2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
5HDGA 3HRSA 1H9GA 1IN5A 2Q7BA 1GXPA 3N97A 1SFEA 2A4NA 2RC4A 3FF5A 4OIRF 2VBXA 1RZ4A 1ZN2A 1SD6A 5LLQA 4R3KA 4XSZF 4HW0A 4FT8A 4CRZB 1FP1D 3GF2A 2WPXA 1KU9A 4I49A 2LF8A 3EXNA 4M6YA 1ZH5A 2G0BA 3TCVA 5D6EA 4B5PA 1FC3A 4EVIA 1BC8C 1B87A 3BWGA 3GY9A 4Y13A 3I3GA 1G3SA 1DDNA 4MEXF 4MEYF 1K7AA 3EY5A 3RDIA 4DQ2A 1CF7B 2VI7A 3ABUA 3KP2A 2IP2A 3BROA 3LSTA 3H4QA 1IYLA 4BXUA 1IICA 5KTAA 2IJLA 1S29A 4ZYGA 4K30A 2QBYB 4UBRA 4GO1A 4P9UA 1JE8A 3ROUA 4G6DA 1U2WA 4HF1A 3MQ0A 2ISYA 2B0LA 5K5QA 5F6FA 4JXQA 2M5WA 4YIIA 5BOXA 4UNOA 2BEOA 2YU3A 4K2EA 3K1MA 4YG2F 4IHTA 5CVVA 3S6KA 2P5VA 1FPQA 4KT5C 3MZHA 4HQMA 1XCBA 1J2XA 2J8RA 1M44A 4ESBA 1EV7A 2DK5A 2PQ8A 4BHPA 3PP9A 5LHIA 3R4KA 1Z1DA 4KN4X 4PSXA 2K27A 3GVAA 3RYRA 2XAQA 3W6KB 1J75A 2O28A 2CNMA 1GHEA 5E18F 3L2CA 1QSTA 4PDKA 5DUIA 2JPCA 1XGMA 1R58A 3RYPA 4WXHA 4R79A 2ATRA 2EFWA 1OMIA 2J5OA 2LKPA 4U88A 4MQ9F 1QZYA 1O3TA 2KIFA 2QUFA 2HOEA 5C88A 2JRTA 3PQKA 1QSMA 1HQCA 5L3BA 1MKMA 1KU3A 3L09A 2B4DB 1IZ1A 5DCMA 4KFCA 3DF8A 1BM9A 2WC2A 1M4GA 1AOYA 2VBYA 4U7BA 2HDCA 2OB0A 2DW4A 3L7WA 3NQOA 4Q48A 2VT2A 4JQFA 2HQRA 3O2PE 2XAFA 3F21A 3DDDA 5DWNA 4L9JA 1BI1A 4KLVA 2EFPA 1TNTA 1FNNA 1V3FA 4Y17A 2OQGA 3I71A 4UXNA 2IT0A 1IN6A 1YVOA 5BPDA 4M9XA 4ZH4F 4EGYA 1D8KA 2Q04A 3T8TA 2HYFA 1P4NA 1FBUA 1IXSB 4O5VA 4MY3A 4P96A 3KP3A 4H89A 4I09A 3CTAA 4CAVA 4S05A 4I0AA 3G73A 3SQNA 1BIAA 2B5GB 3C26A 1TTYA 2Q4YA 1HW5A 2Q2EA 3Q9SA 1SD7A 3DPTA 4RGSA 1Z7UA 3EUHA 4RGUA 2LF7A 3GFIA 4EJVA 2V79A 2HKXA 2O8XA 4EM2A 2QLZA 2CG4A 2P6GA 4XPKA 4TV7A 3R9EA 3IRRA 3VWEA 4M71A 4KOVA 4JJXA 4IXAA 3GLXA 3KLNA 3B73A 2NAZA 5LRRA 4MI4A 2ARHA 2COMA 1P0HA 3TTHA 5CVRA 4G7OF 3C18A 2PRBA 3WR7A 2FBHA 3B02A 1XGOA 4OOIA 3W91A 1U6GA 4L18B 5ICFA 2B3VA 4KIBA 4N9IA 1T38A 3TE4A 1SFXA 1P4XA 1J7KA 3D8PA 5H6RA 1QGPA 2C27A 2HR3A 2FIWA 4LK0F 4KOWA 1MDMB 1YYVA 1YGHA 4CO8A 1IRFA 2QIRA 2HYGD 1SD4A 4YGOA 2QMLA 2LNBA 4A12A 4OLLA 2R7FA 4U0YA 3JAMK 4PK3A 3U1DA 1YK3A 2OQRA 4FHTA 3DEUA 2DFIA 4HOBA 5IT9K 4LUAA 4OMZA 1CF7A 4ZYHA 3MCZA 2DK8A 4L5IA 1YG2A 4KZTA 1Z4RA 5LRSA 3QP5A 2P6EA 4WXDA 3DXJF 4JBAA 2VOOA 3B8GA 1Y9WA 5IT9Z 3FBUA 1XMAA 3D0SA 2QBYA 3ELKA 3W6JB 1FOKA 1RNLA 3BY6A 1UHMA 3GO5A 3IC7A 3F22A 3BJAA 2XGXA 5HH1A 1O7FA 1QZZA 1W7PD 3LQQA 5ICGA 4GS4A 3I58A 2W25A 5LEJA 2H27A 1U3EM 4BNCA 5CLSA 2FE7A 2A07F 1J5YA 4L0YB 4I98B 2PLYA 4I2OA 4LX9A 1NHAA 4R8HA 3GYAA 5DV5A 4X5KA 5ISVA 2OU2A 3K9TA 4XSXF 2GZWA 3I59B 2BBYA 2PI0A 2WV0A 1YREA 4EV0A 3U2RA 4IRGA 2VBWA 1TQMA 3O3KA 3QAHA 3SXYA 4PCQA 2RV8A 2FOKA 4JXRA 1OYYA 1I5ZA 2F2EA 1T39A 3WTUC 2Z99A 4IVNA 4OAEA 3HHHA 3KP6A 3I4PA 2B4DA 5EEGA 4E2AA 4HX8A 2RKHA 1FWZA 3QU3A 2VC1A 3FWEA 5FFZA 4CAWA 2ZXJA 2P5KA 3K1PA 3HUGA 4AG7A 1SMTA 3ZP5A 2L4AA 3F6VA 2FIAA 3LA2A 3WTTC 2A6HF 2FF4A 1S6LA 3T1BA 1IXRC 1S7NA 1ONVA 3IHUA 3TKYA 4WK8F 4KOSA 2QQ9A 1BO4A 3V4GA 3DR8A 2KJBA 2QECA 5DYMA 1XDUA 2CY2A 4LLNA 1P6RA 5HLIA 2FBKA 3DKWA 3WGIA 1ULYA 4F0YA 2K02A 5LHGA 3F8NA 2BL1A 3PZJA 4YFJA 3DFGA 3E6BA 3ZMUA 5EBVA 4RB3C 1BI0A 4P55A 2ZNZA 3WU1B 1DP7P 2B5GA 1Y0UA 3K69A 1M4DA 2BEIA 3ECHA 5FLXK 1KYWA 3V8KA 1O3SA 4NEXA 3ZJ0A 4FD6A 2NNNA 3HRMA 4CYDA 2HZTA 4ZYDA 3H3ZA 2RDPA 1LDJA 1XD7A 3P2HA 3U9GA 3QB8A 1NSLA 3V8LA 1USTA 4M3SA 1RUNA 2VT3A 2NNYA 1I1DA 5AONA 5DCMB 2EK5A 4ZBGA 3DSBA 1GHCA 1KQ9A 3FM3A 2A61A 3TDZC 1I1GA 3VFZA 4CXFA 3FXRA 2RN7A 2BV6A 2EV0A 3F8KA 3MEXA 4PGHA 5HLGA 1HKTA 1YX0A 2CNSA 2VE9A 5HS8A 2XVCA 2HS5A 1RUOA 4XPLA 3KP7A 1ZG3A 2F5FA 2A69F 3NEUA 5JFRA 2O0YA 1TBXA 2R7DA 2JT1A 3KP4A 1LEAA 3VOEA 4HV5A 2Z10A 3HTUA 3IKVA 3S6HA 4EJWA 4HX4A 4KNYA 3WTWC 2VZZA 3FIXA 2FEZA 2BUEA 5C82A 2PC1A 1OKRA 1MDMA 3SXOA 1EH8A 2FCKA 2A68F 1MGTA 4O3MA 3FMSA 2JLMA 2L01A 3LODA 3K9UA 3T9YA 4KMUX 2CGPA 6PAXA 3T8RA 5L3CA 2Z9OA 4KLWA 5KK1A 2FBIA 3M8EA 3GX4X 1UHWA 5DWMA 1FBQA 3N7ZA 5E8GA 5AIQA 1W7PB 2GE3A 3IWZA 1VKCA 2Y0MA 1PP7U 2FU4A 4BYYA 1G6NA 3HRTA 4LJZF 1SQHA 2QENA 1IN8A 3L00A 4HDUA 5L3GA 4GYGA 2W57A 2FMLA 1ZRCA 3ABTA 4H6ZA 2J5PA 2ZCWA 3E6MA 5HDKA 3OWCA 5D6FA 2M30A 2Y48A 2ZJ2A 2PFBA 1FP2A 4UWIA 2EWNA 2A5YB 5L3DA 3J80K 4PK2A 5JHUA 3EYYA 3DNSA 1XSXA 5J8CA 2P0WA 2STWA 3HOTA 3Q5FA 3E6DA 3I59A 2J8MA 1QSNA 2FXAA 1JXSA 1R00A 2QWWA 2EFQA 2E7WA 1C0WA 1B4AA 3JUWA 5D4SA 2ZW5A 3H92A 4HBLA 5F46A 2FS5A 4I7HA 3WG9A 1BI3A 2ISZA 2OZUA 2O6GE 2PN6A 2AE6A 1XF8A 3HOSA 5ILSA 1LDKB 2ACJA 2L54A 2IW5A 3EETA 3FXUA 4S04A 1IN4A 5E17F 5LGNA 1Z6RA 2QVOA 1OYIA 3HSFA 2DPUA 2IA0A 1LRZA 1I6XA 4I01A 1IF1A 1ZRDA 3BDDA 3TOAA 4N0BA 3ZMVA 1R23A 3HSRA 2HUZA 3E5QA 1H9TA 1O7LA 3HTSB 1IYKA 3LQRA 3R61A 4Y49B 2VEZA 3HRUA 1T0FA 3J81K 3I5UA 2GXBA 2LDUA 4H0EA 4R57A 2DU9A 2DAOA 4XRFA 1F9NA 3AAFA 1FBSA 4HLXA 4AVCA 1FYKA 1R5HA 4NQWA 5A2QK 4E0AA 3KP5A 1YLEA 4KIGA 2XKOA 4LLLA 4AWXB 1BOAA 4YFXF 2DTRA 4JLYA 1S7AA 4QUSA 4R3LA 4IJAA 4U9YA 2ZXVA 3C7JA 5K5OA 2JSCA 2UXNA 1ZG5A 4FD4A 2PG4A 1KU7A 2G7UA 2NS0A 3BJOA 1DPRA 4R87A 1B9NA 1LDDA 2UWMA 3I64A 2L02A 4N9HA 2MH9A 3E6CC 3GW2A 1XMKA 2MBFA 3C3WA 3GXOA 2IRFG 2XAGA 5H6QA 3IKTA 3QPHA 2V6CA 3V7RA 2X4HA 