2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
1RI7A 4H6ZA 3S2WA 4I02A 5ICCA 3GW2A 2EV0A 2FIWA 2HGCA 3I59B 1OKRA 1B87A 5BQTA 1IYKA 2H94A 3HSFA 2HKXA 1IZ1A 5ERIA 2DPUA 2QMLA 2EVNA 1ZG5A 5HDKA 3DPLC 1YVKA 4IXAA 1X3UA 3LAJA 1GHCA 5KTDA 1EH8A 1OZPA 3LQRA 5AIPA 1H0MA 3ROUA 2HDCA 2FNAA 2FMLA 1W7PA 2PG4A 1E2XA 2M8EA 5H6QA 3I54A 4M72A 4L8AA 1Y7RA 1TW2A 3WU1B 1S7AA 4N9HA 4BHBA 2L3DA 5IV0A 4PSXA 3DNSA 1CM0A 4IRGA 3FXUA 2B58A 4M9ZA 1ZLJA 1T38A 4XRFA 5JHUA 4AVAA 3ZMVA 3D2MA 3CXSA 3GX4X 4H6UA 2IT0A 2FBIA 3MFKA 3WTSC 3FHZA 3P7NA 1XSVA 3DQVC 5JFRA 1ZG1A 2DT5A 2L02A 1T2KA 2WPXA 2F2EA 2RGVA 2NNYA 3UY5A 4G7OF 1D8JA 3CXPA 4R8HA 3I3GA 2HS5A 4HA8A 2KJBA 1XGSA 2B5GA 1GXPA 2YX4A 5E1WA 5D5XB 4HLXA 3R6SA 4OU0A 3CLOA 1OMIA 2XKOA 1ZAOA 5A2QZ 3EYIA 3O3KA 4MEYF 5D5WB 5A2QK 1UFHA 1EH6A 3QP5A 1BIBA 2W85A 3WTVC 2VBWA 3R95A 3W6JB 2ESHA 4AIKA 4ESBA 5D5VB 2FL4A 4E70A 2VBQA 3HSRA 3IWFA 5FO5A 2E7XA 2LSOA 2G9WA 3JSOA 3COAC 1S7KA 2NS0A 5C82A 3KETA 5JVTA 3CO7C 2MH2A 1MKMA 4OOIA 3F8MA 2C27A 3SXYA 2V9VA 4I49A 4PK2A 3PQJA 3ECOA 5K5OA 4KZTA 1KQ9A 4LLGF 3G73A 4OIOF 1J59A 1ZHFA 4HW0A 4B09A 3QRFF 1IF1A 5LLQA 3B02A 1G3TA 3V7CA 4ESJA 1FSEA 3BY6A 1FNNA 1FPQA 4D0PA 3TQNA 1ZLKA 3ZN0A 4IJAA 2PI0A 2BL1A 1FX7A 4JXRA 4OLLA 2R7DA 4Y49B 4LLLA 1UHWA 1YVOA 3FXTA 3W6XA 2YR2A 1PUEE 2NMTA 1WRJA 2HFHA 1H9TA 3DXJF 3GVAA 4UHTA 3DKWA 4KIFA 2EFWA 5ILSA 3KLOA 3R0JA 1UCRA 1QPMA 3CO6C 5KVRA 1UB9A 2FSWA 1U5TB 3G8WA 1SFUA 3I9SA 3TO6A 5D6FA 2EK5A 3TTHA 3J7AO 2PR8A 2Q4VA 4BQAA 4AG9A 1I1GA 3K2ZA 3VWEA 2DU9A 4XNHB 4HBLA 4EGZA 1TNTA 4OADA 3FBUA 4ENMA 3CTAA 4WWCA 3R61A 4PGHA 4R9MA 3WTUC 4P96A 5H84A 2K5TA 1BC8C 2X7BA 2FBHA 1USSA 2XROA 3HHGA 1UFMA 1LJ9A 2L4AA 3ERED 1F9NA 3K9UA 1GXQA 4WXHA 4KIBA 4A12A 2RNJA 5L3DA 3TDUC 4HKFA 5H86A 4MQVA 2KJCA 4HNWB 4AVCA 4BHPA 3R9FA 2BSWA 3KP5A 2OB0A 2P5VA 1T0FA 5E18F 4ZYDA 3R4KA 4RS8A 4KNYA 1I12A 3VODA 2QIRA 3EDPA 5HDNA 5F46A 4XSXF 5L3GA 5DD8A 4HQEA 3IKTA 4DQ2A 5F6FA 2ZNZA 1G4DA 3T9YA 4CAXA 4KVXA 3MAJA 2H6CA 2F5FA 4GS4A 2CY2A 2F5IA 1FBSA 1R23A 1IICA 3O6BB 1J5YA 4FX4A 4M85A 1Z6TA 4I01A 3U9GA 2GANA 1IB1E 1V0CA 4JXQA 4HX7A 3CUQB 3HHHA 2M87A 2AS5F 3K1PA 3IL2A 4ENKA 4UWJA 3ZJ0A 4RB2C 4HNXB 1XSXA 2QECA 5JQ4A 4NQWA 2ZW4A 3N4MA 5LGNA 4X5KA 1Q1HA 1EH7A 1UHMA 4IRHA 5ILUA 1WWZA 5EEHA 2Q04A 3BJAA 4MY0A 3DP7A 4ZYGA 3BOQA 3HTSB 2FEZA 3F22A 4KFCA 4G94A 4GO1A 1ZRCA 3SHFA 2FS5A 4JWPA 4PCQA 4KN4X 2VI7A 2H09A 4IUSA 1LVAA 3F8CA 2HTJA 1M1DA 3MQ0A 2XRNA 5F1RA 2ADUA 3GFMA 5K5QA 1NMTA 4L0YB 2PMUA 2A68F 1Z6RA 2RQPA 2G7HA 1C0WA 1FYMA 1DUXC 2LNBA 1Q2YA 2ISZA 1K78A 1L0CA 1DP7P 1VKCA 1B59A 3ULQB 4BHCA 1HW1A 3P2HA 2DK5A 3R60A 3TOBA 4KOWA 4L5JA 2GXBA 5IX3A 1P4NA 1J7KA 1LB2A 5CLSA 4R3LA 2FSRA 2HV2A 4L5IA 5ISVA 2CG4A 2ISYA 1YQAA 2XGXA 5DWNA 3BJ7A 4EM1A 1P2FA 5LHIA 2ZBKA 4Q47A 4MTDA 1PP8F 2HEOA 4I09A 1YTYA 2QVOA 3CXQA 4Z2YA 4O6JA 3KP2A 3L7WA 5DCMB 2QQ9A 2P6FA 4HV5A 4RB1A 1IXRC 4ASNA 2WWYA 3ZP5A 4EVIA 1HKQA 2Y0MA 1I21A 4L9JA 3VOEA 2R1IA 3LQQA 2IA0A 2L54A 4EV0A 2D1HA 4CGZA 4YFJA 2QBYB 2H6BA 1KU3A 1XMTA 1KUXA 1HKSA 4A0YA 2X4HA 3ZZIA 2CQKA 4XPLA 4PGGA 2EA4A 2PJPA 2A61A 1IIDA 3WTZA 4MJ8A 3MWMA 4M9XA 1QBJA 4NEXA 5LHHA 3E6DA 2PDOA 1CF7B 3F6VA 3FIXA 3F21A 4U88A 4ENJA 3MZYA 5LRRA 3SXOA 1TQMA 1YS6A 2V1UA 1TW3A 4KMUX 4DNCA 3LA7A 4CAVA 2EV5A 2G7UA 3T0YA 2P7VB 3T8RA 4KOSA 4XPDC 1IRGA 2EFQA 1WK4A 2GWRA 4M71A 5FLXZ 1G6NA 5F47A 2BV6A 4L0ZB 3I58A 1O7LA 4KLWA 1BI2A 4I7HA 1XE4A 4G7ZF 1YFHA 2ZW6A 4CHUA 5LEJA 1MDMB 1K7AA 2M1BA 5FLXK 1IYLA 3F8BA 5C88A 1ODDA 2CNTA 4B5PA 1S29A 4IPAA 5E1ZB 1B6BA 3F72A 5EEGA 1OYYA 2ZMEB 2VXZA 1BO4A 1G3SA 1S8NA 4S05A 1U3EM 4ESFA 5J6XA 4XBFA 3SZTA 1XIXA 3QP6A 4F7ZA 2IA1A 2Z3YA 3ABTA 3LFKA 4NHJA 1KQ0A 1DPUA 1ON1A 2ZCWA 3ML6A 4FD4A 1N71A 2H27A 4LMYA 4HX4A 2FE7A 3ZN1A 4ZZLA 4GYIA 3JUWA 3M8FA 2P0WA 2PSWA 2REEA 4UVAA 3EC4A 2Z10A 1R58A 3E0KA 2RKHA 2AE6A 4Q48A 2CW0F 5DYMA 4O3MA 3V8KA 4A2UA 4LK1F 4U5YA 2A4NA 1J0RA 3FRMA 3Q5FA 1FBUA 4BXUA 1BBYA 4I98B 3MZHA 4M3SA 1J2XA 2CGPA 2ZW5A 2J8RA 3F8KA 3P9CA 3T8TA 4G6QA 2FT0A 3GF2A 5AIQA 2CSOA 2P6EA 4N0BA 3QAHA 3R96A 4KOUA 4EJWA 1LEAA 3K1MA 4MQ9F 5L3CA 2WPWA 5ED4A 3GKRA 2W57A 3E6MA 3QPTA 4LFUA 2ATRA 1XMKA 2VE9A 4OINF 3N97A 1HBXG 5FVJA 1I27A 2XAFA 4JK1X 2VBXA 3E5XA 4AIJA 5H20A 3WTWC 2GIVA 3P9IA 1BOAA 1KZFA 1LDKB 3WU0A 3W91A 1WQ2A 2F5DA 4FD6A 1YS7A 3LAPA 2MLGA 1D5VA 4ENNA 2RDPA 3R9GA 2K4BA 2HQYA 3WGIA 3GY9A 4G9YA 3EYYA 3H4QA 3HYIA 2HR3A 4RAZA 4EJUA 1YK3A 1B6AA 1IW7F 3V8LA 2EFOA 3SXNA 2MD5A 1BI0A 5LGTA 2CNMA 4HYEA 4E0AA 1BN5A 1TIQA 4RGXA 3FF5A 2A3SA 4U0WA 5D8KB 2PC1A 4L9TA 4M9SA 4XSZF 3E3VA 3TFYA 2GZWA 4AIHA 5LGUA 2PQ8A 1CJWA 4HZFA 3F8FA 3J80Z 2ZFWA 3HRMA 5HOOA 4M74A 4NXYA 4EM2A 2HTSA 3J80K 2ARHA 4WK8F 3TKYA 1LNWA 2XAJA 2UXNA 2D4PA 4GCVA 2XVCA 3S6FA 4HDUA 2XASA 4I0BA 3KZYA 3M9AA 1HSTA 2M5WA 2ZW7A 2QUFA 1LRZA 5ICGA 4AVBA 1Z4RA 2O28A 4MBUA 3PGPA 1U2WA 2GE3A 5FFXA 1ULYA 4R3KA 1WWXA 5E1XA 3J81Z 2IRFG 4CXFA 2OZ6A 5E8GA 3GZ5A 1G3YA 3J81K 5EC4A 1YW7A 2QM3A 2Y75A 2B4DB 2VZZA 2Q2EA 4EVYA 1EV7A 2HYGD 3EY5A 3BP8A 4L9VA 3IKVA 