 1SFUA 5KTCA 3OWCA 1IAWA 2ZNZA 3CMMA 3ZN0A 2CWGA 2B5GA 3FK7A 1ZQ3P 3S9MA 2KQRA 1ZRFA 4OOIA 1MMNA 4UV8A 2V9KA 2JW6A 5ILUA 4PFPA 3WGHA 1YU6C 4CRZB 4UA3A 5JGFA 4V2FA 1RO5A 1MNEA 5DD4A 2HXIA 2DOEA 1B6BA 3LSIA 3HBLA 3KR4A 3ISXA 1UAAA 4BGDA 3JRUA 5C82A 5HQ8A 2CUFA 5BPIA 4EJWA 3Q9VA 1F2PA 4UCPA 2XAJA 1IOFA 4L5EA 1BOBA 2NNYA 3OYIA 3SGBI 4UEEA 1DPUA 1P92A 2LY1A 2CWHA 1X19A 3KEOA 1I27A 4IRIA 2IGKA 4R79A 1G3WA 3J80Z 4ZTJA 1WWXA 4MXUA 1HEVA 3MN8A 5CBMA 2DAOA 4U0WA 5TRDA 2ZMEB 2IAIA 1AKHB 1IY5A 3TGNA 1X3WB 4RAGA 1XA6A 3KYLA 1N75A 2EZKA 1D5VA 2DODA 5E3LA 2CGPA 4MIMA 3M4OJ 1CE3A 1NMTA 1VKCA 4UIAA 2DA2A 2DFHA 1GLNA 3DEWA 4R8HA 3DBHB 2GFQA 1FX7A 1F5TA 4KOTA 4A12A 1WGTA 4E7JA 1J4JA 2XAQA 1ZYRF 1K7UA 1HSTA 1UG0A 1F2OA 2HV2A 1V5EA 3CLOA 1R00A 1FMWA 4B09A 1XFOA 2BHZA 4M71A 4L0YB 2B4BA 1R49A 2O28A 4H6UA 1ZKGA 5LD2C 3QTLD 3L2NA 5FLVA 1JTXA 4CYNA 4LOCA 1XS9A 2G9DA 4AVZA 1Z9CA 1IXSB 3W6KB 5TGTA 4LLGF 4CXFA 1Y39A 3CCLI 2RN7A 2V26A 4P44A 3DKXA 2VC0A 4HX4A 3S16J 3I56I 4KN4X 4CGMA 4MFKA 3ZQGA 3OYCA 3P9CA 1WI9A 2EBIA 3H3UA 4MCSA 2KRHA 3CP8A 2K4JA 1BI0A 2VKEA 4XBFA 2V8DA 2Y0SA 3BPVA 4A38A 3F8FA 4OC3A 1UHSA 2BV6A 5H6QA 1JWQA 3HKZN 2I8DA 2ECCA 2KJBA 3JCUC 4CPAA 1ODDA 2PMHA 3FIWA 1IN6A 4MFEA 2EINH 3UKGA 1R7JA 2EZIA 4CCNA 4A3LJ 2VXZA 4MHNA 5F46A 5D5WB 3PSFA 1TOTA 4RN7A 5D6FA 3OL3A 2FMYA 1XBUA 3ABTA 1WJBA 3SDBA 2H8RA 1LDKB 3JTKA 5FLMJ 4YWYA 1D1CA 1OR7A 4JJXA 3Q5FA 1AYEA 3SJXA 3RYRA 4P55A 2W25A 4B44A 4I02A 5AIPA 1U9NA 3WHBA 3ZGKA 2WGCA 5E96A 2ARPF 4HDUA 3DEUA 4BHCA 1YOVB 3E3VA 4LLLA 3IH2A 2QECA 2E1MC 2GKTI 3PB6X 3V4GA 2NVXJ 1VNDA 3SQNA 2XAGA 2UZ3A 5IYBJ 2BY2A 4AG9A 2G3AA 4ZY0A 2OF7A 1LEAA 1X1DA 2V1XA 4XLFA 1YW8A 4HX7A 3IFEA 1J09A 2R7SA 3KKWA 3A02A 5ERIA 4BD9A 3KYDB 1KUYA 4MO7A 4RS8A 3K1NA 2GM4A 3MN2A 1FT9A 3QAYA 4GDFA 3RJPA 1YITI 3IWEA 2Z10A 5JHUA 1XGNA 1VQNI 5GTIC 1SD7A 2MABA 4FX4A 1PP8F 4U7BA 3BCBA 3C1DA 3C3WA 3K4NA 2BY1A 2PIYA 2CWFA 3I3GA 1K7VA 3H8GA 1S72I 4XOPA 1R71A 4C3JJ 4C2MJ 3C18A 4XLAA 4E7LA 2ODDA 1Z3YA 3R1KA 3S14J 1O3QA 4BQNA 1OVOA 4KMFA 5DS9A 2R5YA 2L54A 4BXFA 1FWZA 3GTLJ 2CXAA 3K7AJ 3UGIA 4OWRB 3CCEI 3F8MA 4WJBA 2W7NA 2EWNA 3A1YA 2A4NA 4G94A 2FS5A 3HPGA 2P5LC 2WCYA 4MI4A 2DDBA 2WYRA 2ZW6A 1Q1HA 1T8IA 1XCVA 2PJ4A 1K61A 3QP6A 1B87A 3B7IA 2CMPA 1TWGJ 3EFAA 