3M8FA 3GUDA 2V1DA 5HS9A 2D1VA 1K4JA 2GA1A 2D45A 4OADA 2M87A 3F8CA 2B3UA 5IX3A 4EGZA 5HVQC 3R6SA 2VQYA 3ERED 5DDGA 3GEZA 2BE5F 4KIFA 4CZZA 1P4AA 3TQNA 5IB0A 1YLFA 1HSJA 4F7ZA 2W24A 3P9KA 1WKMA 2FQ3A 4EVYA 3HSEA 1QPMA 3LFKA 1IUYA 3IRQA 1HXDA 1QNTA 2CWEA 1G3WA 3FYNA 3H3UA 3E5UA 1L0CA 2G3AA 3E97A 5IV0A 3R0JA 3G8WA 2A6EF 1Q2YA 1VTNC 5JVTA 3M1EA 1DUXC 3FXTA 2XRNA 2TDXA 1W7PA 3HHGA 3LA7A 2RNJA 3RKXA 2G9WA 4KUAA 4AIKA 1KUVA 4GYIA 2A3SA 3QRFF 5LGUA 4JK1X 1S7FA 2M45A 4XNHB 4UA3A 2ESHA 4HA8A 2EFNA 1KQ0A 3W6XA 3RIRA 3WTSC 3BPVA 3ZZIA 4LK1F 3COAC 1GXQA 2AJ6A 4U5YA 1A04A 4WXCA 5E1XA 3WTZA 4IF5A 3TOBA 2D2WA 2HKOA 4M73A 2OH1A 4B09A 2KJCA 1YTYA 1T6SA 2B4BA 4U9ZA 2VXKA 3S2WA 4Q5SF 3QU6A 5EEHA 4G6QA 2XUBA 3QP6A 2H6BA 4J3GA 3TFYA 3FB3A 2PEXA 2FE3A 1J4JA 5BPIA 1S5KA 3RPUA 1PP8F 2NMTA 2OZGA 2ZMEB 3K1NA 1XE4A 1T98A 3W6SA 1D3YA 3I53A 2P6TA 4UUVA 2JEVA 1IN7A 4CS0B 1Q2DA 5ICEA 5FGMA 3BPXA 3T0YA 5E1WA 3ECOA 3CXSA 1UCRA 1HW2A 2QYOA 3F23A 1JGSA 3SHFA 1XB4A 3JAMZ 4E70A 5BS6A 4RB2C 3ZN1A 1S3JA 1R1TA 4WF2A 3TO9A 3TO6A 5DEQA 2REFA 3EDPA 2RQPA 5FFXA 4UV9A 1SD5A 5FB2A 1LB2A 1Y7RA 4LD5A 1LNWA 2UXXA 1LJ9A 1WWZA 3WE2A 4RB1A 3IL2A 4M9ZA 1TIQA 2FA5A 3IWFA 1FZPB 1Q1HA 2IA1A 5LBQA 1FYLA 4HLYA 1YS7A 2DPDA 4RS2A 2PR8A 4CICA 2Q0OA 3RTRA 4CRYB 3G3ZA 3P7NA 1BC7C 5F47A 5H86A 2Q44A 3D2MA 4IHSA 2M8EA 2PJPA 4FD7A 2BYVE 1I1SA 4ENNA 3VB2A 2XROA 3V7CA 3SFZA 1O3QA 5FD6A 1IB1E 2K5TA 5HDNA 1J9IA 3JTGA 4PGGA 2EA2A 4M72A 4KUBA 4Q4ZF 3KCCA 2KKOA 2C6YA 4F6AA 2EJRA 3JTHA 5CVUA 4L8AA 5EC4A 3EC4A 5JI6A 2MH2A 3V7SA 3F0AA 2FXFA 4LB5A 1ZGAA 3SXNA 4XLNF 2K4JA 4O6JA 1VHSA 4UHTA 1U8RA 3FXQA 2BGCA 1SAXA 1OPCA 3BJ6A 3TO7A 3DP7A 2OD5A 1HSTA 3F6OA 1RI7A 3V8JA 2B58A 4HX7A 4HNXB 3OOPA 2Z11A 4ON0A 1UFMA 1MJBA 2O3FA 5E8IA 1FSEA 2XHKA 2QQAA 4QBJA 3ZMTA 3KE2A 1M4IA 4BHBA 3QPTA 1K6OA 1F5TA 1XDSA 3P2FA 1YW8A 4PZJA 1XGNA 1EH6A 2ZW7A 2EFOA 3CLOA 4AVPA 2K7LA 3EYIA 3CXPA 2ELHA 5D5VB 1V0CA 4ENKA 2KCWA 4EJUA 1B9MA 2JDCA 2P6SA 4BAYA 1BIBA 3E5XA 1M1DA 4LFUA 1ZYRF 1MD0A 2MLKA 2PR1A 1R57A 2YSRA 1FLIA 1Z6TA 2D1HA 5BMZA 1V4RA 4UVCA 4Y49C 4KOYA 2W84A 4MTEA 5FLXZ 3R9FA 4I02A 1S60A 1OYWA 2GQQA 1LEBA 1XN7A 4GXOA 2H09A 1F4KA 4OIQF 2NRAC 1B1BA 3WE3A 2V1XA 3F8FA 2PSWA 2FSWA 4L9TA 4M6XA 3KLOA 1KQ8A 3WODF 3IGRA 2P7VB 4XLPF 2EV6A 1K79A 4AIHA 3BOQA 2VOPA 1LQ1A 3R60A 3BLNA 1ZLJA 5JR3A 1RXTA 3PQJA 2CNTA 4KVME 1QBJA 4CGZA 1BBYA 5I0CA 1KUXA 4B5OA 4HYEA 2EA4A 5D4RA 1WWXA 1QSOA 1TQPA 2VN2A 4AIJA 3BP8A 2YPRA 4EMSA 3GFJA 2DT5A 3REOA 3K0LA 2ZMEA 1YW9A 4D0PA 1NMTA 1HW1A 3L9FA 3EFAA 4L0ZB 5ED4A 4MJ8A 4HNWB 4HQEA 1J0RA 5AIPA 5D5UB 2CFXA 2R98A 1PUEE 5ICCA 1SFUA 4OU0A 1U5TB 2DI3A 2CSOA 4LMYA 1WQ2A 1Y9KA 2REEA 1WRJA 1D8JA 2F5CA 4BQAA 5KTDA 4OIPF 2HQNA 1XEBA 4A0ZA 1MZBA 3LD2A 2I79A 1ZGJA 2H5MA 2R8VA 2XASA 4ENJA 3WTXC 1H0MA 3NE7A 3K2ZA 3LAJA 2CQKA 4XPDB 5HMNA 4EM1A 1IW7F 5E20A 1S7OA 3GFMA 1ZREA 2G3TA 4L89A 2KRFA 2DQLA 4M85A 1CJWA 3N4MA 1AWCA 2OAZA 4XNHC 1ON1A 2XKPA 5FO5A 4A0YA 3TDUC 2VONA 4A5MA 4OMYA 4G8XA 5CVJA 1OR7A 3JVNA 1Z91A 3G3SA 4L9NA 1BN5A 2MA3A 4KUMA 3TT2A 5E96A 3IWGA 3DV8A 1B6AA 3J80Z 1SMYF 5L3FA 2E1NA 4M9SA 2OZ6A 5HS7A 3ML6A 4EQQA 4NB5A 1TNSA 4KVOE 1K78B 3F8BA 4KA4A 2I00A 2ZW6A 1QQIA 1D5VA 2Z3YA 4UVAA 2FNPA 4G7ZF 2IVMA 2DBBA 4LG0B 2NYXA 4FD5A 1YFHA 2KIMA 3CUQA 2Q4VA 4LGWA 3CJNA 4Z2YA 1L3LA 2OBPA 2X7BA 3VODA 1EH7A 4ESFA 3BJ8A 5D8LB 2RVCA 2FSRA 2QZ8A 2PDOA 3KFWX 2K86A 5TRDA 2LSOA 3GZ6A 1KU2A 3HYIA 4IRHA 5HLHA 1HKSA 4UVBA 4ENMA 2WWYA 2P7CB 2IL4A 1ZHFA 2WPWA 4WCGA 3TGNA 1STZA 4AD9A 2JZYA 2O03A 1PU9A 2QQBA 2FMYA 2JPBA 5CJ9A 1XCVA 1UFHA 1TW3A 2ZKZA 2FL4A 4G7HF 3J81Z 2P8TA 2M1BA 1XSVA 3WU0A 1HKQA 4CDGA 1HBXG 1E2XA 1JHHA 3RJPA 5F64A 5A2QZ 3RKWA 2CYYA 1USSA 3F8MA 1JHFA 2BSWA 4OINF 4LLGF 1U78A 2IPQX 1IAWA 4ETSA 2PMHA 5F1RA 4ORFA 4AVBA 5GCNA 1W4MA 2AS5F 1W5TA 4HZFA 1YQAA 4QC6A 1W5SA 4ZZLA 1I12A 2KIUA 2RGVA 4IRIA 1XIXA 3CUQC 2D4OA 3KEQA 2VBZA 2ESNA 4EJTA 3LWFA 2HEOA 1YS6A 4R9MA 3ZQ7A 3T5XA 3SZTA 1TW2A 1WK4A 1LVAA 3NRVA 4HF2A 3WGGA 3WGHA 5FVJA 1MJ9A 4FX4A 2G7HA 2JDDA 3GYHX 4AVAA 4G94A 3J7AO 2Q8KA 1FYMA 1BI2A 3CO6C 2EV5A 1TLHB 5L3EA 4BH9A 1ODDA 3ZPLA 4YRHA 1YR0A 2Z33A 3CDHA 1MJAA 3P9IA 4A2UA 2L4MA 1WI9A 1U5TA 4MHGA 4P5OA 2HFHA 1R1UA 3JW4A 5DD8A 5H84A 5D5XB 1Z05A 4ZZDA 4KOTA 4KOUA 4NHJA 4UWJA 1FX7A 1XMTA 1KGSA 4GCVA 4HF0A 3D3SA 1WSUA 1REPC 3FHZA 3E3VA 1R7JA 3OV8A 1ZARA 2EUIA 4BHCA 2WTEA 3I0TA 1Z9CA 3RI4A 2H6CA 5KVRA 1XSDA 1B59A 2ZO4A 3RPQA 3ZMDA 2Z0ZA 3MGDA 5DUKA 4A6DA 3LA3A 2P6FA 1KZFA 4ONUA 4HDVA 2DXQA 3WTVC 4LB6B 5CYVA 3FX3A 2HTJA 5DCFA 3M9AA 3RYOA 1K78A 3KZZA 1U6MA 4MTDA 3PGPA 2GXGA 4QB9A 1YO5C 1F1ZA 3GKRA 3R9GA 3CO7C 4RAZA 2FNAA 1P92A 4Y15A 2F5EA 5CVIA 3ULQB 1S3ZA 1L0OC 3R95A 1R1VA 1I21A 3I54A 2E1CA 3BZ6A 5D5WB 4LG0A 1T2KA 4IF4A 1KYZA 3GFLA 4JWPA 4HNYB 5LHHA 3MFKA 2R1IA 1CGPA 5LGTA 2HQYA 3S6GA 3FMRA 1RIOH 4ASNA 1B6BA 1MK4A 3RKYA 3R96A 5ILVA 5FD5A 5TJJA 4L5JA 4YFKF 2P4WA 1PUAA 4A6EA 4ZYEA 4II9A 3LAPA 5E1ZB 5K1YA 1YVKA 4BMHA 4NCZA 1TQIA 1U5TC 1ZRFA 3JSOA 1ZLKA 4B8XA 1Z9UA 2Q0YA 1XGSA 4WX9A 4FX0A 