4LK0F 3IRQA 1ON2A 2E1CA 4LG0A 3WGGA 1KUVA 3FMRA 5FD5A 4IHSA 4LLNA 1P4WA 2PBIA 3FX3A 1QQIA 5FD6A 2ZNYA 1YREA 4KIGA 1FBQA 2B3UA 4LB5A 1JHFA 1ZN2A 1BI3A 4CDGA 2DTRA 3ELKA 3KFWX 1CGPA 3VFZA 1S7FA 2J8NA 4KUMA 3IRRA 3DR6A 2Z0ZA 4A5MA 3F6OA 2K4JA 1TBXA 1QZZA 1YG2A 3W6KB 5ICFA 1SFEA 2RN7A 4HLYA 1GVJA 1SAXA 2F5EA 1S5KA 5DCMA 1Z9UA 1S7LA 1YR0A 1SMYF 5HLGA 2ELHA 4LB6B 1BI1A 3TCVA 1QZYA 2DK8A 5D6EA 1S3JA 1H9GA 3MEXA 4YIFA 1XDSA 2KIMA 4ETSA 1XEBA 1LDDA 2DLLA 1R00A 3LA2A 3Q9VA 5LBQA 3GXOA 2AXLA 4YFXF 4H89A 2DI3A 3RYOA 1RZ4A 2EFNA 2A6EF 4LD5A 3DDDA 4QLCU 3D0SA 2HZTA 3QOPA 2XV4S 3WE3A 1REPC 3V7SA 3V8IA 3R0AA 2MLKA 2MC3A 2EFPA 2YSRA 5LEKA 2ZPAA 1O3QA 1T98A 1WKMA 1W7PB 1NSLA 3ABUA 4UV9A 1VTNC 4BH9A 3BPVA 3V8JA 2HUZA 3ZPLA 1KU7A 3G3SA 5CYVA 1RXTA 3AAFA 4Y17A 4BNCA 5BMZA 3EFAA 3K0LA 4M6YA 4MNUA 4KVME 1RO5A 3LD2A 3ZQ7A 3D2PA 1KU9A 1M4GA 3FMSA 2JPBA 3MGDA 2UZKA 1L3LA 3P2FA 1FP2A 4ZYEA 4K2EA 5J8FA 2STTA 5EBVA 3SHPA 2VONA 5I0CA 5FGMA 1B1BA 1O3RA 3LODA 3L9FA 2IW5A 1Z4EA 3FMQA 1FT9A 4QWQA 2OD5A 2Q44A 2DQRA 2ZXJA 1QSRA 5E20A 4ZBGA 6PAXA 1XGNA 2K86A 2JDDA 2VOOA 2XAHA 3NEUA 2B5GB 4B8XA 1SD4A 1QSOA 2VODA 4AG7A 4II9A 4CS0B 2O61A 3R1KA 5ILVA 3HOTA 4FT8A 1ON0A 3R9EA 4KYWA 4KUBA 2D45A 2VXKA 4EGYA 1IXSB 1PP7U 1S7NA 2Z9OA 2OBPA 2W84A 5F49A 1Q2DA 3H3ZA 4UWIA 4IF5A 5CVRA 3RKYA 3M1EA 1K6OA 1FWZA 3TO9A 3WR7A 2PMHA 1DPRA 3QPHA 2G0BA 1U6MA 2STWA 1F5TA 2R3SA 3LWFA 3ZMZA 2ZJ2A 3RJPA 2O6GE 2FF4A 4A6DA 1XD7A 4Q5SF 3I59A 1O3SA 4GXOA 2OQRA 1TQPA 2JTVA 2K7LA 5L3EA 3FZVA 4U7BA 3TOAA 3F23A 4LGWA 2A07F 3TGNA 1P6RA 2BBYA 4GYGA 1AOYA 2B4BA 1HKTA 3VB2A 3JAMZ 1IN6A 2PFBA 2XAGA 4B5OA 3GWZA 3TE4A 2IJLA 1P4XA 1Y0UA 3CJNA 3S6GA 1FC3A 1YX0A 2ZXVA 3BROA 3F5BA 1RUNA 2P8TA 3QB8A 2CFXA 3KEOA 4KORA 3WGHA 5CVJA 4KOVA 1IUYA 2Q8KA 1Z7UA 2V1XA 2VQYA 3I53A 1MK4A 1S3ZA 1JE8A 5CNPA 3OV8A 2J5PA 2Z33A 3TDZC 2HWVA 1MZBA 2C6YA 4ZYHA 1OYIA 5TRDA 4P9FA 2L01A 2BUEA 4MEXF 3FM3A 4F6AA 4L9NA 2MA3A 4MHDA 4AB7A 3TO7A 3S6KA 5HLIA 1LQ1A 1AWCA 1XGMA 2Y48A 3L00A 2DQLA 3RPUA 3C7JA 1R1VA 3MCZA 3RKXA 5FB2A 2G3TA 5AONA 2L4MA 4HF2A 5K1YA 4UA3A 3EUHA 4NB5A 2Q0YA 3GFIA 3PFIA 1FZPB 3N7ZA 4XPKA 2VT3A 4RGRA 1NHAA 1R1UA 5DUKA 1YYVA 2QENA 1R36A 2EUIA 3NE7A 4CRYB 2P6TA 3SQNA 3L09A 4G8XA 4L18B 4IHTA 1J9IA 5E17F 2OZGA 3KP6A 2LF8A 3U1DA 4ZH4F 3W6SA 2O0YA 2A69F 3JTGA 1XB4A 3KP4A 5ICEA 3HUGA 4PSWA 1M44A 4IF4A 4RGUA 4KVOE 3FWEA 4JJXA 3DSBA 2D1VA 2D2WA 1FP1D 2A5YB 4XPDB 2CYYA 1R7JA 2HYFA 2PLYA 5IB0A 1ZRDA 2EJRA 3E97A 1R1TA 2JRTA 2BEOA 4UVCA 4HDVA 1DDNA 1IN5A 4CRZB 1SD5A 1TNSA 5L3FA 2K02A 1STZA 1U78A 2ETHA 2RC4A 2OA4A 5J8CA 2M45A 2G3AA 1Z05A 2V79A 3B8GA 1L0OC 2R98A 4HV6A 5BS6A 1FLIA 5BPIA 3HRTA 2COMA 1J75A 1XMAA 4LUAA 3ECHA 1VHSA 5E8IA 2XHKA 4EQQA 3RPQA 3WODF 2VBZA 2EA2A 4ON0A 4A5NA 1ZH5A 1B9NA 1QSNA 2OQGA 1U5TA 3ZMTA 5DDGA 4BMHA 3BJ6A 1IXCA 4WX9A 1F1ZA 1FY7A 1I1DA 3I5UA 3GFLA 1LEBA 3IHUA 5DWMA 3V7RA 4ONUA 1K78B 4U9ZA 2OU2A 1KYWA 2EV6A 4I0AA 2MBFA 5DCFA 3T5XA 1PUAA 4IRIA 3DPTA 2VOPA 5FFZA 4R87A 3DF8A 4FD5A 1K79A 3BLNA 1YW8A 4AWXB 1P0HA 1W7PD 1W4MA 3FXRA 1LDJA 5K5RA 2P4WA 1R5HA 4R57A 3WTYC 1SD6A 5HS9A 2FQ3A 3F8NA 4EJOA 4CZZA 2IL4A 3GZ6A 3FYNA 3CDHA 2QYOA 1XF8A 2KCWA 2FXAA 4H0EA 4GGGA 1K4JA 4E2AA 4S04A 4YFNF 2PEXA 2TDXA 2FNPA 3KCCA 1B9MA 5BPDA 1T6SA 5DV5A 3D3SA 3B73A 1PU9A 4JLYA 2VE8A 1HQCA 2Q0OA 3DFGA 1SD7A 4PZJA 1V3FA 1R22A 3BDDA 2OAZA 4WF2A 1YIOA 4WXCA 4O5VA 1J4JA 2RVCA 1MD0A 2FU4A 3F0AA 2X0LA 5KTCA 3O2PE 1R57A 4A0XA 4PK3A 1D3YA 2MH9A 4BYYA 4NSQA 4WXDA 4UBRA 2VN2A 2YU3A 1FOKA 3K9TA 3M8EA 1Y9WA 2CNSA 4KOYA 1IN7A 1JHHA 3CUQA 4N9IA 2W25A 3ZMUA 4QUSA 2I79A 1OYWA 1OR7A 3RIRA 3DV8A 2EB7A 4EJVA 1YLFA 3I4PA 4XLPF 4KMFA 1Z1DA 3JW4A 3PP9A 4HF0A 2O8XA 2XIGA 3VEPA 3HRUA 2UWMA 1G3WA 4B5PB 2WC2A 4OMZA 2KIFA 3GO5A 4QBJA 3GYHX 4HF1A 3RYRA 4KT5C 5KTAA 2FCKA 2JDCA 5JR3A 3I64A 1ZG3A 3K69A 1O57A 2E7WA 5IT3A 1BIAA 3KE2A 4Y49C 2P6GA 2QWWA 3JVNA 2CWEA 3DEUA 2JLMA 2J5OA 2DPDA 4UVBA 1S60A 3E5UA 2VBYA 1RUOA 3EXNA 1TQIA 5DUIA 2EWNA 2AJ6A 5CJ9A 1U5TC 4P9UA 1WSUA 2WTEA 2OZHA 4HQMA 2FIAA 3Q9SA 2FRHA 3IWGA 3RDIA 2NRAC 3NQOA 3OWCA 4YGOA 3KP3A 1D8KA 4R79A 2GQQA 3I0TA 2R7HA 1XDUA 4XNHC 2KRFA 1KU2A 3C1DA 1I6XA 1Z91A 4A6EA 1YO5C 3CUOA 3LSTA 1MJAA 2HQRA 3GUDA 5HVQC 3HIFA 1SFXA 2IA2A 1B4AA 2PN6A 3GEZA 4U9YA 4ZZDA 4KICA 2RV8A 2QQBA 4E8OA 5E96A 3JTHA 3ZMSA 3LA3A 2QBYA 3FM5A 4J3GA 1ZGAA 2V1DA 3H92A 4RI1A 2VZYA 1S6LA 3HTUA 1BJAA 3T90A 2WV0A 2YX7A 4UNOA 2UXXA 4PV6A 3H3UA 3EETA 2P6SA 4QVTA 2B3VA 2ESNA 4RB0A 5HH1A 3REOA 2JSCA 4RAYA 1CF7A 2NYXA 2ZO4A 4FX0A 4YFKF 1U6GA 2A6HF 4HX8A 1XCVA 5D4SA 5JPHA 4JBAA 4L89A 3BJOA 4F0YA 1USTA 3F3XA 2Q7BA 2P7CB 3NRVA 4MY3A 2FXFA 3FB3A 1YW9A 4R1HA 4WCGA 2GXGA 2DFIA 4CICA 4MGRA 2B0LA 4MTEA 3V4GA 1MDMA 1KQ8A 5KK1A 1JXSA 3ISPA 3P9KA 2OZUA 1JGSA 2XAQA 5LHGA 4MHGA 2NAZA 3OOPA 4EM0B 4CYDA 3CUQC 1ZARA 1XCBA 4QC6A 4Q4ZF 2ZMEA 4OIQF 4HAMA 1HSJA 1FSHA 3FXQA 3TT2A 2XKPA 3K1NA 4PDKA 3WTTC 1M4DA 3HSEA 2OH1A 3HOSA 1FYLA 3S6HA 3QU3A 2FE3A 4K30A 1WI9A 3FNCA 2PR1A 5CVIA 5IT9Z 4AVPA 4OAEA 3SZPA 4LX9A 4U0VA 2HKOA 