1Y9KA 1D1AA 5D4RA 2P7CB 2KCWA 1X2MA 2MD5A 3K2ZA 2B7EA 4YRVA 2A07F 5F48A 4HNTA 4CYDA 4Y3OA 1HPTA 2VT2A 3D1NI 3DLLF 5JLXA 2JA6J 1LR7A 4BDYA 5BNGA 3HIFA 5IOZA 2LKXA 3C7JA 1GDTA 3F3XA 2KZGA 4GFBA 2QM3A 2CSOA 1EE3P 2PVVA 1IY6A 5J47A 4IZZA 4NNJA 2EFOA 2FVGA 2IMOA 1FNOA 2HS5A 3QB8A 5TJJA 2EWBA 2GOMA 1JKPC 3DDDA 4BBRJ 3A0HC 4HV5A 2NOJB 4AYBA 4F52A 2L7FP 1PU9A 3V7ZA 1LVKA 3WTUC 3HHHA 2HR3A 2WY7Q 1R1UA 3R60A 5DS0A 3FDYA 2VQHA 1PYTB 3CP2A 3BJOA 4MBUA 4IQ4A 2FNFX 4XLCA 1N71A 2P6FA 1JJ6C 2WPXA 3IGRA 4NGSA 2OOTA 1CP7A 4CAXA 1KYZA 2BL1A 4HEA2 1WK4A 1V4RA 4LK0F 1T0FC 4PFOA 1B8IB 1TKHA 4X2TA 3GLLA 3IC1A 2FSWA 2YSRA 4UIBA 2IA2A 5JHFA 1YFHA 4B3AA 2R0QC 3CJQB 4UVBA 3F8KA 3I55I 1RKWA 2R93J
chains in the Genus database with same CATH topology
4HBLA 2BEOA 1U2WA 6PAXA 1CF7A 4LX9A 1B59A 4K2EA 1AWCA 3P2FA 4I98B 1SMYF 2EFQA 2AS5F 5H6RA 3BJAA 2GIVA 2Z99A 2ADUA 3SFZA 1HKTA 2QBYB 3J81K 2R7DA 2JDCA 3R9GA 2VEZA 3T9YA 2IRFG 2ZW5A 4B10A 3WTTC 1LB2A 4IUSA 1PUAA 2EFNA 2FXAA 2QQ9A 4IHTA 5HS8A 3WE3A 1S7FA 3ZMUA 5CVIA 3ZMSA 3RPQA 2DFIA 4AVCA 1OPCA 4Q47A 5J6XA 3RTRA 1P0HA 1K78A 4UV9A 2DU9A 1ZRCA 2PN6A 2VZZA 5DCMB 4ZBGA 4U7DA 2W57A 1S7KA 3I9SA 1KQ8A 4RI1A 2H6CA 3I58A 3EQLF 4E8OA 3HSFA 2K86A 2JSCA 4CGZA 3FXQA 1I1GA 4C2YA 1WKMA 1FBQA 3HSEA 1HKSA 1R5GA 2NNNA 3ZJ0A 1J75A 3E97A 4EM1A 3RYOA 1EH7A 1YQAA 3M8EA 1KU3A 4WXHA 4F0YA 2Y75A 1SMTA 3L9FA 2MLKA 4A95A 2VXKA 5KK1A 3E6DA 3MEXA 1H9GA 4KOXA 3K0LA 2NS0A 5D5VB 5CVRA 2L01A 5HS7A 2VQYA 3QAHA 3IWGA 4MQ9F 2FBKA 2XAHA 2JTVA 3A9LA 3KP7A 3G8WA 4BMHA 3SXYA 4UWJA 2COMA 2Z3LA 4ESJA 1BBYA 4AVBA 2JPCA 4XPDB 4UWIA 5K5OA 3TT2A 2EB7A 2VBYA 3C26A 4MFLA 4CGNA 3H4QA 4NQWA 4CGPA 1QBJA 1YO5C 3T5XA 4OINF 4LB6B 1BO4A 3WTWC 1S7OA 1LRZA 4B8XA 1T0FA 2CNTA 3L09A 4R1HA 2GWRA 4KZTA 2HYFA 1ULYA 2VBXA 4HA8A 4IJAA 3K9TA 5AONA 4YFXF 3R4KA 2ZCWA 4KOSA 2PBIA 2R8VA 2EK5A 5ICCA 1XMKA 3H3ZA 3LSTA 5FD6A 3F21A 5I0CA 1D8JA 2HKXA 2QENA 2JLMA 5H20A 3G73A 3KP2A 5LRRA 4ZZLA 4BYYA 1PP7U 1MK4A 2RGVA 2V79A 3K1PA 2BUEA 4FD5A 2HYGD 2F2EA 1Z05A 5G20A 2LF7A 3GW2A 4CAFA 1GVJA 3QPTA 2Z33A 5A2QK 3COAC 4EVIA 1OYWA 3ZQ7A 3PFIA 3GVAA 4H0EA 2CNSA 2IJLA 3REOA 4MEYF 2XHKA 3CTAA 4N9HA 4CAVA 2CW0F 3S2WA 4A5MA 2PLYA 1STZA 5CVVA 4L9VA 4TV7A 1ON1A 3QU3A 5HDKA 1C0WA 5BOXA 4E2AA 2Z9OA 4CZZA