2K4BA 3D5LA 1IXCA 1CM0A 4KICA 2CW0F 4PV6A 4HAMA 4EJOA 5H20A 4XPDC 4XBFA 3C1DA 3R0AA 1N71A 1OZPA 1YW7A 3FZVA 1QSRA 2FRHA 2PMUA 2MC3A 3UY5A 2ZBKA 5LEKA 1KUYA 5J8FA 1Q2CA 2DO7A 2CO5A 3E0KA 4MBUA 4RB0A 5DD4A 4B5PB 5F49A 2L3DA 2GA2A 1Z4EA 3CUQB 3SZPA 4RGXA 2XV4S 4CHUA 1G4DA 5K5RA 3ZN0A 3F3XA 1BOBA 2J8NA 2ZFWA 3CXQA 2ETHA 2D4PA 4CAXA 2DQRA 1NE9A 4DNCA 2HWVA 1BJAA 4MHDA 3KZYA 3Q9VA 1O3RA 3R1KA 4KVXA 3FM5A 4ESJA 3M7GA 3KKWA 2PBIA 4RI1A 4KMFA 2F5DA 3PFIA 4IPAA 1ON2A 3KEOA 2MLGA 2MD5A 4R1HA 3MZYA 3F5BA 4M74A 4E8OA 4OIOF 5D8KB 2DLLA 1J59A 4MNUA 3T90A 2YX7A 4I0BA 2YR2A 4RS8A 4A5NA 1PDNC 2FT0A 4KYWA 4IUSA 1YIOA 1G3YA 2ZNYA 5ILUA 1DPUA 1ON0A 2VC0A 2HV2A 3BJ7A 1RO5A 2XAJA 4U7DA 4KN7X 1IIDA 4NXYA 3DR6A 4Q47A 2ZPAA 1X3UA 2UZKA 2EVNA 2VE8A 4P9FA 5J6XA 4RGRA 3DQVC 3MWMA 4QWQA 2OZHA 5IT3A 4KDPA 4UV8A 3DPLC 5JQ4A 1I27A 2H94A 1ZG1A 4GGGA 5ERIA 3GZ5A 3FRMA 3S6FA 2P5LC 4YIFA 4U0WA 1R22A 3JSPA 2YX4A 4MQVA 3VEPA 1FSHA 4U0VA 4KORA 2VBQA 1ZAOA 2VODA 2EB7A 1P2FA 4MY0A 1E17A 5F48A 2Z5UA 2R7HA 3CUOA 1KA8A 1P4WA 1S7KA 2STTA 4YFNF 1GVJA 2IA2A 2XAHA 4HV6A 3EO4A 2GAUA 4G9YA 2HTSA 1FY7A 1UB9A 3D2PA 5JPHA 3MAJA 2O61A 2XIGA 3KETA 1QO0D 2V1UA 3F72A 2F5IA 2HGCA 2VXZA 4QLCU 3P9CA 3QOPA 3EQLF 3FMQA 4JD6A 4KOXA 4AB7A 2VZYA 3VWDA 4RAYA 4L9VA 4NF1A 2GWRA 5KTCA 1S7LA 4WWCA 1R5GA 3WTYC 4AG9A 3HIFA 2ZW4A 4PSWA 1FT9A 3ISPA 2W85A 5BQTA 4NSQA 2QM3A 2AXLA 2GIVA 4H6UA 1O57A 2R3SA 2V9VA 3FNCA 2ADUA 5CNPA 2OA4A 3SHPA 4MGRA 3V8IA 4EM0B 2JTVA 3ZMZA 3O6BB 2E7XA 4QVTA 5HOOA 3I9SA 3GWZA 4A0XA 1R36A 2GANA 1IRGA 1G3TA 2X0LA 3ZMSA 2Y75A 1S8NA 4HKFA
chains in the Genus database with same CATH superfamily
2K40A 1TWAJ 2F6CA 5HDGA 3HRSA 5M3MJ 1JI8A 2DF5A 1H9GA 2AHQA 1IN5A 4P4BA 2Q7BA 4R76A 1GXPA 3N97A 4PXBA 3GMEA 3S3OA 1IY6A 1SFEA 1ZR4A 2LH9A 3RCOA 2A4NA 1XOVA 1VQOI 2XSDC 2DMPA 3IC1A 2RC4A 3FF5A 2K9MA 4ITVA 4OIRF 5FLMJ 3RU0A 3B3WA 2VBXA 1RZ4A 1ZN2A 3RZAA 4C2UA 1V54H 3VH9A 1SD6A 5LLQA 3HC7A 5HLTA 2J9RA 4XSZF 2DFEA 4P45A 1OBRA 4R3KA 2PJ4A 1N25A 4HW0A 4DJAA 4FT8A 4PFOA 4CRZB 1FP1D 4XLEA 2EINH 4IEJA 2PIZA 4BUPA 4A32A 3GF2A 5J4VA 2N71A 3UOEA 4TNUA 2PJCA 4I99C 2WPXA 2JUCA 1D5YA 1KU9A 1NG6A 3AL0B 2LEOA 4FQGA 5FKOA 1G8XA 4CYCA 4I49A 4WWVA 2LF8A 3EXNA 4MFLA 4M6YA 1ZH5A 3KGQA 2VJIA 1Z67A 3SDBA 2JQ7A 5D6EA 2G0BA 1B72B 3TCVA 1FC3A 4B5PA 4HNTA 2XGEA 4EVIA 1BC8C 1Y1BA 1B87A 1LFBA 3BWGA 3JRUA 4R8FA 1TT0A 3GY9A 1A6QA 1Y7EA 3ONQA 4Y13A 4PFPA 2E2JJ 3ASOH 3J7AY 1DP3A 3OMYA 3OYIA 3I3GA 5J1QA 1G3SA 2JUGA 1VQ5I 1DDNA 4MEXF 2PX9A 4MEYF 1K7AA 2ORWA 4CH7A 3EY5A 3RDIA 1RFHA 2JVHA 1R43A 4DQ2A 1CF7B 5DTDA 2WYRA 3IEHA 4IAVA 1M8CA 2VI7A 3ABUA 3FJUA 3KP2A 2WB1A 2IP2A 2MFZA 1NG7A 2WY8Q 3BROA 3LSTA 4D5CA 3H4QA 1IYLA 4BXUA 1IICA 5KTAA 1CGJI 2X52A 1PCAA 1RC9A 1OCRH 2IJLA 1S29A 4ZYGA 4HRIA 4K30A 2JBJA 5FUYA 2GBYA 3VYRB 3CP8A 2QBYB 2EH3A 1YRNB 2YNEA 4X8IA 2UVOA 4UBRA 4GO1A 4B6DA 2IGMA 4P9UA 2PJ7A 5FKKA 1VFCA 4KSAA 1JE8A 3ROUA 4G6DA 1U2WA 2AFMA 4HF1A 2GFQA 3MQ0A 2HOSA 2ISYA 2NVUB 2B0LA 2VJ4A 5JLWA 3H8EA 5GAEJ 5K5QA 5F6FA 4JXQA 2M5WA 4AIDA 5G20A 5JH9A 3P5JA 4YIIA 5BOXA 2BEOA 4UNOA 2R92J 3OYMA 3HEFA 2YU3A 4K2EA 4OAYA 3CMEI 4RM2A 4C2YA 2EZIA 3G1LA 3K1MA 2R5YA 3A1YA 4A3LJ 4DOZA 4YG2F 4IHTA 1IW4A 2DT6A 5CVVA 3OSGA 1X4SA 3S6KA 2P5VA 4XL9A 4NSQA 1FPQA 4KT5C 3MZHA 4HQMA 1XBTA 1XCBA 2V8DA 1J2XA 4ZTJA 2CS3A 4Q7AA 2QCOA 2J8RA 3QYEA 1M44A 4ESBA 1EV7A 3VSKA 4UFWA 2DK5A 2M9HA 2PQ8A 3K4CA 3BG7A 4BHPA 5E3MA 4BBRJ 2BY0A 3PP9A 4RN7A 5LHIA 4PPZA 3G1OA 2KHMA 3R4KA 5G21A 1Z1DA 4KN4X 2JJ7A 5JLXA 4PSXA 4TWEA 2K27A 3GVAA 3RYRA 2XAQA 3W6KB 1J75A 1WI3A 1X1BA 2E2IJ 3HB9A 1F2OA 2O28A 2CNMA 1GHEA 5E18F 3L2CA 1RPWA 1QSTA 4PDKA 5DUIA 2OC6A 2JPCA 3DTKA 1XGMA 1R58A 3RYPA 4WXHA 4R79A 1DS3I 3LSMA 3A0HC 2YS9A 4PJNA 2EFWA 2ATRA 2Z3KA 1OMIA 4ZTFA 2J5OA 2LKPA 4U88A 3LL7A 4MQ9F 1QZYA 1O3TA 2YU9J 3S1QJ 2KIFA 2QUFA 2HOEA 5C88A 2JRTA 2TRTA 3PQKA 3QTLD 2PVVA 1QSMA 1HQCA 5L3BA 3OYEA 1MKMA 1KU3A 2E35A 5DS9A 3UKGA 3L09A 3WC6A 2B4DB 5GADJ 1IZ1A 5DCMA 4KFCA 3DF8A 1BM9A 2WC2A 1M4GA 3TC8A 2DPSA 1Y56A 4M6GA 1AOYA 2VBYA 4UCMA 1TKHA 4U7BA 1XBUA 2HDCA 1Y1CA 3MMYB 3M07A 2OB0A 2V4JC 4O23A 2DW4A 3L7WA 3NQOA 3HUGB 2VT2A 4Q48A 4JQFA 1FOWA 2HQRA 2N8GA 3O2PE 3VE5A 2XAFA 2PJAA 3F21A 2M7BA 1QU3A 1E3HA 1UMQA 3DDDA 5DWNA 3A03A 4QSHA 2CW8A 4L9JA 1D0YA 1TBRR 2QQEA 1BI1A 4KLVA 2EFPA 3RSNA 3GCMA 1TNTA 1FNNA 4A2ZA 2K5CA 3LSIA 4AUXA 1WJFA 1IUFA 1V3FA 2OQGA 4Y17A 3D1NI 3CCUI 3PO2J 1FEXA 1U5KA 1A2ZA 1HA8A 1V5GA 4QPOA 1SAUA 1OCCH 2M8GX 3I71A 3VWBA 4N4NB 4UXNA 2IT0A 1IN6A 1MSFC 2V7FA 4XR6A 1YVOA 4MHZA 1NSLA 1ETOA 3K70D 5BPDA 1UVFA 4M9XA 2OTJI 3VYSB 1TC3C 1RR7A 2M7AA 2XEIA 1AYEA 4ZH4F 4EGYA 1D8KA 1ULKA 2Q04A 3T8TA 2HYFA 1P4NA 1FBUA 1IXSB 5G22A 3SYTA 4O5VA 3FECA 2Z1DA 4MY3A 4P96A 3KP3A 4RAGA 4H89A 4I09A 3CTAA 4CAVA 4S05A 3H0DA 4BQQA 2W0TA 3A02A 4I0AA 2ELIA 4CCMA 3DEWA 3G73A 3SQNA 1BIAA 2B5GB 3GUXA 3C26A 5GP9A 1TTYA 4J01A 1NUBA 1HDPA 1YE9A 2Q4YA 1HW5A 2NS8A 4DYQA 4EEFG 2Q2EA 4NGMA 4A94A 3Q9SA 1WFXA 1SD7A 2KT0A 2V1NA 4IKFA 3DPTA 4MPIA 4RGSA 1Z7UA 2VJJA 3EUHA 