5GCNA 5IT9K 2PRBA 1OPCA 3I71A 4UV8A 1V4RA 2Q4YA 1P92A 4CO8A 4P5OA 3C26A 2Z5UA 2QLZA 2VC0A 1KYZA 1E17A 1KUYA 2VT2A 1T39A 3G3ZA 1IAWA 4KN7X 3D8PA 4XLNF 1HXDA 2DAOA 1IN4A 4NF1A 2FMYA 4KUAA 2K27A 5HMNA 1ZREA 1FYKA 4YG2F 3L2CA 4G6DA 2O03A 1HW2A 1A04A 3IC7A 5TJJA 4NCZA 4LG0B 4KDPA 1ZRFA 2QQAA 1R5GA 5HLHA 1GHEA 3KP7A 2JPCA 2GA1A 1M4IA 3WTXC 1IRFA 2JZYA 1KA8A 1P4AA 4TV7A 3GYAA 2FBKA 2I00A 1QSMA 1F4KA 5D5UB 1Y9KA 2CO5A 2M30A 3SFZA 3JAMK 5HS7A 3KZZA 4KLVA 4KOXA 2F5CA 2R8VA 2BYVE 1XN7A 2REFA 3IWZA 1W5TA 5HDGA 5CVVA 3BJ8A 2P5LC 3BWGA 4JQFA 2JT1A 2R7FA 4P55A 1QO0D 2FA5A 1TLHB 2YPRA 3C3WA 2VEZA 1TTYA 4U0YA 1HW5A 3U2RA 3RKWA 2HOEA 4Y15A 2V6CA 1MGTA 5JI6A 2Z99A 2LF7A 4JD6A 1XGOA 1BC7C 5H6RA 2NNNA 3QU6A 2KIUA 2H5MA 4RB3C 4G7HF 2LDUA 3T1BA 3WG9A 1ZGJA 1W5SA 3BPXA 4LJZF 3E6CC 2KKOA 4QB9A 2IPQX 1I1SA 2DO7A 1MJBA 4KOTA 2QZ8A 3BZ6A 2ZKZA 4RS2A 3KEQA 4M73A 4RGSA 4OIPF 2IP2A 4BAYA 3RYPA 5DEQA 4YRHA 1QNTA 2XUBA 4FHTA 1BOBA 4KA4A 4UXNA 1XSDA 2Z11A 3VWDA 4UUVA 4OMYA 4EJTA 1Z9CA 3HRSA 3GFJA 4YIIA 1IN8A 2BGCA 3C18A 1YLEA 2DXQA 1S7OA 1NE9A 3D5LA 2B4DA 2GAUA 4U7DA 4ORFA 3DR8A 2O3FA 1PDNC 4I2OA 2JEVA 3RI4A 1ONVA 1SMTA 2BE5F 1Q2CA 1RIOH 3ZMDA 4M6XA 3EO4A 4IVNA 4Y13A 2D4OA 4HOBA 2P5KA 3PZJA 3EQLF 1BM9A 1KGSA 1O7FA 3WE2A 2IVMA 3IGRA 3KKWA 5CVUA 5L3BA 5HS8A 1O3TA 3RTRA 5D4RA 4OIRF 1YGHA 4CAWA 4MI4A 1MJ9A 3KLNA 3E6BA 5LRSA 4FD7A 2ACJA 5DD4A 4EMSA 2W24A 1U8RA 4AD9A 3GLXA 3JSPA 2J8MA 1RNLA 2DBBA 2FOKA 2GA2A 2HQNA 2VC1A 2E1NA 3M7GA 5BOXA 5F48A 5D8LB 1QGPA 2DW4A 3E5QA 1ZYRF 5F64A 2BEIA 4A0ZA 4HNYB 1QSTA 2LKPA 3PQKA 1SQHA 1I5ZA
chains in the Genus database with same CATH superfamily
1RI7A 5B66C 3FBIB 3D66A 4H6ZA 2E34A 3DBHB 3S2WA 4XIDA 1IW4A 3PB6X 4I02A 5ICCA 2ZJRF 2CJJA 5THWA 3GW2A 2EV0A 4II2A 2FIWA 3BR0A 5AG6A 2HGCA 3QYFA 3QWPA 3AG4H 5M5YJ 1Z77A 3BZCA 2OF7A 2X51A 2CV1A 3I59B 1OKRA 2QQCA 1B87A 5BQTA 1IYKA 2G9DA 3CDIA 2H94A 3CMYA 2E60A 3S16J 4M3FA 3HSFA 1XC5A 4IAVA 2HKXA 3Q0WA 1IZ1A 5ERIA 3HOZJ 2DPUA 1DS2I 2QMLA 1VF9A 4NGQA 2EVNA 4BQQA 1ZG5A 5HDKA 3DPLC 2NS7A 4O23A 1YVKA 4HRIA 4IXAA 1X3UA 2CV0A 5FKLA 3LAJA 2JVGA 3NARA 3OYFA 1GHCA 3DGVA 2ZFUA 5KTDA 5K8OA 2C6GA 3L1PA 2AFXA 1EH8A 1OZPA 3ABLH 3LQRA 5AIPA 2ZELA 2DJNA 3GLLA 1H0MA 1V1HA 3ROUA 2HDCA 2YQPA 2FNAA 2FMLA 1W7PA 3WC6A 2PG4A 2WADA 1E2XA 3QPSA 4A94A 2M8EA 3CC7I 5H6QA 3I54A 4M72A 2KDZA 4L8AA 4E7ZA 4MCPA 1Y7RA 1WGTA 1TW2A 3WU1B 3B35A 1IDYA 1S7AA 1UG0A 4N9HA 4BHBA 5IOZA 2L3DA 5IV0A 4PSXA 4CYPA 3DNSA 1CM0A 4PUSA 5CQGA 4IRGA 1ENHA 3FXUA 3IV5A 1S7EA 1Z2LA 2OPTA 4AMLA 2B58A 2YUSA 4M9ZA 1ZLJA 1LUJB 1T38A 4XRFA 5JHUA 4AVAA 3ZMVA 3RO0A 1S72I 3D2MA 2R4GA 2ERWA 3CXSA 3GX4X 4JX6A 2QKLB 4H6UA 2IT0A 3CCVI 2FBIA 3EUAA 1D0YA 3K4BA 1LE8B 1OBRA 2Z2SB 3MFKA 3SEKC 2V77A 1OCRH 3WTSC 2EWBA 1ULMA 1EE3P 3FHZA 3P7NA 2DPSA 1XSVA 3VARA 3DQVC 2IBDA 5JFRA 1ZG1A 2DT5A 2L02A 5CQEA 1X3ZB 3A01B 2CTCA 2K5CA 1T2KA 1R6RA 4MHZA 3BR5A 2WPXA 4G6TB 2I10A 2F2EA 2RGVA 1RKTA 2ZEHA 2J9RA 2NNYA 3OS0A 3UY5A 2M8GX 4G7OF 2GREA 1D8JA 2JBJA 2MYSA 1XPXA 3UKGA 1ULNA 2NOGA 3DWLE 3BJIA 1ELLP 3CXPA 4R8HA 3I3GA 2HS5A 3B3SA 1DS3I 4HA8A 2VXDA 2KJBA 1XGSA 3PB9X 2B5GA 3OYMA 1GXPA 2YX4A 1MBJA 5E1WA 5D5XB 1TBNA 4CYNA 4HLXA 3R6SA 4OU0A 3OYBA 1D1CA 3CLOA 3FK7A 2MFZA 1OMIA 2I5UA 3PSIA 2XKOA 1ZAOA 2XB5A 2K3PA 5A2QZ 5J3LA 3EYIA 3B6AA 4HNVA 3I3LA 3O3KA 4F9VA 3BLYA 4UCNA 3ZRGA 1K83J 5FKOA 2NU0I 4MEYF 1VQKI 2BOLA 5D5WB 4E1PA 2X9DA 3IAS2 5A2QK 1UFHA 1CG2A 2PRQA 1EH6A 3MKZA 3NA6A 3QP5A 1G59A 1ZLIA 2HPIA 2NSMA 1BIBA 5ELYA 1Z8XA 3PB7X 2W85A 3NWSA 5LYLA 4ANJA 3WTVC 4BJTA 1LFBA 2VBWA 3CZ6A 3R95A 2DIPA 3W6JB 2ESHA 4AIKA 2DKVA 4ESBA 2NVQJ 5D5VB 1OCTC 3HH2C 4NJRA 2O5RA 4E70A 2FL4A 4U87A 2VBQA 4C2MJ 3HSRA 3IWFA 1Z7KB 2G0EA 5FO5A 2E7XA 2LSOA 3LL7A 2G9WA 3HUGB 3JSOA 2ZEEA 3CC2I 4DYCA 4F91B 3BCAA 3COAC 1S7KA 2NS0A 3IU1A 5DS9A 5C82A 1U5KA 2ID3A 3KETA 2LG4A 5JVTA 3CO7C 4C3JJ 2MH2A 3FK6A 3SFIA 1MKMA 2HQ5A 4OOIA 1MSEC 4GRIA 3F8MA 2QGUA 2C27A 3HOUJ 1AYEA 3SXYA 2Z3LA 2V9VA 4I49A 2V9KA 4PK2A 3PQJA 3KHZA 1RKWA 3HLPA 1IG7A 2K9MA 3ECOA 5K5OA 4KZTA 2WY7Q 1KQ9A 1HF0A 4LLGF 3G73A 4FTHA 4OIOF 3S14J 1J59A 3RZOJ 1GVDA 1ZHFA 2ANPA 4HW0A 1Z7LA 2OTLI 5EGOB 2QA4I 1I50J 4B09A 3QRFF 1IF1A 5LLQA 5E3NA 3OYAA 2Y9ZA 3B02A 1G3TA 2JA2A 1AKHA 5EMIA 3V7CA 4D7MA 1FSEA 3HL2A 3C2GA 4ESJA 3BY6A 1FNNA 3BC8A 4UXJA 1LAPA 1FPQA 5EJCA 3NE8A 2OTJI 2CU7A 2LMDA 1X74A 1Y1BA 4D0PA 1W36C 5HNFA 3ESWB 3CJRB 2VUMJ 1Y0RA 3TQNA 2KMPA 4F0XA 1ZLKA 3ZN0A 4IJAA 1TGSI 4D1QA 2PI0A 2WCYA 2BCOA 2BL1A 3OSFA 1FX7A 2RIJA 4JXRA 3AL0C 4OLLA 5EZGA 2ZB9A 2R7DA 2DMUA 3HBLA 4LLLA 4AVZA 1UHWA 4Y49B 1TKJA 1YVOA 4MFLA 3FXTA 3W6XA 2YR2A 2NU4I 4XRMA 4HGUA 2PJ7A 1PUEE 2NMTA 1WRJA 2HFHA 1H9TA 3DXJF 3GVAA 4UHTA 3DKWA 4A3MJ 2R93J 4UUSB 1YQEA 2JA1A 2IJZA 2KZGA 4KIFA 2EFWA 1J09A 2ZXIA 5ILSA 3KLOA 2KISA 1UCRA 1QPMA 3PFYA 2CFOA 3R0JA 1CSOI 1XJOA 3CO6C 5KVRA 3K4JA 1UB9A 2FSWA 4A38A 4A3LJ 3OYCA 3TX8A 1U5TB 3G8WA 1SFUA 5GPCA 3FEDA 3Q3SA 1RETA 1ZR4A 1BJZA 2LC2A 3I9SA 3TO6A 5D6FA 2N8GA 2EK5A 1WJCA 2R7QA 5F0FA 4D5CA 2VQHA 3P5JA 5JHWC 