1TOTA 4CGMA 1SANA 2K3PA 2LFBA 3A01B 3LWUA 3L2WA 4MFKA 4RGUA 3IV5A 4CYPA 1KBEA 2LF7A 3PB7X 3GFIA 3RZDJ 4EJVA 1PCEA 4IK2A 4Q36A 2V79A 2KMRA 2HKXA 2O8XA 1MIJA 4YELA 5F04A 4EM2A 2QLZA 4UCPA 2CG4A 2P6GA 2TCTA 2C6GA 4XPKA 4TV7A 3R9EA 3DKXA 2ZOGA 3IRRA 3VWEA 4M71A 4P1WA 2NVXJ 3D5SC 4RBOA 1AHDP 4A3FJ 4KOVA 4JJXA 2XGDA 1XRYA 4IXAA 3GLXA 3KLNA 4XLCA 3B73A 2NAZA 4LG3A 5TISC 5FRNA 2Y9ZA 2CUEA 2KRCA 5LRRA 1MNMC 1YITI 2BCOA 2QVPA 1ZKGA 1SFKA 4MI4A 2ARHA 8CPAA 5LYIA 1MMDA 4CZCA 2COMA 1P0HA 1VQKI 3TTHA 5CVRA 3OYJA 4G7OF 4E7LA 3C18A 2PRBA 1LPQA 3WR7A 2FBHA 3B02A 1XGOA 4BBSJ 4A31A 2DMNA 3BTCA 1CE3A 2LY1A 3HLPA 1X74A 3DBRB 3Q0VA 4OOIA 5IPAA 2VQGA 1O4XA 1U6GA 3SGQI 3W91A 2MW8A 4L18B 4E1RA 5ICFA 3TX8A 5CCLA 2B3VA 4KIBA 4N9IA 1T38A 2WGCA 4G12A 3TE4A 1SFXA 1P4XA 1J7KA 4AYBA 2NOJB 3GBGA 1GDTA 1UELB 3D8PA 3PB9X 3JRFA 1SFOJ 4B11A 4PQAA 5H6RA 2Y0SN 3WHCA 1ELMP 1G59A 1QGPA 3HKZA 2C27A 3K2AA 2HR3A 1XX5A 2AO9A 4LK0F 2FIWA 1S5LC 2CQ7A 1AN1I 4KOWA 4P4FA 1MDMB 1YYVA 3H5AA 3O8HA 4BJTA 1B72A 4KISA 3S16J 1X10A 1YGHA 4CO8A 3MEKA 5FRMA 1IGBA 1IRFA 1ULMA 5F1JA 2QIRA 2IXSA 4NC6A 1LAPA 2HYGD 1SD4A 4YGOA 4UFXA 4U87A 2QMLA 2LNBA 4HG2A 4A12A 4OLLA 2R7FA 4U0YA 3UGDA 3JAMK 3MD2A 4PK3A 1FT7A 4M3EA 1E3PA 3U1DA 3MZ8A 3K7AJ 2OQRA 2LVSA 4FHTA 4QIWN 3DEUA 1YK3A 2DFIA 4P10A 3OXLA 4GDFA 2R7XA 3M8JA 1DE4C 4HOBA 3ISZA 3IU1A 2HU9A 2KRHA 5IT9K 3ZQCA 4LUAA 4E7JA 4OMZA 4ONWA 1CF7A 3R9GA 3R5AA 4ZYHA 2GM4A 3MCZA 2DK8A 5CQGA 5M3FJ 3W6VA 1AKHB 4L5IA 3OYAA 1YG2A 3ZQLA 3C2BA 2PE3A 4KZTA 1Z4RA 5LRSA 1W0TA 3PRTA 3I3LA 4A30A 2LBFB 3GIUA 4E7SA 3G4SI 1PUFA 1OVOA 5EG0B 3QP5A 2P6EA 2VXDA 1ITYA 5LRJA 4WXDA 3DXJF 4JBAA 3TL4X 2VOOA 3B8GA 3OYDA 1Y9WA 1YJ9I 1Z2LA 5IT9Z 2EBJA 3FBUA 4DUKA 1XMAA 3D0SA 2QBYA 3GTKJ 2QQCA 1YRNA 3ELKA 2Z3PA 1D1CA 1PTQA 3KYCB 3GOXA 3W6JB 2QJ8A 1FOKA 1RNLA 4I6ZA 3EUHC 4HSRA 1HDLA 3BY6A 1UHMA 1YMEA 4NUBA 4EMEA 2V8VA 3GO5A 3IC7A 4IHVA 3F22A 4NGPA 3BJAA 3O8GA 2XGXA 2ZJPF 1R9TJ 2DA1A 1NK2P 5HH1A 2QQ0A 5F0HA 1O7FA 1TWCJ 4BY7J 1QZZA 1W7PD 3LQQA 3SEQA 5ICGA 3F0CA 1X2NA 2VKVA 4GS4A 4A3DJ 1BR4A 3I58A 4BINA 3CCMI 3NWTA 4RAFA 3JRGA 2W25A 5LEJA 2H27A 1U3EM 1HLVA 4BNCA 3GTMJ 1EF4A 2NU1I 3HPGA 5CLSA 2FE7A 1QPIA 2A07F 2GOMA 1J5YA 1M1EB 4L0YB 4I98B 3VDXA 1R71A 3KIOA 2PLYA 1NHAA 1W1WE 4R8HA 4I2OA 1HOMA 1CT0I 1VDDA 3GYAA 5DV5A 4X5KA 3QAYA 1FIAA 5ISVA 3MKLA 2OU2A 1IGNA 2PJ3A 1QZEA 1R4MB 2RNGA 3K9TA 4XSXF 2IEKA 2R0QC 2GZWA 3I59B 3G2BA 2BBYA 2PI0A 2WV0A 2A6TA 1YREA 4EV0A 3FX6A 3B6CA 2WAQN 1SC7A 3U2RA 2VQCA 3FMCA 3CCJI 2ELKA 4IRGA 1SEUA 2VBWA 2JA7J 1TQMA 3O3KA 3QAHA 2JW6A 2WA0A 2ZXWH 4HEA2 3SXYA 3SI2A 4PCQA 2RV8A 1K7VA 2FOKA 4JXRA 3HXLA 4B14A 1SGEI 1OYYA 2I10A 1I5ZA 2KQRA 2F2EA 4F0XA 2VJ5A 1T39A 1OFCX 3WTUC 5DM6F 5IP9J 1UG0A 2Z99A 4IVNA 4F9VA 4OAEA 3D00A 1WPKA 4PUSA 2EBIA 3HHHA 3KP6A 1PJUA 2N52A 2VQLA 5KHDA 3I4PA 3CZ6A 2B4DA 5EEGA 2ZEHA 4E2AA 4HX8A 1TKFA 2OJED 1JTXA 1WJAA 4XKWA 2RKHA 1FWZA 2WADA 2I8DA 3H5NA 2VC1A 3FWEA 3QU3A 1VQPI 3AL0C 1LOKA 2LD5A 3OXGA 4CGLA 5FFZA 4JX4A 1FJLA 4CAWA 3KY9A 3RPUD 2ZXJA 2BOAA 2P5KA 3K1PA 3HUGA 3BC8A 4UEZA 2M34A 1E3OC 3BHXA 1SMTA 4AG7A 3ZP5A 5B66C 2L4AA 2HVRA 3F6VA 3PDNA 1U0JA 2C6CA 2FIAA 3LA2A 3SFIA 3WTTC 1SGNI 2DFFA 2A6HF 2DODA 2FF4A 1S6LA 1IXRC 3T1BA 4NGSA 3OY9A 3H9GA 1ONVA 1ELLP 1S7NA 4RUHA 3IHUA 3HGYA 3TKYA 4WK8F 4ZYQA 1DU6A 4KOSA 1QVTA 3K4KA 4J00A 5LD2C 1BLLE 2QQ9A 1BO4A 3V4GA 1UG2A 2O9LA 2W4SA 3DR8A 2KJBA 1XS9A 2QECA 2CQXA 5DYMA 2R5YB 2J9AA 1XDUA 2JA2A 2CY2A 1I39A 3AFHA 1MNDA 4LLNA 1TBOA 1P6RA 4B1RA 1SGRI 3M3YJ 5HLIA 2FBKA 3DKWA 3WGIA 1ULYA 2E5ZA 3K10A 3OL3A 3HDDA 4F0YA 2K02A 5LHGA 3F8NA 5KNLA 3GTPJ 2BL1A 3PZJA 4YFJA 1TWGJ 3DFGA 3PSFA 1I3AA 4BQOA 4B13A 3E6BA 3ZMUA 5EBVA 2NXNB 2Y30A 4RB3C 1BI0A 4UY8I 4P55A 4M6HA 2ZNZA 3WU1B 1YJWI 1DP7P 2B5GA 4BDYA 3B3TA 5HODA 3CCSI 1BL0A 1Y0UA 3K69A 2QEXI 3E2IA 1M4DA 3TW6A 2BEIA 3BJIA 2WV1A 3ECHA 2VKHA 5FLXK 1KYWA 3V8KA 1O3SA 1MH3A 5C4JJ 4NEXA 2L7KA 1FNOA 3ZJ0A 4FD6A 2NNNA 2ZC2A 3HRMA 4CYDA 2WY7Q 1MMSA 3PB8X 2HZTA 1D0XA 3A01A 4ZYDA 3H3ZA 4C68A 2RDPA 1D0ZA 3FK6A 2L0KA 3MRUA 1LDJA 1XD7A 3N05A 3KZIC 1LE8B 3ZCOA 3P2HA 3U9GA 4V19K 1HC8A 4YEJA 3V8LA 1USTA 2JA6J 2CTBA 3QB8A 4M3SA 2L5QA 1JUPA 1OCPA 1RUNA 2VT3A 2NNYA 1AA7A 2A20A 5AONA 1P9ZA 5DCMB 2EK5A 4B48A 1I1DA 5C4XJ 3I9V2 1GHCA 3DSBA 4ZBGA 1KQ9A 3FM3A 3PL8A 4UEEA 3UGIA 2A61A 3KQXA 3SI1A 5GPAA 4KJZA 4BACA 3BR3A 3TDZC 1S9HA 1I1GA 3VFZA 2NYQA 2DT7B 3ZQGA 4CXFA 2OV7A 1TZLA 3FXRA 2RN7A 2BV6A 2EV0A 5EMIA 3F8KA 2R7TA 1R3NA 3MEXA 4PGHA 5HLGA 4RMNA 1HKTA 4Y7NJ 1YX0A 3NH5A 1HPTA 2CNSA 2VE9A 4R7MA 4L9MA 5HS8A 1VQ4I 3B6AA 3PNYA 2XVCA 2HS5A 1RUOA 3HGGA 4XPLA 2JEWA 3B7IA 3KP7A 3L1PA 1ZG3A 2F5FA 2A69F 1ETYA 3NEUA 5JFRA 1H89C 3IU2A 2BUSA 2O0YA 2VL8A 1TBXA 2R93J 2R7DA 2JT1A 3KP4A 2DOEA 1LEAA 3VOEA 2EPFA 2NSMA 1IG7A 2JRMA 3VARA 4HV5A 2Z10A 3HTUA 3IKVA 3S6HA 2DA7A 2YNCA 2VPRA 2WAFA 5GTHC 4CCKA 4EJWA 4HX4A 5F09A 1IOIA 4KNYA 3HOUJ 3WTWC 2VZZA 2A05A 2FEZA 1HJAI 3GTGJ 2BUEA 2PC1A 3FIXA 5C82A 1JKRC 1OKRA 2ORVA 1FMWA 1MDMA 3SXOA 5JHWC 1BR1A 1EH8A 3HZJA 1HDQA 1R6RA 3OL0A 3FC3A 2FCKA 1JTYA 4M3GA 2A68F 1MGTA 4O3MA 1X58A 3FMSA 5J4YA 2JLMA 2L01A 3LODA 3AG1H 3K9UA 1YJNI 4KMUX 2CGPA 6PAXA 4R6TA 3T8RA 5L3CA 2Z9OA 4KLWA 3T9YA 3IO1A 2OCEA 4XN0A 2R7WA 5KK1A 2FBIA 4A24A 1CPSA 3M8EA 3GX4X 3BCBA 1UHWA 5DWMA 4PJMA 1FBQA 4BE0A 5E8GA 3N7ZA 5AIQA 4C2TA 4G6TB 5BWAB 2CUJA 5A27A 1W7PB 2ZXIA 1AKHA 1H8AC 3BQZA 2KZVA 5LRKA 2GE3A 3IWZA 3CC7I 1VKCA 1N77A 2LBFA 2Y0MA 1PP7U 3OSFA 2FU4A 4BYYA 4CA0A 2CQNA 3VPRA 2R7UA 1YU6C 2HOTA 2PRQA 1G6NA 5C3EJ 3K4NA 1WCMJ 3HRTA 3LMMA 4LJZF 3I4MJ 1KONA 1SQHA 2WAEA 3SJEA 2QENA 3D7FA 1IN8A 2Y0SA 1ZGWA 3ISXA 3L00A 4PXDA 4ZYAA 4HDUA 5L3GA 4GYGA 2W57A 2E2HJ 2FMLA 1PPFI 1ZRCA 2IMOA 3ABTA 3OIOA 4H6ZA 4Y4RA 3R5CA 2J5PA 2ZCWA 2QQ8A 3E6MA 3LSPA 2KIQA 5IOYA 9ANTA 5HDKA 2E73A 3Q0UA 3CPXA 3OWCA 1ZR2A 5D6FA 1D1BA 2M30A 2Y48A 2ZJ2A 2L9SA 3LNQA 2PFBA 1FP2A 2H1LA 2NVYJ 3NH8A 4UWIA 1VHOA 3CCQI 2EWNA 3JRCA 1TBNA 5E3RA 2A5YB 5L3DA 1YSJA 3WG7H 1K4TA 3GLJA 3R5BA 3J80K 2AFWA 5JHUA 4PK2A 1W5CC 2JSPA 3EYYA 3WHBA 5EX3A 3DNSA 1XSXA 4BE1A 4AXVA 5J8CA 1LKXA 1Y8RB 3TW7A 2P0WA 2CJJA 3ZXSA 2STWA 3HOTA 1WVRA 3Q5FA 1RETA 3E6DA 3I59A 5FKNA 2J8MA 3V42A 2KL4A 3SDGA 1QSNA 2EWBA 3SJGA 2FXAA 1JXSA 1R00A 2AQEA 2QWWA 4BGDA 2HXIA 3DGVA 2EFQA 2E7WA 1C0WA 4IOCF 5IYCJ 1T8IA 4D5FA 5A28A 1B4AA 2LOOA 2W7NA 3VSLA 2LLKA 2M2EA 4B44A 3JUWA 5D4SA 2KPMA 1U9NA 3U21A 2PVWA 3D7HA 3NA6A 5EX0A 2MD0A 4IX7A 2ZW5A 3H92A 4HBLA 5DM7F 5ELYA 2Q1ZB 5F46A 1Y1WJ 2FS5A 3KZWA 4I7HA 3WG9A 1BI3A 7WGAA 4CSWA 1A31A 2LC2A 1DU0A 2ISZA 4BY1J 2EO8A 2HVQA 2IBDA 4D1QA 5CPAA 2OZUA 1J09A 3VYTB 2YNCC 2O6GE 2PN6A 2AE6A 2VQHA 3HOVJ 4JX5A 4M3DA 4F3QA 4MRIA 4B43A 4UUSA 3HH2C 2YGWA 4BXFA 2NU0I 3HOSA 2X1CA 3UFFA 1XF8A 5ILSA 2HXOA 3QWLA 1LDKB 4F91B 2ACJA 2L54A 3CC2I 1IRZA 1PUFB 2Q43A 3FH4A 1XC5A 2DMQA 1JUSA 2F4OB 2BXYA 2IW5A 1FIPA 3K6GA 3EETA 3FXUA 4S04A 1IN4A 1TF9A 1H0ZA 4WP4A 5E17F 3GTJJ 5LGNA 3BR0A 4GRIA 1Z6RA 1W36D 3TT2A 2QVOA 5J1UA 1OYIA 1XA6A 3S1NJ 3HSFA 1NXUA 2DPUA 5K8MA 2IA0A 4Y3OA 1LRZA 2WAQA 2KMUA 1I6XA 4I01A 1IF1A 2K9QA 4OC4A 1WTJA 1WJCA 2NU3I 3UGLA 1FOYA 4NNJA 1MNEA 1ZRDA 3BDDA 3TOAA 5FLVA 1ZG9A 2AFSA 3K2KA 4N0BA 3ZMVA 1G2HA 2JVGA 3PBEA 1R23A 3HSRA 2HUZA 2FQ4A 1GUUA 3E5QA 1WGTA 5E79C 2ENNA 1H9TA 3PBBA 1O7LA 5K7FA 1WGCA 2RIJA 3HTSB 1IYKA 2OVOA 3S9MA 3LQRA 3R61A 3S93A 4Y49B 2VEZA 5J1YA 3HRUA 5BNGA 1CSOI 1T0FA 2KP6A 1OMTA 3J81K 3L2RA 3I5UA 3OIPA 3PUBA 1FAQA 3CMYA 2GXBA 5EJCA 4C2MJ 1CP6A 2F7VA 2LDUA 3PNVA 4H0EA 4R57A 2DU9A 2DAOA 4XRFA 1F9NA 5IOZA 1FBSA 3AAFA 4HLXA 4AVCA 1FYKA 1R5HA 3OIQA 4NQWA 5GAHJ 5A2QK 3FKIJ 2PJ9A 4E0AA 3KP5A 2YQPA 1YLEA 2XGCA 4KIGA 1VQNI 2DIPA 2XKOA 4LLLA 4AWXB 2LUYA 1BOAA 1UWYA 1BMOA 1YX3A 4YFXF 2DTRA 2BY1A 4JLYA 3QPLA 1HEEA 2ARPF 1PTRA 5IP7J 3CT9A 1S7AA 4QUSA 3NE8A 4R3LA 2X1DA 4IL6C 1X2MA 2JA1A 3IAS2 4IJAA 4C3HJ 1LE8A 3HOZJ 1H8LA 4U9YA 2Q51A 1V1HA 4E1PA 2ZXVA 2KLOA 3C7JA 3CCRI 2P81A 3H8GA 1V5FA 4F9UA 5K5OA 1D1AA 1K7TA 1DGRM 2JSCA 2UXNA 1ZG5A 4FD4A 2B8TA 2PG4A 3HJEA 4A3EJ 3PB6X 1KU7A 4C7HA 4RM3A 2G7UA 2NS0A 3BJOA 1DPRA 4R87A 2DJIA 4GXHA 5CPRB 1YW4A 2CMPA 1XX6A 1UAAA 1ZG7A 1B9NA 1LDDA 2UWMA 4QPQA 3I64A 4C3IJ 2L02A 1YX5A 4N9HA 5LYDA 2KDOA 2MH9A 2ZSIB 3E6CC 3GW2A 2CV2A 3IUOA 1XMKA 1A36A 2MBFA 3C3WA 4MHPA 3BR5A 2M4KA 4D7NA 4FETA 3S14J 3GXOA 2IRFG 2XAGA 5H6QA 3IKTA 3QPHA 3B3SA 1IU8A 2V6CA 3V7RA 3AG2H 2X4HA 3M8FA 2NVQJ 3GUDA 4EATA 3FSXA 3T8WA 1BW6A 2V1DA 1Z8TA 5HS9A 2D1VA 3S1MJ 1K4JA 2GA1A 1ORKA 2D45A 1IRXA 4MIMA 4OADA 2L9NA 2M87A 3F8CA 2B3UA 5THWA 2DTZA 3TBIA 5IX3A 3K70C 4EGZA 5HVQC 3R6SA 2VQYA 3ERED 7CPAA 5DDGA 1CT2I 3GEZA 1OYVI 2BE5F 4KIFA 4JP0A 4CZZA 4XRMA 3PIPF 1EE3P 1P4AA 3TQNA 2OUMA 5IB0A 3IWEA 1YLFA 1HSJA 2OOTA 1W0UA 3RNZA 4FTHA 2FX0A 4S0HB 4F7ZA 2YNDA 2W24A 3P9KA 4XM3A 2CW7A 3K4LA 1TKJA 3CCLI 2O8KA 2GLFA 3GTOJ 4CCOA 1CQTA 2YUUA 1WKMA 2FQ3A 4EVYA 3HSEA 1QPMA 2VKEA 3LFKA 1IUYA 4DW6A 3IRQA 2WVJA 3VYUB 3BXMA 3GB0A 1HXDA 1QNTA 5FKLA 2CWEA 2RFHA 1G3WA 3HPHA 3R5DA 3FYNA 3H3UA 3IH2A 5KAIC 3PFOA 2GOXB 2DMUA 3E5UA 4FBEA 1L0CA 2G3AA 3E97A 3I4NJ 2PJ2A 1OISA 4BQNA 4OAZA 5IV0A 3R0JA 3G8WA 4UEFA 2A6EF 4UB6C 1VTNC 3CF2A 5JVTA 3M1EA 1Q2YA 1DUXC 3FXTA 4DYOA 2HI3A 2XRNA 2TDXA 3E7LA 2B0UC 3S32A 1MMNA 1T0FC 4UIBA 3B35A 1W7PA 3FBNB 3HHGA 2RNJA 3LA7A 2G9WA 3RKXA 2ZENA 4KUAA 2JK3A 4AIKA 5M5WJ 1JQGA 1KUVA 4GYIA 1WJ5A 4MHYA 2A3SA 2DKVA 1YOVB 1XG1A 4CGOA 3QRFF 2SGFI 5LGUA 1QHGA 4JK1X 1S7FA 3BI0A 2E60A 4G1PA 1DQUA 3SI0A 2M45A 4XNHB 2OR4A 4UA3A 2XEJA 1FARA 3LSJA 2ESHA 5EZGA 3HG9A 2E19A 4HA8A 2XF6A 2DOFA 2EFNA 4CUGA 1KQ0A 3AG3H 2QA4I 4E7HA 2GU2A 3W6XA 3QQAA 3RIRA 1QVUA 3BPVA 3WTSC 2R7RA 3H5ZA 4P4DA 3ZZIA 4LK1F 3COAC 2ZJRF 2FD5A 1GXQA 1R5ID 2AJ6A 4U5YA 1A04A 4WXCA 5E1XA 4OC3A 3WTZA 4IF5A 3TOBA 1ARMA 1T33A 4A3GJ 2D2WA 2M0CA 2HKOA 4M73A 3EUAA 2IS1A 2GVIA 2OH1A 4B09A 2FOWA 2KJCA 4M3FA 1P7IA 3QWPA 2PJRB 5M5XJ 2IAIA 2DDAA 4UF4A 2G0EA 1YTYA 2IJZA 3H9JA 2QSFX 1T6SA 2RQQA 2ODDA 2B4BA 3OYLA 2IQ6A 4U9ZA 2VXKA 3S2WA 4Q5SF 3PEIA 3QU6A 1FOXA 5EEHA 4G6QA 5E3NA 2JZMA 2XUBA 4ZY2A 3QP6A 2BW3A 2H6BA 4NDLA 3FKJA 4J3GA 3TFYA 3FB3A 2O7OA 