5AG5A 3J7AO 1TWCJ 2PJAA 3TTHA 2PR8A 1ULKA 2DT7B 3UFFA 2PJ6A 3UEYA 2DDBA 3OVOA 2A20A 2Q4VA 3KYDB 4BQAA 4A69C 1E3OC 4AG9A 1I1GA 1VQ6I 2Z3PA 3K2ZA 3VWEA 2RB7A 4CCJA 2DU9A 4XNHB 4HBLA 4EGZA 1RR8C 2W0TA 1M8BA 1MBFA 1TNTA 1MNDA 3FBUA 4FWUA 2L5QA 4ENMA 2VJ5A 3CTAA 2VKEA 4OADA 4WWCA 3R61A 3FXLA 3CDXA 4PGHA 1WTJA 4FBEA 4RM2A 1DU0A 2LP0A 2ELIA 2NU3I 4R9MA 3WTUC 2K9LA 4P96A 5H84A 2K5TA 1BC8C 2X7BA 4FUUA 2FBHA 1USSA 2JN6A 1IO2A 2XROA 2QQEA 4IHVA 3HHGA 1UFMA 1LJ9A 2L4AA 4XOPA 3S1MJ 3ERED 3S15J 1F9NA 2XPUA 3OL3A 5IPAA 3K9UA 2CXAA 1GXQA 4WXHA 4UXIA 4KIBA 1MMGA 1JTYA 4HSTA 4A12A 2RNJA 3IH4A 5L3DA 3TDUC 4Y3OA 1TL8A 3CPXA 4HKFA 5M3MJ 4MQVA 2KJCA 4HNWB 5H86A 4AVCA 5FUYA 4BHPA 2JZMA 3R9FA 5HVHA 3NWTA 2BSWA 2M7AA 3KP5A 3WC5A 1GUUA 2CUEA 3JCUC 3PJRA 2OB0A 1M4LA 1WFXA 2P5VA 3D7GA 1T0FA 5E18F 4ZYDA 2PJ9A 3R4KA 9WGAA 2C1CA 2ZEOA 4A33A 2IGOA 4RS8A 2PJRB 1JUPA 2JUGA 3I4MJ 3D00A 4KNYA 4J19A 2RQQA 1I12A 2XB0X 5J47A 3DPUA 2MSYA 3FJUA 1W5CC 2GKRI 3VODA 1MMAA 2QIRA 4ONWA 3RQIA 3H3VK 4EMEA 3EDPA 5HDNA 3JREA 2IAIA 5F46A 4XSXF 1JKPC 5L3GA 5DD8A 2VIXA 4HQEA 4K3NA 3IKTA 4DQ2A 5F6FA 1I3QJ 2ZNZA 4A3GJ 4MXUA 1G4DA 3T9YA 3ZQIA 3MRUA 4CAXA 4BDYA 1NSAA 5DM7F 2R7WA 4G1PA 4KVXA 2B63J 2J87A 2V7FA 3H5RA 4B11A 3MAJA 2ELJA 2H6CA 3HKZN 4ABZA 2AQFA 1CPXA 2F5FA 2PIZA 3CCMI 5K8NA 4GS4A 3S8PA 2CY2A 1I6HJ 2F5IA 2ZXHA 2DA5A 1XRYA 8CPAA 5A27A 1FBSA 1R23A 1TUSA 1IICA 4JX4A 3VE5A 3O6BB 1J5YA 3ASOH 3OL4A 2CMPA 4FX4A 4M85A 4ZDOA 4DUKA 1Z6TA 4I01A 4OIWA 3U9GA 4QPQA 4BY1J 2GANA 2JA8J 2ENNA 1YX5A 1IB1E 1V0CA 4JXQA 4P4BA 4HX7A 5EG0B 3CUQB 3LSRA 2PJBA 3HHHA 1ETOA 2BY0A 2WAEA 2COBA 2M87A 1A35A 2AS5F 4CA0A 3K1PA 3IL2A 3GZNB 4ENKA 3IWWA 4UWJA 4OVOA 3FC3A 3ZJ0A 2Q43A 3E0JB 3I9V2 3UEJA 3LACA 3G1OA 4RB2C 3SJEA 4C2YA 5M3FJ 4HNXB 1XSXA 2QECA 5JQ4A 4NQWA 3CCSI 2ZW4A 3N4MA 3BZKA 5LGNA 4X5KA 1Q1HA 3CP2A 1EH7A 1UHMA 3D5SC 2AO9A 4IRHA 5EEHA 2LBFB 5ILUA 1WWZA 3BJAA 2GU2A 2Q04A 3DP7A 4MY0A 3VDXA 4ZYGA 3BOQA 3HTSB 3HB9A 3IH2A 2FEZA 3F22A 1WJBA 4KFCA 1WJFA 2JK3A 4G94A 5FKNA 4ZI6A 1IGBA 2ZJQF 4BE1A 4GO1A 3HDDA 1ZRCA 2ODFA 2F4MB 3SHFA 2FS5A 4JWPA 2VQGA 2LUYA 2FVGA 1RESA 4PCQA 2K9NA 4KN4X 2VI7A 3GTKJ 1P7IA 2H09A 2M4KA 4IUSA 2X48A 1LVAA 1IRXA 3F8CA 4XKCA 2HTJA 1M1DA 3MQ0A 2XRNA 5F1RA 3CJTB 5J4YA 5FUXA 2ADUA 3GFMA 5K5QA 1Q7LA 3EPZA 3OYHA 1NMTA 4L0YB 2PMUA 3Q0UA 2A68F 1Z6RA 2RQPA 4HNTA 4DYRA 2G7HA 1C0WA 2WAFA 1FYMA 1DUXC 3D68A 1W0UA 5HVFA 2LNBA 1Q2YA 4CCLA 2ISZA 1K78A 1L0CA 1DP7P 4Y7NJ 1B59A 1VKCA 2DOAA 3ULQB 5AG7A 1HW1A 4BHCA 3P2HA 2DK5A 2GVIA 3R60A 3TOBA 1X2NA 4KOWA 4L5JA 2GXBA 2P81A 3HPHA 3H5ZA 1YJWI 1E3PA 2DYRH 5IX3A 1P4NA 1J7KA 1LB2A 5CLSA 4R3LA 2FSRA 2HV2A 4L5IA 5ISVA 1IC8A 3GIUA 2CG4A 3QQAA 2ISYA 1P9QC 4GXHA 1YQAA 2XGXA 5DWNA 3GBGA 3BJ7A 1HDQA 3AG2H 1Z3XA 4EM1A 1P2FA 5LHIA 2PE3A 2ZBKA 4Q47A 3B3TA 4MTDA 1PP8F 4A3FJ 2JRMA 2HEOA 2Y2ZA 4I09A 1YTYA 2NVXJ 2XSDC 5FROA 2PMZA 1YITI 2QVOA 3CXQA 4Z2YA 2K9SA 4O6JA 5K7ZA 1WCMJ 3KP2A 3L2QA 2XEFA 3NH4A 2CTBA 3L7WA 5DCMB 2QQ9A 4XLCA 5D29A 2P6FA 4NC6A 4HV5A 4RB1A 1IXRC 4F92B 1QVTA 2E35A 2ZEGA 2IGNA 2XEIA 2L7KA 3BR3A 4BEHA 5CPAA 4ASNA 2X6XA 1YMEA 3CZXA 1AHDP 2WWYA 3ZP5A 4CCNA 4EVIA 1HKQA 5IOYA 4MPIA 4B3AA 2Y0MA 1I21A 4L9JA 2V8DA 5IYBJ 4A24A 3S17J 1VI0A 3VOEA 1G2HA 2R1IA 3IC1A 3LQQA 2IA0A 2OR4A 1OLTA 2L54A 4EV0A 2BVLA 2D1HA 4CGZA 2Z3MA 4YFJA 1FARA 4MFEA 3ZQQA 2X85A 3KL9A 2HOAA 2DPTA 2QBYB 4B13A 3QAYA 2H6BA 5GAEJ 4IHYA 1KU3A 1XMTA 4M3EA 1KUXA 1HKSA 4PXBA 2Y0SN 3FXOA 3BT9A 2VJIA 2X4HA 4A0YA 3HZJA 3FXMA 2CW8A 3ZZIA 1MMSA 5HXDA 1PVEA 3S3OA 2IEKA 1X12A 2CQKA 4XPLA 1X58A 4PGGA 3LSIA 1T0FC 2EA4A 2PJPA 3L2WA 2A61A 2DA7A 1IIDA 3WTZA 3WT4A 3Q0VA 4MJ8A 3MWMA 1FAQA 4M9XA 3OYGA 1QBJA 4NEXA 1XX6A 4CCOA 1QQ9A 1UELB 1XA6A 2AXTC 5LHHA 3E6DA 4EFDA 4RMNA 2PDOA 3SDBA 1CF7B 1CT2I 5KHDA 3F6VA 3FIXA 1PJRA 3F21A 4U88A 4ENJA 3MZYA 1YRNA 3FKIJ 5LRRA 3SXOA 1TQMA 1YS6A 3DTKA 2V1UA 1TW3A 2QQDA 4NGTA 4I99C 4KMUX 2B9SA 2F8HA 4DNCA 3LA7A 1PUFB 3KR4A 4CAVA 2EV5A 1X3WB 2G7UA 3T0YA 3CCEI 4BS9A 2P7VB 3T8RA 3CQZJ 3J7YJ 3LSMA 4A3CJ 4KOSA 4UIAA 3G4SI 5IP9J 4XPDC 5EZHA 3J7AY 1IRGA 4JYKA 2EFQA 4HNUA 1WK4A 1JKQC 2GWRA 4M71A 5FLXZ 1G6NA 5F47A 2BV6A 2L0KA 5F27A 4L0ZB 3I58A 1O7LA 4KLWA 1BI2A 4I7HA 1XE4A 5J1YA 4G7ZF 1YFHA 2ZW6A 4CHUA 5LEJA 1K7UA 1MDMB 1K7AA 1VDDA 2M1BA 2ZEMA 4L5EA 5FLXK 4P4JA 1IYLA 3F8BA 5C88A 1ODDA 1F36A 2CNTA 2XF5A 1R0RI 4B5PA 1S29A 3H1CA 4IPAA 1Y56A 5E1ZB 4XN3A 1B6BA 2JSPA 3GTOJ 1R79A 3F72A 1F57A 1UVGA 1AU7A 2UV1A 3A02A 4BJ5C 3VATA 1GV5A 5EEGA 1K4TA 2FJ1A 1OYYA 3IP4B 2ZMEB 1IOIA 2JBKA 1VQMI 2VXZA 1BO4A 1G3SA 1S8NA 1DQUA 5F1JA 4S05A 4ESFA 1U3EM 3WHCA 1TOTA 2N1AB 5J6XA 4XBFA 1A36A 4LIVA 3K7AJ 3CXLA 2XGEA 3SZTA 1XIXA 3QP6A 4MCRA 4F7ZA 2IA1A 2Z3YA 3ABTA 3LFKA 2J9AA 3BTCA 4NHJA 3S1NJ 1KQ0A 1DPUA 1ON1A 1UZCA 2ZCWA 3ML6A 4BE0A 1VQPI 4GI3C 2VQLA 4XRSG 4FD4A 4RN7A 2BW3B 1N71A 3L2RA 2H27A 3DTEA 4BXFA 2KDOA 4PXDA 4NGNA 2V26A 4LMYA 4HX4A 2YNCA 1WZ2A 2FE7A 3ZN1A 2ORVA 5JM6A 3VPRA 4ZZLA 4GYIA 3JUWA 1JUMA 3RBUA 3TW7A 2R7ZJ 2ABZA 1ZLHA 3SJGA 2WA0A 3M8FA 4OC1A 2P0WA 4RDUA 