2PEXA 2E1OA 2FE3A 1SGYI 1J4JA 2ZXHA 5BPIA 1S5KA 2ZB9A 2KMPA 4B12A 3RPUA 1PP8F 2NMTA 2JBKA 2OZGA 2ZMEB 3VDPA 4MCQA 3CD6I 4ZDOA 4RDUA 3K1NA 4FISA 4DIQA 4OIWA 5AG5A 4DBRA 3OYNA 3S2DJ 1T98A 1XE4A 2CF4A 4A93J 4IZZA 3W6SA 1UHSA 1D3YA 3I53A 4LIUA 2P6TA 4RA2A 1YIJI 1OCTC 4UUVA 2JEVA 4B10A 5HVGA 1IN7A 2WSAA 4CS0B 2QGUA 1NH3A 2CUZA 1Q2DA 5ICEA 1BPMA 2EIJH 5FGMA 3NWSA 3V7ZA 3BPXA 1LFUP 4DYRA 2DA3A 3T0YA 2ZSHB 5E1WA 3ECOA 3CXSA 3I1UA 1UCRA 1HW2A 2F4MB 3RBUA 2VPLA 4OC2A 1W4RA 2IGKA 2OCCH 2QYOA 3F23A 1JGSA 4DZPA 3SHFA 1XB4A 3JAMZ 4E70A 5BS6A 2IS4A 2PJ8A 3SEZA 4RB2C 3ZN1A 2X85A 3S17J 1S3JA 3KYLA 4AM3A 1R1TA 3QOEA 4WF2A 2K85A 3TO9A 3TO6A 1IV6A 2BOLA 1U9OA 2HNHA 5DEQA 2REFA 3EDPA 3IP4B 2CV0A 4NFRA 2ZOFA 2RQPA 3Q3SA 1TT5B 5FFXA 4UV9A 1SD5A 5FB2A 4IQJA 1XFOA 3FK7A 1LB2A 1LFWA 1Y7RA 4Y52J 4LD5A 3BCAA 2QKMB 1LNWA 2CFOA 2UXXA 4Z65A 1LJ9A 5IYBJ 1WWZA 3WE2A 4BXXJ 4RB1A 2O4HA 3IL2A 4M9ZA 2DDBA 1BAVA 1TIQA 1PJRA 2FA5A 2PMZN 3IWFA 2BY3A 4V2GA 1FZPB 4FASD 1Q1HA 2X1EA 3ASNH 2IA1A 5LBQA 3TMOA 1WH5A 4HLYA 1YS7A 1FYLA 2DPDA 4FKDA 3HOXJ 2PR8A 3IWWA 4RS2A 3CLQA 2Q0OA 2V9PA 4CICA 1MBHA 4OP4A 1RKWA 5DS0A 3RTRA 4CRYB 1T56A 3RQIA 3G3ZA 3OL4A 3OYCA 1CPXA 4ZY0A 3P7NA 4BD9A 2JMWA 1QHHD 3BQYA 1MSEC 2GKTI 1BC7C 2CWFA 1Z21A 5F47A 5E3OA 3S1RJ 2Q44A 3D2MA 5H86A 1HDDC 3LSHA 1MBEA 5JHFA 4IHSA 2M8EA 3ERMA 2PJPA 1HEVA 4FD7A 4LQGA 1ETXA 2PJ5A 2BYVE 3I55I 4JZ0A 4BBHA 1I1SA 2Z3OA 4ENNA 3VB2A 2XROA 3V7CA 3SFZA 3H9QA 1O3QA 4MFEA 5FD6A 2CIJA 1X1AA 2GKVA 4EWTA 1IB1E 2K5TA 1X3WB 5HDNA 1J9IA 2QYVA 3JTGA 1MMAA 3OYKA 4UXJA 4NGQA 4PGGA 2EA2A 4M72A 4KUBA 3K4BA 4Q4ZF 3KCCA 4C7IA 1RRJA 3QYBA 2KKOA 5M5YJ 1CBXA 1VGYA 1WH7A 3TEDA 2ZJQF 2LP0A 2EJRA 3BLYA 3JTHA 2C6YA 4F6AA 5CVUA 5KCMA 4P4EA 1Z8WA 4L8AA 3CXLA 3KHZA 5EC4A 4MXUA 4W97A 4UUSB 4OVOA 3EC4A 1OQYA 2BZTA 4B3XA 5JI6A 2X6XA 2MH2A 3V7SA 2EK8A 3F0AA 2XPUA 4A95A 1IOFA 2FXFA 3S9NA 4LB5A 3L2UA 1ZGAA 3SXNA 1ETKA 4XLNF 3JR9A 2DMTA 2K4JA 4O6JA 1I3QJ 1VHSA 4UHTA 5B1AH 1U8RA 2PIYA 3FXQA 3A2KA 1MBGA 1VQLI 3JREA 1TGSI 2BGCA 1SAXA 1OPCA 2DFHA 4XONA 1X1DA 2HQ5A 3BJ6A 3TO7A 3L2VA 2VB6A 4HNUA 3DP7A 4BS9A 2OD5A 1HSTA 3A0BC 2HZDA 2ZFUA 3F6OA 2WZNA 1RI7A 3V8JA 2M5XA 2B58A 4HX7A 2EZKA 3CP2A 4NC7A 3J7ZI 2HC9A 4HNXB 3OOPA 3NAUA 2Z3LA 4XKBA 2Z11A 4ON0A 1UFMA 3D67A 1MJBA 2O3FA 5E8IA 1FSEA 2XHKA 2Z2SB 4XKVA 3ZQHA 2XPVA 3BR2A 1K4SA 2QQAA 5EZHA 4A3BJ 4XICA 4QBJA 3ZMTA 2V8HA 3KE2A 4PJJA 2R7ZJ 1M4IA 3OS2A 5F08A 1BUSA 4BHBA 2QSGX 3PNTA 3QPTA 1K6OA 1LUJB 1F5TA 1XDSA 2DA6A 1YW8A 2K9NA 1UJ8A 3P2FA 4PZJA 3FXOA 1RKTA 3PUFA 4IHXA 3NFZA 1F36A 3MVPA 4ZC3A 1XGNA 2XB0X 3HBLA 1EH6A 3HM5A 2EFOA 4FE4A 3CLOA 2ZW7A 1UVGA 4AVPA 2K7LA 3EYIA 3CXPA 2IS2A 2ELHA 4NQWB 5D5VB 1V0CA 4ENKA 1Y39A 2KCWA 5LYLA 4EJUA 1B9MA 2JDCA 2P6SA 4BAYA 1R49A 3NH4A 1BIBA 3E5XA 1M1DA 1DTDA 2GLOA 3L2QA 2KCXA 4LFUA 1ZYRF 4MCSA 1MD0A 2MLKA 2V53A 2PR1A 1X4PA 1R57A 2YSRA 1FLIA 1Z6TA 2D1HA 4UUTA 5BMZA 1IC8A 1V4RA 4UVCA 3S2HJ 4IHMA 2GIZA 4Y49C 3PJRA 1SGPI 2GREA 4KOYA 2W84A 4MTEA 5FLXZ 3R9FA 4I02A 3W2WA 1S60A 1WJEA 1YHQI 1OYWA 1PVEA 5H2FC 2GQQA 1LEBA 5LRGA 2DEAA 2Q4ZA 1XN7A 4GXOA 2PJ6A 1P9QC 3LFUA 2H09A 2W82A 1F4KA 2NRAC 4OIQF 1B1BA 2XSJC 1KMAA 2K3FA 3WE3A 2V1XA 3F8FA 2PSWA 3IIBA 1KWMA 3LOCA 2FSWA 4L9TA 2L7MP 3RKQA 2F8HA 5E3PA 2MABA 4M6XA 3KLOA 1KQ8A 1CGII 3WODF 3IGRA 5HNHA 2P7VB 4ZY1A 3NARA 4MHNA 2JA5J 4F8ZA 2R7OA 1TL8A 4XLPF 2ZEMA 2K9HA 2EV6A 1K79A 2DA4A 4AIHA 3BOQA 2VOPA 1LQ1A 3R60A 4CAFA 3BLNA 1ZLJA 5JR3A 1RXTA 4YU9A 5B3SH 5EEAA 3PQJA 5JGFA 2PJRA 2CNTA 4KVME 1IY5A 2DN0A 4KT6A 1Y1VJ 1KZHA 1QBJA 2QSHX 4CGZA 1BBYA 5I0CA 2LMDA 1KUXA 4B5OA 3OWTA 4L5EA 4LITA 4HYEA 2EA4A 4KS9A 4HGUA 4CCJA 1WWXA 5D4RA 1ACIA 2KFDA 1TQPA 2VN2A 3F9KA 4AIJA 1QSOA 2W48A 4MFQA 3BP8A 2YPRA 4EMSA 2QPOA 4HPSA 1XMXA 1Y0NA 3GFJA 2DCEA 2DT5A 2LG4A 3K0LA 3REOA 2ZMEA 2Y31A 1IDZA 1YW9A 4D0PA 1NMTA 2DB6A 1HW1A 3S3NA 5G1ZA 3L9FA 3EFAA 2LB7A 4L0ZB 4UXIA 3RZOJ 2X9DA 5ED4A 4MJ8A 4HNWB 4HQEA 1JJ8C 2GLJA 3G1MA 1J0RA 1OMUA 5AIPA 5D5UB 4FAIA 5TGTA 5E3LA 1N78A 2CFXA 4BJ5C 1V1IA 2R98A 2PJBA 2XEGA 1PUEE 5EGOA 1GVDA 5ICCA 2ID3A 2ABZA 3OYGA 1SFUA 2Y9YA 4OU0A 1U5TB 2DI3A 2CSOA 4LMYA 3ABLH 1WQ2A 2V1CA 4CAEA 1Y9KA 2REEA 1WRJA 1MH4A 4F92B 1LR9A 1R0RI 3KHXA 1D8JA 1WJDA 5KAFC 2YUSA 2NU2I 2UV1A 2F5CA 4M6VA 2GKRI 3WABA 1ERDA 2SGQI 2ZEEA 4BQAA 5KTDA 4OIPF 3OYHA 4MFPA 2H1KA 2HQNA 2AXTC 2PJ1A 3PFEA 5IP6A 1ETQA 1P9GA 1XEBA 4A0ZA 3CCEI 1MZBA 3LD2A 2I79A 4MO7A 2CWGA 4OC0A 1ZGJA 2NVTJ 2H5MA 2R8VA 2XASA 4ENJA 3WTXC 2SGPI 1H0MA 3E59A 4C3JJ 3NE7A 2VRWB 3K2ZA 3LAJA 4E6KG 3B2YA 4I76A 2CQKA 4XPDB 5HMNA 4EM1A 1Z0XA 3G6EI 1IW7F 1P7JA 5HXDA 2ECCA 5E20A 2HPMA 1S7OA 3GFMA 1ZREA 3JRIA 2G3TA 4L89A 1UUCA 4ZDPA 1Z8XA 3H8FA 2KRFA 2DQLA 4M85A 1CJWA 2ME0A 3N4MA 3Q0WA 1AWCA 2OAZA 4XNHC 1ON1A 2DYRH 2XKPA 5FO5A 3ZQFA 2JA8J 4ZX8A 3U1KA 4A0YA 3FEDA 2XPWA 2O5RA 3TDUC 2H8RA 2JN6A 4A5MA 2VONA 4OMYA 4G8XA 2R7SA 4PXEA 5CVJA 1OR7A 4HSTA 3JVNA 1Z91A 3G3SA 4L9NA 1ENHA 1BN5A 2BW3B 3BTIA 2MA3A 3BZKA 1WGXA 4KUMA 3JRHA 3DLLF 5CCMA 3IWGA 4PJ0C 4X6AJ 4A3IJ 5E96A 4RLFA 2D5VA 3RAMA 3DV8A 1B6AA 3J80Z 2MSYA 3H36A 4V2FA 5B1BH 4YWYA 1SMYF 3D5RC 5L3FA 4XOPA 2E36A 2ANPA 2E1NA 4M9SA 2OZ6A 3FHNA 5HS7A 3FSYA 3JTKA 3ML6A 4EQQA 3DPUA 4NB5A 1JKQC 3FBIB 1TNSA 5EYRA 4Y33A 4P44A 2LY9A 4XOTA 1K78B 4KVOE 1YI2I 2KZGA 3F8BA 2HPIA 5EF6A 2ECBA 4KA4A 1QQIA 2I00A 2ZW6A 2KDZA 3FIWA 1D5VA 1XJOA 4B3AA 5F0FA 2E1MB 2Z3YA 4UVAA 2FNPA 3DTIA 2QF7A 2ZELA 2V77A 3CMMA 3ABKH 2X6YA 4G7ZF 2PMZA 3IH4A 2VIXA 2SGDI 1KBFA 2IVMA 2DBBA 4LG0B 2NYXA 4P6YA 4FD5A 4W9YA 1YFHA 2KIMA 3CUQA 2Q4VA 4LGWA 2ZMEC 3CJNA 4Z2YA 1UHAA 1L3LA 3S9LA 2OBPA 4UFVA 2X7BA 3VODA 3MKWB 2Q7SA 1EH7A 2W1OA 4ESFA 1BW5A 2BVMA 3BJ8A 2EZHA 1CP7A 5D8LB 2RVCA 3TP0A 1GLNA 2FSRA 5AG7A 1RESA 2ELJA 1W36C 3UNGC 1SVMA 2ODFA 2QZ8A 2PDOA 1Z7KB 2BHYA 3KFWX 2XRLA 4MFZA 1FMVA 1WKXA 2F4IA 2K86A 5TRDA 3QPSA 1Q9BA 2LSOA 3EO4A 3GZ6A 4MMOA 1KU2A 3BTJA 4D9JA 3HYIA 1ZQ3P 4IRHA 5HLHA 1HKSA 3C2GA 3HOYJ 4UVBA 2B7EA 4ENMA 5FROA 2V1CC 2ZEFA 2WWYA 2P7CB 2IL4A 1ZHFA 2EIMH 4PJLA 1Y0YA 4A69C 1X19A 2WPWA 4WCGA 1WZ2A 3TGNA 2KISA 3I56I 5GTIC 1STZA 4AD9A 4DGWB 4NGTA 3WT4A 2ZEPA 4MFDA 2JZYA 2O03A 3L2NA 3CDIA 5AG4A 1PU9A 3BR1A 3PB4X 2QQBA 2FMYA 4DYCA 4A3CJ 1A5JA 2JPBA 5CJ9A 4E7KA 1XCVA 5B5EC 1UFHA 1YW6A 3H3VK 3CZXA 1TW3A 1TXRA 5HVFA 2ZKZA 4X0GA 2R4GA 2FL4A 2FVGA 1NTCA 4G7HF 2XEFA 1Z3YA 2ID6A 3J81Z 1LFPA 1LAMA 3JCUC 2P8TA 2M1BA 2CQQA 5J40A 1XSVA 2R7QA 5HVHA 2ME6A 1QA6A 3WU0A 3JRDA 1HKQA 2JXDA 4CDGA 3S3MA 1HBXG 1E2XA 1JHHA 2JYYA 3RJPA 5E3QA 1CX8A 1BA5A 5F64A 1XPXA 1BR2A 5A2QZ 4UXHA 4BEHB 3RKWA 2CYYA 4XN3A 2R5ZA 4DZJA 1NSAA 4GI3C 1PYTB 3KI9A 3PSIA 3K4MA 4LIVA 1OR7C 1USSA 3F8MA 1JHFA 1LR7A 5AG6A 2BSWA 6CPAA 4OINF 2N1AB 4LLGF 2KMOA 2XF7A 1U78A 1XMBA 3JRBA 2IPQX 4ANJA 3D66A 1IAWA 4CPAA 1HDUA 1Z5RA 4ETSA 1POGA 1Y6IA 2PMHA 3BT9A 5F1RA 4ORFA 5DAEA 2E34A 2LK2A 1MT1A 3LMSA 4AVBA 3H1CA 1IDYA 5GCNA 1W4MA 2X6OA 2UZ3A 1Z8LA 2E5RA 3FDYA 2E71A 4M3BA 2XDVA 3SJXA 2NS7A 5HI7A 3DU5A 3JRAA 2AS5F 1ZLIA 1W5TA 4HZFA 4JX6A 4XKCA 4AMLA 1YQAA 3KASA 4QC6A 1W5SA 2LKXA 4ZZLA 1I12A 1TF8A 1K61A 2KIUA 1A35A 2RGVA 4IRIA 1XIXA 1BJZA 2X48A 2W00A 3CCYA 2Z3MA 3VDUA 2LREA 3CUQC 5CQEA 3ESWB 2X51A 2CV1A 2D4OA 3KEQA 2VBZA 2ESNA 4EJTA 2M0MA 3LWFA 2HEOA 1YS6A 4R9MA 4UCNA 3A4CA 2LY2A 1Z7LA 4A3KJ 3KEYA 2VL1A 3ZQ7A 2CH0A 3T5XA 4OMEA 5CKTA 2XB5A 1TW2A 3SZTA 1Y8QB 1WK4A 1LVAA 3NRVA 2BXZA 4GM5A 3QODA 3RO0A 4E7IA 1VQMI 4HF2A 3WGGA 3WGHA 5FVJA 1MJ9A 4FX4A 2G7HA 2JDDA 1QQ9A 3GYHX 2GXAA 4AVAA 4G94A 3EPZA 3FVLA 3J7AO 2LTPA 2Q8KA 1FYMA 1ZK8A 1BI2A 4N4OB 3CO6C 2EV5A 4PK4A 4CYNA 1TLHB 2P6AC 5L3EA 1ARLA 1B8IB 3IJ3A 4BH9A 1ODDA 3UR3C 3ZPLA 3ZOBA 1HCRA 4YRHA 1EKEA 2XC7A 3ZQIA 2B63J 2Z33A 3UEJA 1YR0A 3CDHA 1MJAA 3P9IA 4XRSG 4A2UA 2L4MA 3FXJA 3KR5A 2HB6A 1WI9A 1U5TA 4XLAA 4HNVA 4MHGA 1V5EA 1R79A 1U8BA 4P5OA 3B3VA 4A38A 2A5WA 2POKA 4K3NA 3D7GA 3H35A 2HFHA 1R1UA 2LRDA 3FISA 3JW4A 5LYFA 5FUVA 5J3LA 1FTZA 5DD8A 2AFUA 5H84A 2XF5A 5D5XB 4JYKA 2M3AA 1Z05A 2OF7A 4ZZDA 4KOTA 5K8OA 3KL9A 3H0GJ 4KOUA 4NHJA 2Z3NA 4X1EA 4UWJA 2X3TA 2ZEDA 1FX7A 2AQFA 4IOAF 2V8GA 3LSRA 1XMTA 3CPAA 1ZO0A 1KGSA 3SJFA 1VNDA 2MG4A 4GCVA 4HF0A 3GTQJ 3D3SA 1WSUA 5GPCA 1REPC 4OWRB 2L2OA 3FHZA 3E3VA 1R7JA 2EIKH 2L7XA 3OV8A 2I3CA 4XNFA 1EA3A 2PJ0A 1K7UA 1ZARA 1ZELA 4X3RA 2EUIA 4BHCA 2WTEA 3I0TA 1MBKA 4IQ4A 1Z9CA 5K8PA 1LCPA 1VZ0A 3RI4A 2VLAA 2H6CA 4WJBA 1DGWY 5KVRA 1XSDA 1B59A 2ZO4A 3RPQA 2PCUA 2IGOA 3ZMDA 4CYQA 1OCOH 4LQ6A 1GV2A 1ZTRA 3FXMA 1YLOA 2Z0ZA 2KMQA 1OLTA 2ZEOA 1TWHJ 1VQ7I 3MGDA 4A37A 2M4GA 1IY7A 2VASA 5DUKA 4A6DA 3LA3A 1I6HJ 1KZFA 2P6FA 4ONUA 4HDVA 2DXQA 2LYCA 3WTVC 1JGGA 4A3JJ 3PM1A 4P4JA 2WCYA 1WJBA 4LB6B 1GT0C 3CCVI 4LOCA 5CYVA 3FX3A 1M8BA 2HTJA 5DCFA 3M9AA 1XTAA 3OYFA 4MCRA 3RYOA 1K78A 3KZZA 3KYDB 4MTDA 1U6MA 2GXGA 3PGPA 4QB9A 1F2PA 2B9SA 1YO5C 4FE7A 1F1ZA 1VQ8I 3W2AA 5IYDJ 4AC0A 3GKRA 1AU7A 4IO9F 1TUSA 3S8PA 4RAZA 2FNAA 3CO7C 5LFAA 2DPTA 2ZEGA 1P92A 3CJRB 4Y15A 2F5EA 3M1CA 2XRCA 3C2HA 5CVIA 3ULQB 3LSGA 1L0OC 1S3ZA 5EGOB 3R95A 3DBLB 4B6ZA 1R1VA 2X6WA 1I21A 3CMAI 3I54A 2E1CA 3BZ6A 4ABZA 4FUUA 3DEEA 5D5WB 1X3ZB 4LG0A 2L8EA 3WC7A 1T2KA 1HF0A 1YTPA 4IF4A 1KYZA 4DBQA 2WBMA 2MC4A 3GFLA 1ZG8A 1Z3XA 3AKZA 4B4CA 4JWPA 4CGNA 1QMUA 2DJNA 3K4JA 4XQFA 4HNYB 5LHHA 3MFKA 2R1IA 3LACA 1CGPA 5LGTA 2HQYA 3HUVA 1SVOA 3S6GA 3FMRA 4II3A 1RIOH 1F57A 2FUG2 5K7HA 4ASNA 4ZGYB 1B6BA 1MK4A 3RKYA 2MGQA 3R96A 5ILVA 5FD5A 5TJJA 1Q1VA 4L5JA 3ZQQA 3CC4I 4MFJA 3M4OJ 4YFKF 2P4WA 1PUAA 1X12A 2EILH 4A6EA 5F27A 4P4IA 4ZYEA 4II9A 4YIRX 3OS0A 2FJ1A 3LAPA 1NK3P 3MN8A 5E1ZB 5K1YA 3BG6A 1YVKA 4BMHA 4NCZA 1TQIA 2COBA 5JVGF 4GFBA 4A33A 1U5TC 1ZRFA 2QQDA 2DXIA 2RAEA 3JSOA 1ZLKA 1RTQA 4LX9A 4OIDA 2R7VA 4B8XA 2F3CI 3GLLA 3DWLE 1Z9UA 2C6PA 5JM6A 3CDLA 2Q0YA 1LVKA 1F43A 4Z6YA 2MYSA 3OR2C 1XGSA 1ETVA 4WX9A 4FX0A 1X1PA 1VIXA 4AU7A 1TIHA 2EZLA 1Z2IA 3DKYA 2K4BA 3D5LA 3MKYB 1TURA 4A3MJ 1IXCA 5J47A 1CM0A 3PIOF 4KICA 2LKSA 2CW0F 1N75A 4C9YA 4PV6A 1JKPC 4F55A 4XRSA 4HAMA 4EJOA 2WB1N 2VUMJ 5H20A 3GTLJ 4XPDC 4XBFA 2Y2ZA 3C1DA 3R0AA 1N71A 1OZPA 4M6IA 1YW7A 1S20A 3WC5A 3FZVA 1JUMA 4HKFA 2HOAA 1QSRA 