1R9TJ 3M1CA 2PSWA 2WSAA 2REEA 4UVAA 3EC4A 2Z10A 4OC3A 4A2ZA 1R58A 3E0KA 2RKHA 5C3EJ 4OC4A 2DEAA 3V42A 2AE6A 4Q48A 1RRJA 3JRBA 2HOSA 3VWBA 2CW0F 3GB0A 2NU1I 4XL9A 5DYMA 4O3MA 1PCEA 1TC3C 3V8KA 4A2UA 4LK1F 2IXSA 3ZQLA 4U5YA 2DMQA 3TC8A 2V53A 2A4NA 4CGMA 1J0RA 3JRFA 3Q5FA 3FRMA 1FBUA 4C2ZA 2UVOA 4BXUA 4E7HA 1BBYA 4I98B 1LFWA 3MZHA 4GFBA 1LCPA 4M3SA 2M0CA 1FT7A 1J2XA 2CGPA 2PJ3A 2ZW5A 2J8RA 2OOTA 2CS3A 2A6TA 3EUKL 3SGQI 3F8KA 3P9CA 3T8TA 4P44A 4G6QA 3LSHA 3TEDA 2FT0A 1TWHJ 4AIDA 3GF2A 5AIQA 3A1YA 2CSOA 2R5YA 4N0BA 1HOMA 2P6EA 3FMCA 2Y31A 5KAFC 4V19K 3GTMJ 3QAHA 2SGPI 4KOUA 5F0HA 1BW5A 3QWLA 4EJWA 1LEAA 3KIOA 3K1MA 2E2IJ 1M1EB 3G6EI 2OV7A 4MQ9F 3WG7H 5L3CA 1B72B 3PUBA 2KRCA 3H36A 1LR8A 1YJ9I 1V5GA 4S0HB 1PTQA 2WPWA 3KI9A 5ED4A 2ZXWH 2W57A 3E6MA 2CWFA 3GKRA 2FD5A 2DCEA 3QPTA 4LFUA 2VJJA 3JRDA 3RKQA 2Y9YA 2ATRA 2O9LA 1HDLA 1XMKA 2VE9A 4OINF 3LSGA 3N97A 1HBXG 3IO1A 1I27A 4Q36A 4R6TA 2XAFA 5FVJA 5AGEA 4IOAF 3JTKA 3K4NA 3PIOF 1TXRA 4JK1X 2F6CA 2VBXA 3E5XA 4AIJA 2DODA 5H20A 2F3CI 4A39A 2BY1A 3WTWC 2F4IA 3LSJA 2H8RA 3B3VA 3H8FA 2GIVA 3P9IA 2QPOA 2DYSH 2OVOA 1BOAA 1KZFA 1LDKB 4LQ6A 3WU0A 3W91A 1WQ2A 2BXZA 4XICA 2F5DA 3G1LA 3L2VA 1BAVA 3J7ZI 4UCPA 4FD6A 3BG6A 1ZQ3P 3E2IA 3ASNH 2DJIA 1ZG7A 2F7VA 1YS7A 5HVGA 5F04A 3LAPA 2MLGA 4D9JA 1D5VA 4DZJA 4ENNA 2RDPA 1VHOA 3R9GA 2EBIA 2K4BA 1Q9BA 4X1EA 3WGIA 2CWHA 2HQYA 3GY9A 3IU2A 4X0GA 4G9YA 4PJJA 2MGQA 1PYTB 2NYQA 3EYYA 3H4QA 4FCYA 1XX5A 2DMTA 4V2GA 3HYIA 2HR3A 4RAZA 1ETXA 1Q1VA 3TBIA 4EJUA 1YK3A 1B6AA 3MMYB 2V1CA 4M6HA 2HZDA 1EKEA 1IW7F 3MVPA 3V8LA 3S32A 3ZQFA 2EFOA 3SXNA 4FQGA 2R7TA 1HDPA 2MD5A 3KZIC 3UOEA 1UJ8A 1BI0A 5LGTA 2CNMA 3I55I 1H88C 4XK4A 4J01A 4HYEA 1WPKA 4E0AA 1BN5A 3PM1A 1TIQA 4RGXA 3VYRB 3FF5A 2A3SA 1PPFI 4ZY1A 4U0WA 4CYCB 5D8KB 2PC1A 2EZHA 3OIPA 3CMEI 1HLVA 1P7JA 3S9MA 4BL0B 1WI3A 2QF7A 4PFOA 4L9TA 2E1MC 4M9SA 4XSZF 1VQ8I 1V55H 2L7ZA 3BCBA 3E3VA 3TFYA 5EDNA 3H35A 2GZWA 2V4JC 4D7NA 4BXXJ 4AIHA 1SGEI 3C2HA 5LGUA 2PQ8A 1CJWA 2V8HA 4HZFA 4J00A 2DA6A 1TKFA 4CH7A 3F8FA 1BUSA 4C30A 3J80Z 2ZFWA 3K4MA 5HQ8A 4A3KJ 3HRMA 5EF6A 4XMYA 4RBOA 5HOOA 1Z8LA 1XMXA 2ME0A 4M74A 3B4VC 1TF8A 3KGQA 4NXYA 4EM2A 2HTSA 1IJWC 3J80K 2O8KA 2ARHA 1PYVA 4WK8F 1DE4C 3TKYA 1LNWA 2GKVA 2XAJA 2UXNA 2D4PA 1MNEA 2V1NA 2LY9A 4GCVA 2XVCA 2BO9A 1K4SA 3S6FA 2R5ZB 1MBHA 4HDUA 2EK8A 2XASA 4I0BA 3KZYA 3D67A 3S1RJ 2IS2A 5D8NA 5LRGA 1H89C 2IMOA 4M6IA 2SGEI 3CLQA 3M9AA 1YU6C 1T8IA 1SFKA 1HSTA 2WVJA 2EILH 2M5WA 2ZW7A 2QUFA 1LRZA 5ICGA 4AVBA 5EG0A 1B8IB 4F55A 1FMVA 1Z4RA 4E1RA 2O28A 4MBUA 3D5RC 4B44A 3PGPA 1U2WA 3FF3A 2GE3A 5LFAA 5FFXA 1ULYA 1F2OA 1V5EA 4R3KA 1HJAI 1YIJI 1WWXA 3OIOA 4F8ZA 5E1XA 2NVTJ 2VRWB 2ROWA 3J81Z 2UUZA 2IRFG 4IQJA 2EZIA 3G71I 5K7FA 1X19A 1DTDA 2EO8A 4CXFA 2OZ6A 4ZGYB 2YNCC 5E8GA 2RNGA 3GZ5A 3S2HJ 5LYFA 1G3YA 2TCTA 3J81K 5EC4A 2CH0A 1YW7A 2QM3A 2Y75A 2OUMA 2B4DB 1HPTA 3BI0A 1E3HA 2VZZA 5E3QA 2Q2EA 4EVYA 1EV7A 2HYGD 1SGDI 4B48A 4KS9A 2DA3A 1IY7A 2BVMA 4PK4A 3WU2C 4NFRA 3EY5A 2JA7J 3BP8A 4L9VA 2AFOA 5JVGF 3IKVA 4LK0F 2X6WA 4RAGA 4XRSA 3M8JA 3IRQA 1S5LC 2E5NA 3F9KA 1ON2A 3AG3H 2E1CA 4LG0A 3CF5F 3WGGA 2HDWA 2IS4A 3LFUA 3FMRA 1F2PA 1KUVA 5FD5A 3IFEA 1IV6A 4H2KA 3OXFA 4IHSA 1LANA 4LLNA 2Q51A 1P4WA 2KL4A 3BQZA 1IV8A 2PBIA 1QQIA 3FX3A 2K85A 4E7SA 3CJQB 5FD6A 1DGRM 2ZNYA 3R5AA 1YREA 4I76A 4P6YA 1KONA 4KIGA 1FBQA 4DW6A 3R5DA 4L9MA 2B3UA 2VASA 4ZC3A 1A6IA 5CKTA 4LB5A 2VPLA 1JHFA 1ZN2A 1BI3A 4CDGA 2DTRA 3ELKA 3KFWX 1CGPA 4A3JJ 3VYUB 1VQOI 3VFZA 2QSFX 3PO2J 1S7FA 2HNHA 1OMTA 3KR5A 1TWFJ 1TP4A 2Z3OA 3VH9A 2J8NA 4RA2A 3KASA 1MW7A 4KUMA 1VHEA 3IRRA 4MFDA 1Y7EA 3DR6A 2Z0ZA 4KITB 4IOCF 5K7HA 2WV1A 3HG9A 2MG4A 1JKOC 4A5MA 3F6OA 2AFZA 1A2ZA 2K4JA 1SAUA 2QYVA 2M7BA 1VNDA 2JUCA 1TBXA 5E3RA 2R7VA 1QZZA 1YG2A 3W6KB 2DN0A 1TWGJ 5ICFA 4C3IJ 1F43A 1SFEA 2RN7A 7WGAA 4HLYA 1GVJA 4CAEA 1SAXA 1IY5A 2F5EA 1BLLE 1S5KA 1VQNI 2M9HA 5DCMA 1Z9UA 4XLFA 1S7LA 1UVFA 2L9VA 1YR0A 1MBEA 2XDVA 1Z0XA 1SMYF 2ELHA 2W1OA 5HLGA 2F48A 4PJLA 4LB6B 3RYOA 1BI1A 3TCVA 2KMUA 1X1CA 1JJ6C 1QZYA 2DK8A 2D5VA 3SJXA 5D6EA 4P10A 1S3JA 2JEWA 3OOUA 4RLFA 1H9GA 3MEXA 4YIFA 2AHQA 4JX5A 1XDSA 4IQ4A 2KIMA 4ETSA 3KYLA 1XEBA 3MKLA 1LDDA 1FTZA 5FRNA 2DLLA 1R00A 3WHBA 3LA2A 3Q9VA 5LBQA 1HEVA 3NFZA 2M2EA 3OIQA 3GXOA 4BQOA 2N17A 5JLXA 2AXLA 4YFXF 2DMNA 4H89A 3H0GJ 3M3YJ 3AL0B 1YW6A 1QPIA 1ETYA 2KQRA 2CUJA 1NG6A 2KP6A 5B1BH 3K70D 1UUCA 4B4CA 3A03A 2DI3A 5E3MA 1CGJI 1RZ4A 2EFNA 1JGGA 2V1CC 2A6EF 4LD5A 4C9YA 4EEFG 3DDDA 4R76A 4QLCU 5KNLA 3D0SA 2HZTA 2NOJB 3E1SA 4N4NB 3FVLA 3QOPA 5M5WJ 1BA5A 3BG7A 4UUTA 4XOTA 3OL0A 2B7EA 4IK2A 2HPMA 2XV4S 3MZ8A 3WE3A 1REPC 1VIXA 3V7SA 1SANA 4ZTFA 5HNHA 1XG1A 1JT6A 3L2UA 1VQ5I 3R0AA 3R5CA 2PX9A 3V8IA 1VQLI 1D5YA 2MLKA 3JR9A 2MC3A 3MKYB 3FH4A 2EFPA 2YSRA 5LEKA 1WGXA 1N13A 3B6CA 3W6VA 2ZPAA 1O3QA 1T98A 1WKMA 1W7PB 1GV2A 2AFUA 1NSLA 3ABUA 4UV9A 3OXGA 2V8VA 1VTNC 3WABA 4BH9A 3BPVA 3QYBA 3V8JA 4QIWN 4KISA 2CIJA 1N77A 2HUZA 3IEHA 1I3AA 4A93J 3ZPLA 1PJUA 3CD6I 5H2FC 1KU7A 1D0ZA 2EZKA 3G3SA 1T95A 5CYVA 1RXTA 3AAFA 4Y17A 4C2XA 4CGOA 4UEEA 1X1DA 4BNCA 5BMZA 1Z67A 2EINH 3EFAA 4WJBA 3K0LA 5IB9A 4M6YA 1JI8A 4MNUA 4KVME 2H8WA 1RO5A 2JYYA 1KBFA 3LD2A 3ZQ7A 3D2PA 1KU9A 1R49A 4A31A 4XORA 1M8CA 1M4GA 4ZY0A 3FMSA 2M5XA 4I6ZA 2JPBA 3JRIA 3TP3A 4DBQA 2EPFA 3VDPA 1IOFA 3QOEA 3MGDA 2UZKA 1L3LA 4NC7A 3SJFA 3OYKA 3DU5A 2B8TA 1DU6A 3P2FA 1FP2A 4ZYEA 2MC4A 4K2EA 5J8FA 2L9RA 3HUVA 4ZYAA 4NGRA 3DBRB 2GIZA 2STTA 1LPQA 3PBBA 5EBVA 1ZO0A 2VONA 3SHPA 5I0CA 5FGMA 1B1BA 1O3RA 3LODA 3L9FA 4XKBA 2IW5A 1Z4EA 4E7LA 2KRHA 3FMQA 1FT9A 5JHFA 3E59A 1XFOA 1H8AC 3FSYA 4QWQA 3M4OJ 4MFPA 2OD5A 2Q44A 5G20A 4P4DA 2DQRA 2ZXJA 1TWAJ 1QSRA 1EF4A 2BUSA 5E20A 4CSWA 4MFJA 3DLJA 4ZBGA 6PAXA 1X1PA 1XGNA 4BBHA 2K86A 2RREA 2JDDA 1YLOA 1FOYA 3S93A 2XAHA 3NEUA 2VOOA 2B5GB 4B8XA 1SD4A 2LH9A 2WBMA 3OS2A 1QSOA 4M6GA 2VODA 4NJQA 2BW3A 4AG7A 3HPGA 4IL6C 3ZXSA 2O61A 4CS0B 2Y69H 4II9A 3R1KA 5KCMA 5ILVA 1VZ0A 3HOTA 2GOXB 2EK9A 4FT8A 1PTRA 1ON0A 2DOEA 1HEEA 4MCQA 3R9EA 4KYWA 4KUBA 2D45A 2VXKA 1WHUA 3AFHA 4EGYA 1NK3P 1OISA 1IXSB 3JRAA 5IYCJ 3H9JA 1PP7U 1S7NA 1SGQI 2WAQN 1OCPA 2Z9OA 2OBPA 2W84A 5F49A 2X1CA 1Q2DA 3H3ZA 4UWIA 4IF5A 3UNGC 5CVRA 5FUWA 4UCMA 4JOMA 4GDFA 3RKYA 3M1EA 1OCZH 4IZZA 1K6OA 1FWZA 3TO9A 1ZGWA 3WR7A 2HVRA 2PMHA 1DPRA 1NUBA 2PMZN 3QPHA 2G0BA 1U6MA 2STWA 3BXMA 5HODA 1F5TA 2R3SA 1JJ8C 2B0UC 3GLJA 3LWFA 3ZMZA 3PNTA 2E73A 1AUGA 4RM3A 2ZJ2A 3RJPA 3BG5A 1PCAA 2O6GE 4YWYA 2FF4A 2L9NA 4A6DA 4LIUA 1XD7A 2Y30A 1D1BA 2L9SA 1X4PA 5EX3A 3KQZA 2BOAA 4Q5SF 4ZX9A 4IKFA 1TBRR 4AXVA 3I59A 1O3SA 4GXOA 2HB6A 3IWEA 2OQRA 1TQPA 4W97A 2JTVA 4FE7A 5FKMA 2ZEPA 2K7LA 2VPRA 2WAQA 2LVSA 5L3EA 2X1DA 1LR7A 1KWMA 1QU3A 1BPMA 4OC0A 3FZVA 4U7BA 3TOAA 3F23A 1YOVB 4LGWA 1KMAA 1QA6A 2A07F 3TGNA 1P6RA 2BBYA 4GYGA 1SVOA 1AKHB 1AOYA 2B4BA 1XTAA 3R96A 2KLOA 2KHMA 1MMNA 3VB2A 1HKTA 2GM4A 2L8EA 1TURA 5KAIC 3JAMZ 2GXAA 3BTLA 1IN6A 2ID6A 4DYOA 3PIPF 2JA6J 4XKWA 4UFXA 4MO7A 4G12A 2PFBA 2CJSC 2XAGA 2AQEA 4B5OA 3IJ3A 5JH9A 3GWZA 5E3PA 3TE4A 1TKHA 2DA2A 4NNJA 2IJLA 1WJDA 2R7RA 4WWVA 1P4XA 4W1UA 1TBOA 1Y0UA 5BWAB 4KSIA 1WKXA 3CJNA 3KPHA 2N71A 3S6GA 3GTGJ 1FC3A 2KPMA 2SGQI 2L7XA 1YX0A 2CW7A 2VKVA 2Z1DA 3BROA 5GPAA 2ZXVA 1QMUA 4XLHA 3ISXA 4XM3A 1OMUA 3ZQCA 3F5BA 1RUNA 2P8TA 3QB8A 4DIQA 4JCVE 2DB6A 2CFXA 3KEOA 4KORA 3OYJA 3WGHA 5CVJA 1U0JA 3H9GA 3PUFA 1O4XA 4KOVA 4MHNA 1IUYA 2Q8KA 1Z7UA 2V1XA 2VQYA 3I53A 2ZOGA 2AFMA 1MK4A 1SVLA 1S3ZA 4N4OB 5FLVA 2YUUA 3GTPJ 5CPRB 2UZ3A 5I4MA 3OSGA 1LE8A 5A28A 4UF4A 4IEJA 1OYVI 1JE8A 2HDDA 5CNPA 2XAUA 3OV8A 2J5PA 2Z33A 1XBUA 3TDZC 2HWVA 3RPUD 1MZBA 2C6YA 2VI6A 4LOCA 1FEXA 3A01A 2DFHA 2R92J 1R5ID 4PPZA 5K8MA 1Y39A 4ZYHA 1OYIA 5TRDA 1GT0C 3D1NI 4P9FA 2L01A 2BUEA 4MEXF 2XSJC 2PJ1A 3FM3A 3LMMA 4F6AA 4L9NA 1FYBA 2MA3A 4MHDA 4AB7A 3TO7A 3S6KA 4MIMA 5HLIA 1X4OA 1LQ1A 1AWCA 2QSHX 1XGMA 2Y48A 3L00A 2LB7A 2DQLA 2DFFA 1WH7A 2LOOA 3HEFA 3RPUA 2HVSA 4AM3A 1JWQA 3BR1A 2ECBA 4PQAA 3C7JA 1R1VA 3MCZA 3CP8A 3RKXA 1AA7A 3VSKA 3O8HA 5FB2A 2G3TA 4OAZA 5AONA 5C4XJ 4XR6A 1WJ5A 1YX3A 2BY2A 5KTCA 2L4MA 4HF2A 5K1YA 4UA3A 4UFWA 3EUHA 4NB5A 1SGPI 2Z3KA 2Q0YA 3GFIA 1LR9A 3D7DA 3PFIA 4E7IA 1FZPB 3N7ZA 3PB8X 4XPKA 4OKOA 4P4IA 2VT3A 1R4NB 1NHAA 3KX2A 1R1UA 4RGRA 1YYVA 2QENA 3HJEA 5DUKA 3RSNA 3CDLA 4AU7A 4AYBN 1R36A 1TF9A 2EUIA 3L2NA 5TISC 3NE7A 1V54H 3D7FA 4CRYB 5C4JJ 2ELKA 3A0HC 2P6TA 4PJNA 3SQNA 3L09A 4G8XA 2YNDA 4L18B 2M4GA 3FXKA 1Y6IA 4IHTA 4UEFA 1J9IA 5E17F 2OZGA 1H0ZA 1Z3YA 2DFEA 2OD1A 3U1KA 3KP6A 4LITA 1LAMA 2LF8A 1X1AA 2OC6A 3K2AA 3LWUA 3U1DA 4CZCA 3MD2A 2NVUB 4TNUA 4ZH4F 3ONQA 1R3NA 4NGPA 3SJMA 3W6SA 2O0YA 5EX0A 2A69F 3JTGA 3VSLA 1XB4A 3KP4A 5ICEA 3HUGA 3ZQGA 2E2HJ 4PSWA 2KT0A 4SGBI 2OCEA 3UGLA 2DTZA 2RFHA 1M44A 1XMBA 4IF4A 2TRTA 4RGUA 4FASD 4KVOE 3FWEA 4JJXA 3DSBA 3IAM2 2D1VA 3UGDA 1FOXA 1Z8WA 2D2WA 1FP1D 1V1IA 5F0CA 3B7IA 2A5YB 4XPDB 1P9ZA 5DAEA 4BQNA 2CYYA 1R7JA 2HYFA 2PLYA 2R7OA 5IB0A 4B14A 4OMEA 3MN2A 1ZRDA 2EJRA 4AYBA 2GBYA 2JJ7A 2ECCA 1R1TA 1G8XA 3E97A 2JRTA 1K61A 3U21A 2BEOA 4UVCA 1HA8A 4HDVA 1DDNA 1IN5A 4NBQA 4CRZB 1A5JA 2WZNA 5J4VA 5EGOA 1SD5A 1TNSA 5L3FA 1YJNI 5G21A 2K02A 1STZA 1U78A 2KMRA 3K2KA 2ETHA 2RC4A 5F09A 4WP4A 2OA4A 3ZOBA 5J8CA 1EA3A 2M45A 4IX7A 5DM6F 2G3AA 2Z3NA 4AC0A 1UG2A 1Z05A 5J1RA 2V79A 3B8GA 4M3DA 3FDYA 2FNFX 3CMMA 1L0OC 2R98A 4HV6A 5BS6A 1FLIA 4ZYQA 5BPIA 3HRTA 4NQWB 2VLAA 2P6AC 2COMA 3ABMH 1OVOA 2IS6A 1J75A 1XMAA 3CT9A 3OY9A 4LUAA 2M34A 4E7KA 3ECHA 1VHSA 5LRJA 2LLKA 5E8IA 2XHKA 3QODA 4EQQA 3RPQA 4UB8C 3WODF 3CCQI 6CPAA 1ERDA 2ZEDA 1BR4A 1NG7A 2VBZA 2EA2A 4UUSA 2WGCA 4ON0A 4GM5A 4A5NA 1ZH5A 1CP6A 1B9NA 2WY8Q 3IUOA 3UR3C 4BU2A 1W36D 4KSAA 4RUHA 3W3CA 1QSNA 4YELA 1ZELA 5J1UA 2LK2A 3NH5A 2JW6A 2OQGA 4OWRB 1U5TA 3ZMTA 4B3XA 5DDGA 4BMHA 3OYNA 3BJ6A 1IXCA 2XF6A 4WX9A 1F1ZA 1FY7A 1YI2I 3GUXA 1CQTA 3KYCB 1I1DA 3BTJA 4TWEA 3I5UA 2WYRA 2ICWG 1JT0A 3GFLA 1LEBA 4P4FA 3IHUA 5DWMA 3V7RA 4ONUA 3S3NA 4JP0A 1K78B 3MEKA 1FNOA 2GFQA 4U9ZA 2OU2A 3GCMA 1KYWA 2EV6A 4I0AA 2MBFA 5DCFA 1BPNA 2EIJH 2EIKH 3T5XA 1PUAA 4IRIA 3DPTA 2LYCA 3DLAA 2VOPA 5FFZA 3BR2A 1GDTA 4C7HA 