3CDXA 5IB9A 2FRHA 2PMUA 2MC3A 3CQZJ 2CRGA 3UY5A 2DA5A 2ZBKA 5LEKA 1KUYA 4BEHA 5J8FA 1Q2CA 4CYCB 2VKDA 1SGQI 2DO7A 2CO5A 3E0KA 4MBUA 2HDWA 4RB0A 3BG5A 5DD4A 4B5PB 5F49A 2L3DA 1S72I 3DCFA 2GA2A 3CJTB 2CWHA 4C2ZA 1CHOI 3CJQB 2L7ZA 1Z4EA 4SGBI 3OYBA 2Z16A 3CUQB 1E0EA 3SZPA 2CJSC 1SVLA 1LANA 5K7ZA 2N17A 4RGXA 2XV4S 5FKMA 3OR1C 5AGEA 4RLQA 3IFEA 4A39A 2HYJA 5C44J 4CHUA 3HOWJ 4FWUA 4CCNA 1G4DA 2NOGA 5K5RA 1WHUA 3ZN0A 2O53A 2K9LA 3F3XA 2FNFX 1BOBA 3BZCA 1VHEA 2ZFWA 2J8NA 3CXQA 2ETHA 3H5RA 2D4PA 4CAXA 3BG9A 1A6IA 2E1MC 2DQRA 1JJ6C 1X1CA 1NE9A 1OJLA 4DNCA 4OKOA 2HWVA 1BJAA 3OVOA 4MHDA 4OC5A 3KZYA 3ABMH 4ZJZA 3V38A 5J1RA 3Q9VA 1O3RA 3R1KA 3MN2A 3IH3A 4KVXA 2H8WA 3FM5A 3QNVA 3DLJA 4ESJA 1MW7A 3M7GA 3ZRGA 2V9KA 2PBIA 3BG3A 3KKWA 2C1CA 4RI1A 4NBQA 1N13A 4KMFA 2F5DA 3SJMA 3PFIA 3BI1A 4MCPA 3DLAA 1Z77A 4BJ6C 1VF9A 3W2VA 4YRVA 2VI6A 2OD1A 1ETWA 4IPAA 3N5FA 3PO3J 4UIAA 2EQRA 2HDDA 1ON2A 1T95A 2BY2A 2MLGA 2MD5A 3KEOA 4R1HA 3MZYA 3F5BA 2WUUA 4NGNA 1SGDI 4M74A 3TP3A 4E8OA 4OIOF 4Q38A 5EDNA 5D8KB 2DLLA 3VATA 3E1SA 1I50J 1J59A 1GV5A 4MNUA 3T90A 2YX7A 4I0BA 1JT6A 2YR2A 4RS8A 4F52A 2K9SA 2Y69H 4A5NA 2G9DA 2AFXA 2BVLA 4ZDLA 4FCYA 1PDNC 1Y8FA 2EK9A 2FT0A 3OS1A 4KYWA 1JKOC 2AFZA 4IUSA 4DJLA 1YIOA 2RREA 1G3YA 2ZNYA 3BR6A 4E7ZA 1B8IA 1Y0RA 4II2A 4IHWA 2E5NA 5ILUA 3FXLA 1DPUA 1IJWC 3TJQA 1TP4A 4JOMA 3E0JB 2SGEI 4C2XA 1ON0A 2VC0A 2HV2A 3BJ7A 1RO5A 2XAJA 3KQZA 4U7DA 2R5ZB 2CU7A 3J7YJ 4KN7X 4OC1A 3DTEA 2AFOA 1R4NB 4H2KA 5FJ8J 1IIDA 4NXYA 2ENZA 3DR6A 4Q47A 4QTRA 3CESA 3FF3A 1X4OA 2DOAA 1TBQR 3MKZA 1EJ9A 2ZPAA 5K8NA 1X3UA 2UZKA 2HVSA 3S15J 5HNFA 2EVNA 2VE8A 3LSKA 4P9FA 5J6XA 4RGRA 3RQ4A 3CF5F 2IGNA 3DQVC 3MWMA 4QWQA 1LR8A 1CT4I 5FUWA 2OZHA 3SZGA 4PXCA 4IHYA 2L9VA 5IT3A 3FEEA 4KDPA 4UV8A 3DBHB 2L7FP 1YQEA 3DPLC 1IO2A 5JQ4A 2F5VA 1I27A 2H94A 3G71I 1ZG1A 4C30A 3OOUA 3SGBI 4GGGA 5ERIA 3SEKC 3GZ5A 3QYFA 4W1UA 1OCZH 4HPQA 3FRMA 4CYOA 3DU6A 2DA2A 4NC8A 1MBFA 3BTLA 4BKXA 4YIFA 2P5LC 1RR8C 4JYWA 3S6FA 1VQ6I 4KSIA 4U0WA 1R22A 2ROWA 3JSPA 2YX4A 4XMYA 3IAM2 1IV8A 4MQVA 3VEPA 3WU2C 1FSHA 1BPNA 4J19A 4U0VA 4KORA 1AUGA 4KITB 3KR4A 4EFDA 2VBQA 4NJRA 1ZAOA 1VQ9I 2V6EA 1GYTA 2VODA 1K6YA 3FXKA 2J87A 4H4KC 2EB7A 3B3CA 1V55H 1P2FA 4MY0A 4XK4A 1E17A 3KX2A 2Z5UA 2IS6A 2R7HA 5F48A 3CUOA 1KA8A 1P4WA 2L9RA 3HL2A 2NU4I 2BO9A 1TWFJ 2ICWG 2JWTA 4UB8C 2LR8A 2STTA 1S7KA 4YFNF 4XORA 4NJQA 1GVJA 2IA2A 4NGRA 2XAHA 4HV6A 1FYBA 4ZX9A 2V26A 1T08B 2F48A 2GAUA 4G9YA 2HTSA 1FY7A 2QKLB 1JWQA 1UB9A 3A9LA 3D2PA 3PFYA 5JPHA 3MAJA 2O61A 5FUXA 5CBMA 2XIGA 2OPTA 3KETA 1W3SA 2XAUA 1QO0D 1UZCA 1APLC 2V1UA 3KPHA 1DS2I 1JT0A 3F72A 5I4MA 2F5IA 5HQ8A 1Q7LA 2HGCA 2VXZA 2CUFA 4QLCU 4CCLA 3P9CA 2HQAA 3QOPA 3AG4H 1PYVA 3EQLF 3FMQA 3OXFA 3B4VC 4JD6A 4KOXA 2VZYA 4AB7A 4CGPA 3UEYA 2I5UA 5D8NA 3VWDA 4MLOA 1K83J 4RAYA 1QRYA 4L9VA 4NF1A 2GWRA 5KTCA 2Q2EB 1S7LA 4XLHA 5F0CA 1S7EA 3D7DA 4BL0B 4WWCA 4F93B 3EUKL 4XIDA 4D7MA 1R5GA 3WTYC 2OTLI 1CG2A 4AG9A 3HIFA 2ZW4A 4ZI6A 3ZGKA 2BHZA 4AYBN 4PSWA 4BDZA 1FT9A 4BU2A 3ISPA 2UUZA 4BE2A 2W85A 5BQTA 5GAGJ 2CTCA 4JCVE 2RB7A 4AVZA 1MBJA 2QM3A 2AXLA 2GIVA 4H6UA 1O57A 2R3SA 2V9VA 3FNCA 2ADUA 1ULNA 5CNPA 3HKZN 2OA4A 1MMGA 3X2QH 1M4LA 4KSFA 3SHPA 4MGRA 3ZR8X 9WGAA 3V8IA 1ZLHA 1FTTA 4EM0B 2JTVA 3ZMZA 3O6BB 3D4UA 5EG0A 4B47A 3W3CA 4E4HA 2E7XA 2ERWA 4QVTA 5HOOA 3I9SA 3GWZA 4A0XA 1R36A 2CXAA 4X2TA 2GANA 1H88C 1IRGA 4XLFA 3D68A 2DYSH 5IY5H 1G3TA 3GZNB 2X0LA 3ZMSA 5D29A 2Y75A 1AMPA 1S8NA 1VI0A
chains in the Genus database with same CATH topology
5HDGA 3HRSA 1H9GA 1IN5A 2Q7BA 1GXPA 3N97A 1SFEA 2A4NA 2RC4A 3FF5A 4OIRF 2VBXA 1RZ4A 1ZN2A 1SD6A 5LLQA 4R3KA 4XSZF 4HW0A 4FT8A 4CRZB 1FP1D 4A32A 3GF2A 2WPXA 1KU9A 4I49A 2LF8A 3EXNA 4MFLA 4M6YA 1ZH5A 2G0BA 3TCVA 5D6EA 4B5PA 1FC3A 4EVIA 1BC8C 1B87A 3BWGA 3GY9A 4Y13A 3I3GA 1G3SA 1DDNA 4MEXF 4MEYF 1K7AA 3EY5A 3RDIA 4DQ2A 1CF7B 2VI7A 3ABUA 3KP2A 2IP2A 3BROA 3LSTA 3H4QA 1IYLA 4BXUA 1IICA 5KTAA 2IJLA 1S29A 4ZYGA 4K30A 2QBYB 2YNEA 4UBRA 4GO1A 4P9UA 4KSAA 1JE8A 3ROUA 4G6DA 1U2WA 4HF1A 3MQ0A 2ISYA 2B0LA 5K5QA 5F6FA 4JXQA 2M5WA 5G20A 4YIIA 5BOXA 4UNOA 2BEOA 1ZO0A 4C2YA 2YU3A 4K2EA 3K1MA 4YG2F 4IHTA 5CVVA 3S6KA 2P5VA 1FPQA 4KT5C 3MZHA 4HQMA 1XCBA 1J2XA 2J8RA 1M44A 4ESBA 1EV7A 4UFWA 2DK5A 2PQ8A 4BHPA 3PP9A 5LHIA 3R4KA 5G21A 1Z1DA 4KN4X 4PSXA 2K27A 3GVAA 3RYRA 2XAQA 3W6KB 1J75A 2O28A 2CNMA 1GHEA 5E18F 3L2CA 1QSTA 4PDKA 5DUIA 2JPCA 1XGMA 1R58A 3RYPA 4WXHA 4R79A 2ATRA 2EFWA 2Z3KA 1OMIA 2J5OA 2LKPA 4U88A 4MQ9F 1QZYA 1O3TA 2KIFA 2QUFA 2HOEA 5C88A 2JRTA 3PQKA 1QSMA 1HQCA 5L3BA 1MKMA 1KU3A 3L09A 2B4DB 1IZ1A 5DCMA 4KFCA 3DF8A 1BM9A 2WC2A 1M4GA 2DPSA 1AOYA 2VBYA 4UCMA 4U7BA 2HDCA 2OB0A 2DW4A 3L7WA 3NQOA 4Q48A 2VT2A 4JQFA 2HQRA 3O2PE 2XAFA 3F21A 3DDDA 5DWNA 4L9JA 1BI1A 4KLVA 2EFPA 1TNTA 1FNNA 4A2ZA 1V3FA 4Y17A 2OQGA 3I71A 4UXNA 2IT0A 1IN6A 1YVOA 5BPDA 4M9XA 4ZH4F 4EGYA 1D8KA 2Q04A 3T8TA 2HYFA 1P4NA 1FBUA 1IXSB 5G22A 4O5VA 4MY3A 4P96A 3KP3A 4H89A 4I09A 3CTAA 4CAVA 4S05A 4I0AA 3G73A 3SQNA 1BIAA 2B5GB 3C26A 1TTYA 2Q4YA 1HW5A 2Q2EA 3Q9SA