4R87A 3TMOA 4PJ0C 4C7IA 1Y8RB 2ORWA 3DF8A 4IHWA 4FD5A 1K79A 3BLNA 4DYQA 1YW8A 4AWXB 3VYSB 1P0HA 4X6AJ 2EZLA 2IQ6A 1CT4I 1W7PD 5B3SH 4BACA 1BL0A 2E1OA 3H5AA 5TGTA 1W4MA 2PVVA 2RAEA 3PRTA 1VQ7I 3FXRA 4PXEA 1LDJA 4RAFA 2DOFA 3PNYA 5K5RA 3OS1A 1LFPA 1R5HA 2P4WA 2ME6A 4R57A 3WTYC 1KZHA 4B43A 1SD6A 2LKXA 1A6QA 5HS9A 3IIBA 2FQ3A 3F8NA 4EJOA 1ARMA 4CZZA 2IL4A 1MSFC 3GZ6A 3FYNA 4UEZA 4FETA 3CDHA 1NH3A 3S9NA 5GP9A 1Y0NA 2QYOA 1XF8A 3BTIA 2KCWA 2FXAA 1TZLA 1TT0A 4H0EA 2XRCA 4OIDA 2XC7A 3LNQA 4BEHB 4GGGA 3S3MA 3CMAI 4Z6YA 1K4JA 3BI1A 4B12A 4EATA 5AG4A 4E2AA 1OQYA 4S04A 4YFNF 1IU8A 2PJRA 2PEXA 2TDXA 2FNPA 3KCCA 1VQ4I 2M3AA 4XONA 1B9MA 1HC8A 1Z8TA 5BPDA 2O53A 3TJQA 1K6YA 1T6SA 2VL1A 3H9QA 4H4KC 5DV5A 3B73A 3I56I 1LOKA 1PU9A 1R43A 3CF2A 3D3SA 4JLYA 4R8FA 4A37A 2VE8A 4M3GA 3EUHC 1HQCA 2Q0OA 1V5FA 1K7TA 3DFGA 5BNGA 1SD7A 4PZJA 4C2UA 1V3FA 1R22A 2XRLA 3BDDA 2OAZA 2LEOA 4E6KG 4WF2A 1YIOA 4WXCA 4O5VA 3SZGA 1FIPA 1WH5A 1J4JA 3HGYA 2RVCA 1MD0A 4X2TA 2FU4A 2W4SA 5E3OA 2X0LA 1BR2A 3O2PE 1SFOJ 1FJLA 4A0XA 2GLOA 1R57A 3F0AA 4PK3A 4PXCA 1D3YA 3OYLA 2FUG2 3H5NA 4QTRA 1YE9A 2MH9A 4BY7J 2EIMH 4AUXA 4BYYA 3GTQJ 2XPWA 4NSQA 4WXDA 4UBRA 2VN2A 1Z21A 2YU3A 1FOKA 3K9TA 3M8EA 3FSXA 1Y9WA 3DKYA 4YIRX 1Y1VJ 2ZEFA 4ITVA 3VDUA 4KJZA 3OXLA 4CYQA 2IS1A 3K6GA 4EWTA 1GYTA 2CNSA 1VGYA 4KOYA 4ZY2A 1YRNB 2PIYA 1IN7A 5F08A 3CUQA 1JHHA 2BZTA 3HM5A 4N9IA 2W25A 2F5VA 2ZSHB 3O8GA 3ZMUA 2LREA 1S20A 4OC2A 2DA4A 4QUSA 2I79A 4C68A 1FOWA 2E1MB 1OYWA 1YHQI 1OR7A 3RIRA 3C2BA 2EB7A 3DV8A 1YLFA 3I4PA 4E4HA 4EJVA 4XLPF 4KMFA 1Z1DA 3JW4A 5LD2C 5FUVA 3DU6A 2LBFA 1XOVA 3T8WA 4DBRA 3CCRI 2HXIA 4Q38A 1SVMA 3PP9A 3RAMA 4HF0A 3FECA 2DMPA 5HLTA 1ZG9A 4IHXA 2O8XA 2XIGA 3RQ4A 3VEPA 1ELMP 1MIJA 1SGYI 5DS0A 2CRGA 1IUFA 3HRUA 2UWMA 1G3WA 3OWTA 4B5PB 2WC2A 4OMZA 2KIFA 4B10A 3GO5A 1MBGA 4A95A 2I3CA 4QBJA 2VJ4A 3GYHX 2AFSA 4HF1A 2V6EA 3RYRA 3A0BC 4KT5C 2HYJA 2LY2A 5KTAA 2FCKA 2NU2I 2CF4A 2Q7SA 2JDCA 4NGSA 1OJLA 4BINA 1JUSA 2PCUA 5JR3A 3I64A 1ZG3A 1R4MB 2Q4ZA 3K69A 1SGNI 1O57A 1CHOI 2E7WA 3PL8A 4BGDA 5IT3A 1WGCA 1BIAA 4FE4A 1AMPA 3KE2A 1XBTA 1BW6A 4YRVA 2LD5A 4Y49C 2CQQA 2ODDA 1A31A 2P6GA 2QWWA 3FISA 3JVNA 4MLOA 5FLMJ 1OFCX 2CWEA 1XS9A 3DEUA 2JLMA 3KHXA 1RPWA 3G2BA 4V2FA 2J5OA 3LMSA 2DPDA 4UVBA 1S60A 4Q7AA 3E5UA 4MFZA 1MNMC 2VBYA 1RUOA 2JWTA 3EXNA 1ITYA 2K9QA 1RFHA 1POGA 1TQIA 5DUIA 3PSFA 3S2DJ 1UHAA 2EWNA 1JQGA 5CJ9A 1U5TC 2AJ6A 4P9UA 3FKJA 1Y1CA 1WSUA 2WTEA 2BXYA 2HOTA 2OZHA 1MH4A 3AG1H 4HQMA 2A5WA 2FIAA 3Q9SA 3HOWJ 2FRHA 3IWGA 2GKTI 3RDIA 2NRAC 1ETQA 4IHMA 3PNVA 1NK2P 1SGRI 3NQOA 3OWCA 4YGOA 3KP3A 1D8KA 3FHNA 2GQQA 3I0TA 4R79A 1XDUA 3N05A 4A3EJ 3CCJI 1ZG8A 2R7HA 4XNHC 3K4CA 2KRFA 1KU2A 2JQ7A 4ZJZA 3C1DA 1W4RA 1I6XA 1Z91A 4A6EA 1YO5C 3CUOA 2JVHA 3FXJA 2PJCA 3LSTA 1MJAA 2HQRA 3QNVA 3GUDA 5HVQC 1ORKA 3HIFA 2PVWA 1SFXA 2IA2A 1B4AA 4UB6C 1X1BA 3DKXA 3PBEA 4CGLA 3ISZA 2PN6A 3GEZA 3HC7A 2R5YB 4F9UA 3RCOA 4U9YA 4ZZDA 2KIQA 2ZJPF 4KICA 2RV8A 3GMEA 2QQBA 4E8OA 2A05A 4JYWA 5E96A 2E36A 5GTIC 3QPLA 4BJ6C 4ZDLA 1HDUA 2R7UA 2QCOA 3JTHA 3ZMSA 3LA3A 1Y1WJ 2QBYA 3FM5A 4YEJA 4J3GA 1ZGAA 2PJ2A 2V1DA 2V9PA 3H92A 4RI1A 2VZYA 1LKXA 1S6LA 1BJAA 2KFDA 3HTUA 4X3RA 3T90A 4B6ZA 1Z5RA 2WV0A 2CUZA 4CPAA 2NXNB 2YX7A 2R0QC 4A3IJ 4UNOA 2VKDA 2UXXA 4PV6A 3H3UA 3JRGA 3OMYA 2WUUA 4M6VA 3EETA 3MN8A 5E3LA 2P6SA 5G1ZA 4QVTA 2QVPA 2B3VA 3ZCOA 2ESNA 4RB0A 5HH1A 3REOA 2L7FP 2JSCA 2BHYA 3OR2C 4RAYA 2M0MA 2GOMA 5CBMA 1CF7A 4MMOA 2VB6A 2NYXA 2XPVA 2ZO4A 3HGGA 4FX0A 4E7JA 2YU9J 2OJED 1N25A 4YFKF 4Y52J 5K8PA 2H1KA 1U6GA 3H0DA 2A6HF 4HX8A 1XCVA 5D4SA 2SGFI 5JPHA 4JBAA 3A9LA 4L89A 3BJOA 4F0YA 1PUFA 3FIWA 5FKKA 4XLAA 1OCCH 1USTA 5JLWA 1TBQR 2BHZA 3F3XA 2ZENA 3SGBI 2Q7BA 2DXIA 9ANTA 2P7CB 2YGWA 4PFPA 2DDAA 2CUFA 3NRVA 4MY3A 2FXFA 3FB3A 3PB4X 1YW9A 4R1HA 2DA1A 4WCGA 2GXGA 2DFIA 4DOZA 4XQFA 4UXHA 3SI1A 4CICA 3FX6A 4MGRA 1GLNA 2B0LA 4MTEA 3V4GA 1AN1I 1MDMA 1KQ8A 1RTQA 5KK1A 4PJMA 3ISPA 1JXSA 4HG2A 1W1WE 3P9KA 2O7OA 3B2YA 4A32A 2OZUA 2YNEA 1JGSA 3V38A 1RR7A 2XAQA 5LHGA 4MHGA 2NAZA 4BE2A 1W0TA 3ZGKA 2XEJA 3OOPA 3ZQHA 4EM0B 4CYDA 4IO9F 3CUQC 3OYEA 3DTIA 3WC7A 5EEAA 4XKVA 1ZARA 2YS9A 1XCBA 4QC6A 4Q4ZF 2ZMEA 4B1RA 4OIQF 4DJAA 1OR7C 4CCKA 4HAMA 1HSJA 3H8GA 1FSHA 3FXQA 3TT2A 3B3WA 3SDGA 1T33A 2CQ7A 2XKPA 3K1NA 1MBKA 2IGMA 4PDKA 3WTTC 3JRHA 2QSGX 3X2QH 1M4DA 5LYIA 3CCLI 3HSEA 3CC4I 2PJ5A 1WVRA 4CAFA 2OH1A 4NGMA 3HOSA 4DZPA 1CGII 4JZ0A 3SI2A 2QJ8A 1D1AA 1FYLA 3S6HA 3QU3A 2FE3A 4K30A 4BKXA 4MRIA 1WI9A 3FNCA 5GAHJ 2PR1A 2L2OA 5CVIA 5IT9Z 1QZEA 4CGPA 3JRUA 1ARLA 4AVPA 3PDNA 4ZX8A 4OAEA 3SZPA 4LX9A 4QPOA 2HXOA 4U0VA 1LVKA 2HKOA 4FISA 5GCNA 3ABKH 3CCUI 5IT9K 2PRBA 1I39A 3TP0A 1U8BA 1BMOA 2E19A 3CPAA 2ARPF 3I1UA 1WJAA 4KSFA 1OPCA 2E71A 3I71A 4UV8A 1V4RA 5C44J 2X3TA 3ZR8X 3K10A 3LOCA 3DEWA 1TT5B 3FEEA 3MKWB 3BR6A 3BG3A 1JKRC 2Q4YA 3PFOA 2E5ZA 1P92A 1CBXA 5M5XJ 4CO8A 3OYIA 1IDZA 2KMQA 4Y33A 1ZK8A 2HC9A 4P5OA 1IY6A 3R5BA 3C26A 3GTLJ 2R7XA 2KMOA 1DP3A 3HOYJ 2Z5UA 2QLZA 2VC0A 4HPSA 1KYZA 1E17A 1KUYA 2VT2A 1T39A 3G3ZA 1IAWA 1P9GA 2GLJA 3HKZA 4KN7X 5GAGJ 3D8PA 4XLNF 1HXDA 2DAOA 1IN4A 2PJ4A 2IGKA 4NF1A 2QKMB 2FMYA 1K7VA 2QEXI 2Q2EB 2C6PA 1IGNA 4KUAA 4MFQA 2K27A 1QVUA 1T56A 4R7MA 5HMNA 1ZREA 1FYKA 4YG2F 4OP4A 4ZDPA 3L2CA 4G6DA 1UMQA 2MD0A 2O03A 1HW2A 4CGNA 1A04A 3IC7A 1B72A 1W3SA 2JXDA 5TJJA 4NCZA 4KT6A 4LG0B 2Z16A 1ETWA 3D7HA 4X8IA 3NH8A 4KDPA 1ZRFA 3LSPA 2QQAA 4B47A 1R5GA 5HLHA 2HI3A 3KP7A 3VYTB 1GHEA 3N5FA 2LR8A 2JPCA 2GA1A 2V8GA 1WJEA 1IRZA 1M4IA 2ZSIB 1KBEA 2O4HA 2EBJA 4BUPA 4YU9A 3WTXC 1IRFA 2JZYA 1Y0YA 1KA8A 1P4AA 3ERMA 4TV7A 2W82A 1QRYA 2FBKA 1ACIA 3GYAA 2I00A 1QSMA 4II3A 5D5UB 1N75A 1F4KA 1Y9KA 2CO5A 2M30A 3SFZA 2Q1ZB 3JAMK 5HS7A 3KZZA 1HDDC 1YTPA 4KLVA 4KOXA 4CUGA 2F5CA 3TL4X 3HOVJ 3B3CA 2R8VA 2BYVE 2ZC2A 3AKZA 1XN7A 2ENZA 2REFA 3IWZA 1FMWA 2KCXA 1W5TA 5HDGA 5CVVA 2K9HA 3BJ8A 1QHGA 2FQ4A 5DTDA 2P5LC 2X6OA 4B6DA 3BWGA 2GLFA 1UHSA 4JQFA 2W7NA 3KQXA 4DJLA 3DCFA 3SI0A 2JT1A 2R7FA 4P55A 3M07A 4A30A 2LKSA 3V7ZA 3PO3J 1QO0D 2FA5A 1TLHB 1D0XA 2X6YA 1NTCA 3KEYA 4NUBA 4ZTJA 2YPRA 3W2WA 3C3WA 3S1QJ 3G1MA 2XGDA 1ZTRA 2VEZA 1N78A 4BBSJ 2POKA 1TTYA 4U0YA 1U9OA 1ZR2A 1HW5A 3U2RA 3K70C 1Z2IA 3RKWA 2CV2A 4MHPA 3S9LA 2HOEA 4P1WA 4Y15A 5LRKA 2HVQA 2V6CA 2EQRA 3F0CA 4UY8I 1MGTA 3RZDJ 3RNZA 1H8LA 1T08B 2F4OB 1SC7A 5JI6A 2Z99A 2LF7A 4Z65A 1ETKA 5IP7J 3W2AA 4CYCA 4JD6A 3KZWA 5JGFA 4CYOA 1XGOA 7CPAA 1BC7C 2VKHA 1CE3A 5H6RA 3TW6A 2NNNA 3QU6A 4A3DJ 2KZVA 2KIUA 2H5MA 2X1EA 4RB3C 4G7HF 3GOXA 2R7SA 2LDUA 2VQCA 3T1BA 1APLC 4BDZA 2XEGA 3WG9A 1CX8A 3PEIA 1ZGJA 4F93B 1W5SA 3BPXA 4LJZF 3E6CC 2C6CA 4UIBA 3RZAA 2SGDI 2BY3A 2KKOA 4QB9A 4RLQA 1DGWY 2IPQX 2QQ8A 2DO7A 1I1SA 5CCLA 1MJBA 1NXUA 4OC5A 4KOTA 2QZ8A 3BZ6A 2FOWA 2LFBA 2CQXA 4F3QA 2W00A 1OCOH 4HSRA 2OCCH 2ZKZA 4RS2A 3KEQA 5GTHC 4M73A 2H1LA 4RGSA 4BBRJ 2E5RA 4OIPF 1VQ9I 2IP2A 2PJ0A 4BAYA 3RYPA 2R5ZA 5DEQA 5CCMA 4YRHA 3A4CA 5IYDJ 5G22A 1X4SA 5EYRA 1QNTA 1ZKGA 1ETVA 2ZMEC 2DF5A 4BD9A 3OYDA 3SEZA 2XUBA 3BHXA 4FHTA 1BOBA 4KA4A 1B8IA 1EJ9A 4NDLA 4UXNA 2EH3A 3QYEA 1XSDA 2Z11A 3VWDA 4OAYA 1RC9A 3HXLA 4DGWB 2CQNA 4UUVA 1X2MA 3H8EA 4OMYA 3CCYA 1Y8FA 2CWGA 2N52A 2LY1A 3QTLD 5LYDA 2W48A 4EJTA 3DEEA 3IH3A 1Z9CA 3HRSA 2X52A 1S9HA 3GFJA 4CCMA 3PFEA 2Y0SA 4YIIA 1IN8A 2BGCA 1U9NA 3C18A 3DBLB 3LSKA 1YLEA 3BG9A 2DXQA 1S7OA 2QQ0A 1NE9A 1UAAA 1CT0I 4F52A 3DLLF 3A2KA 3E7LA 2LRDA 5E79C 3D5LA 2B4DA 2GAUA 3K4KA 3CESA 4U7DA 4ORFA 3DR8A 2O3FA 1PDNC 1MMDA 4I2OA 3RI4A 2JEVA 2ZOFA 2HQAA 4XLEA 1ONVA 1SMTA 2BE5F 1FIAA 1BR1A 1CPSA 1Q2CA 2NS8A 3K4LA 2I8DA 1RIOH 2E2JJ 3JRCA 3ZMDA 4M6XA 1LFUP 1YW4A 4IVNA 4Y13A 1SEUA 2D4OA 3EO4A 4HOBA 5FRMA 2P5KA 4FAIA 3PZJA 3EQLF 2JA5J 1BM9A 1KGSA 1O7FA 2MABA 1JTXA 5J40A 3WE2A 3HOXJ 2IVMA 3SYTA 2WB1N 3IGRA 3KKWA 5CVUA 1E0EA 2NVYJ 5L3BA 5HS8A 1O3TA 4C2TA 3RTRA 5D4RA 4OIRF 1YGHA 4MCSA 4XNFA 4NC8A 4CAWA 2XF7A 4MI4A 1UWYA 2K3FA 1MJ9A 4HEA2 2HU9A 3FBNB 3E6BA 3KLNA 5GADJ 5LRSA 4LQGA 4FD7A 1MH3A 3D4UA 2FX0A 4LG3A 2ACJA 2PJ8A 2LTPA 5DD4A 1QHHD 3OR1C 4EMSA 1VFCA 4C3HJ 2W24A 2L7MP 4D5FA 2XGCA 4AD9A 3GLXA 1U8RA 4HPQA 3JSPA 2DT6A 4A3BJ 1TIHA 1CP7A 2J8MA 5J1QA 1RNLA 2DBBA 2FOKA 2GA2A 4Y4RA 5IY5H 1HCRA 5IP6A 3GTJJ 1MT1A 4FKDA 2HQNA 5HI7A 2VC1A 3W2VA 1X10A 2E1NA 4P4EA 4P45A 4MHYA 4MFKA 3M7GA 5B5EC 1R71A 3RU0A 5BOXA 1Y8QB 2K40A 3KY9A 4QSHA 5F48A 3BQYA 5D8LB 1QGPA 3I4NJ 2DW4A 3E5QA 4XN0A 3SEQA 1YSJA 1ZYRF 4UFVA 2VL8A 5B1AH 5F64A 2BEIA 4A0ZA 3NAUA 5FJ8J 4HNYB 1QSTA 2LKPA 2WB1A 2MW8A 3PQKA 1SQHA 4W9YA 4M3BA 3UGIA 2AFWA 2JMWA 1FTTA 1I5ZA
chains in the Genus database with same CATH topology
1RI7A 4H6ZA 3S2WA 4I02A 5ICCA 3GW2A 2EV0A 2FIWA 5AG6A 2HGCA 3I59B 1OKRA 1B87A 5BQTA 1IYKA 2H94A 3HSFA 2HKXA 1IZ1A 5ERIA 2DPUA 2QMLA 2EVNA 1ZG5A 5HDKA 3DPLC 1YVKA 4IXAA 1X3UA 3LAJA 1GHCA 5KTDA 1EH8A 1OZPA 3LQRA 5AIPA 1H0MA 3ROUA 2HDCA 2FNAA 2FMLA 1W7PA 2PG4A 1E2XA 2M8EA 5H6QA 3I54A 4M72A 4L8AA 1Y7RA 1TW2A 3WU1B 1S7AA 4N9HA 4BHBA 2L3DA 5IV0A 4PSXA 4CYPA 3DNSA 1CM0A 4IRGA 3FXUA 2B58A 4M9ZA 1ZLJA 1T38A 4XRFA 5JHUA 4AVAA 3ZMVA 3D2MA 3CXSA 3GX4X 4H6UA 2IT0A 2FBIA 3MFKA 3WTSC 3FHZA 3P7NA 2DPSA 1XSVA 3DQVC 5JFRA 1ZG1A 2DT5A 2L02A 1T2KA 2WPXA 2F2EA 2RGVA 2NNYA 3UY5A 4G7OF 1D8JA 3CXPA 4R8HA 3I3GA 2HS5A 4HA8A 2KJBA 1XGSA 2B5GA 1GXPA 2YX4A 5E1WA 4CYNA 5D5XB 4HLXA 3R6SA 4OU0A 3CLOA 1OMIA 2XKOA 1ZAOA 5A2QZ 3EYIA 3O3KA 4UCNA 4MEYF 5D5WB 5A2QK 1UFHA 1EH6A 3QP5A 1BIBA 2W85A 3WTVC 2VBWA 3R95A 3W6JB 2ESHA 4AIKA 4ESBA 5D5VB 2FL4A 4E70A 2VBQA 3HSRA 3IWFA 5FO5A 2E7XA 2LSOA 2G9WA 3JSOA 3COAC 1S7KA 2NS0A 3IU1A 5C82A 3KETA 5JVTA 3CO7C 2MH2A 1MKMA 4OOIA 3F8MA 2C27A 3SXYA 2Z3LA 2V9VA 4I49A 4PK2A 3PQJA 3ECOA 5K5OA 4KZTA 1KQ9A 4LLGF 3G73A 4OIOF 1J59A 1ZHFA 4HW0A 4B09A 3QRFF 1IF1A 5LLQA 3B02A 1G3TA 3V7CA 4ESJA 1FSEA 3BY6A 1FNNA 1FPQA 4D0PA 3TQNA 4F0XA 1ZLKA 3ZN0A 4IJAA 2PI0A 2BL1A 1FX7A 4JXRA 4OLLA 2R7DA 4Y49B 4LLLA 1UHWA 4MFLA 1YVOA 3FXTA 3W6XA 2YR2A 1PUEE 2NMTA 1WRJA 2HFHA 1H9TA 3DXJF 3GVAA 4UHTA 3DKWA 4KIFA 2EFWA 5ILSA 3KLOA 3R0JA 1UCRA 1QPMA 3CO6C 5KVRA 1UB9A 2FSWA 1U5TB 3G8WA 1SFUA 3I9SA 3TO6A 5D6FA 2EK5A 5AG5A 3TTHA 3J7AO 2PR8A 2Q4VA