2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
3FF5A 3WTVC 4JLYA 4B5PB 3EETA 3IHUA 1IN4A 4UWJA 5HOOA 1IXSB 4AVBA 2MA3A 3WTZA 4RB1A 3GZ5A 2JSCA 4PSWA 3PQJA 5LHHA 2QYOA 1UCRA 5KK1A 2D4PA 3WTUC 1FP2A 3QB8A 2VXZA 2FMLA 4EM2A 4EJWA 1YTYA 4Y49C 1M4GA 1LDKB 3LA7A 2FE7A 2PSWA 4G6QA 4Q47A 2FNPA 3F8KA 1GHCA 4YFJA 2A61A 5HS8A 2G7HA 2HKXA 4KLVA 2DXQA 2FIWA 3KP6A 4D0PA 3I58A 3RIRA 2ISYA 3BJ7A 1TNSA 3CXPA 2K86A 2ZW7A 3IWFA 4HLYA 1ZH5A 4P96A 1P2FA 3WTXC 2PC1A 1U5TA 4IRIA 1LEAA 2HQRA 4RS8A 3FX3A 5H6RA 4FX4A 2AJ6A 3TOBA 2P8TA 1B9MA 4A12A 4RS2A 3U9GA 3LWFA 5ILSA 3OOPA 3JAMZ 4R3LA 3MZHA 2FL4A 4DNCA 1S29A 2MH9A 3N97A 2QZ8A 1CGPA 5FO5A 3PZJA 3OV8A 3DKWA 4F6AA 3EFAA 2JT1A 3P2HA 1FLIA 3N7ZA 1WWZA 2NNNA 3BPXA 3MEXA 4XPDB 3J81K 5CNPA 4XPKA 4UUVA 4KMFA 2VT2A 3GO5A 1H9TA 4CGZA 5JI6A 3L9FA 3KCCA 3BLNA 1T6SA 5IV0A 1KU2A 5D5UB 3CO7C 2O28A 2L01A 4GYGA 1YG2A 1ZAOA 4RGXA 3N4MA 4PV6A 4KOWA 3CUQC 2O03A 4B09A 3ZMTA 1K4JA 3S2WA 1RXTA 4ESFA 4KDPA 2O8XA 2FSRA 1W5SA 1Z1DA 4F0YA 2G3TA 1YLEA 3FMRA 3KKWA 1ZHFA 3ROUA 2DO7A 5L3GA 2COMA 1SFEA 3RI4A 3BJ8A 5LEJA 4ORFA 2LF7A 2X0LA 2C27A 2IA0A 1SQHA 1QSNA 3QRFF 3U1DA 1JHFA 1LNWA 2B5GB 2B5GA 4P9FA 1ULYA 4JQFA 4MEYF 1T0FA 3S6KA 2G7UA 3B73A 5JR3A 2HDCA 3DR8A 1G3TA 2XASA 5CVRA 4R3KA 4KA4A 3J80K 3GUDA 1W7PD 3CUOA 2O61A 1ONVA 1MJ9A 4S05A 2D45A 2ATRA 2RC4A 1ZYRF 2J8RA 4PCQA 1BC8C 2BEOA 4KVOE 1BM9A 2OA4A 1EH6A 4HAMA 1K79A 4EVIA 4GGGA 1OPCA 3JSOA 3E6MA 1R00A 2CO5A 3LODA 2WV0A 2YX4A 3HTUA 2W57A 4IRGA 3VWDA 1LQ1A 1LVAA 1QGPA 1Z6TA 3H92A 3C1DA 1YVOA 1XD7A 3EXNA 1BI0A 4LMYA 1BIAA 1ON0A 4OLLA 2MBFA 4WXDA 3GW2A 2HEOA 1YX0A 2FEZA 2A4NA 4YIFA 4L18B 3DSBA 2JDCA 3DFGA 4ZYHA 2EFWA 4M6XA 1B87A 3RKWA 3KLNA 2H09A 1G3YA 5HVQC 5LRRA 3TDUC 2REEA 2P7CB 3PGPA 5DCMB 1T39A 2HTJA 4NQWA 4UVCA 2BSWA 4MY0A 4E0AA 3R61A 2HFHA 3F8BA 2B0LA 1X3UA 2DFIA 3TT2A 1B59A 1F9NA 2V9VA 2ZO4A 1L0OC 5F6FA 3LFKA 4F7ZA 2QBYA 2KIFA 2Z9OA 5DWMA 1KA8A 3WTTC 1YR0A 1B4AA 4NEXA 2EFPA 2M1BA 4UXNA 4HV6A 4A6EA 1H9GA 1SD4A 1R36A 3RKXA 4U0WA 1S5KA 4KORA 2KIMA 2HUZA 4HF0A 2ZNZA 4QBJA 3WTSC 3TDZC 2R7DA 3R4KA 3ECOA 3F6OA 4HX7A 1CF7A 3FIXA 3G3SA 1Z91A 3I59B 1ON1A 2NAZA 4IJAA 5K5QA 1Z6RA 4WWCA 5IT9K 2RVCA 1WWXA 1MDMA 3FM3A 4Y49B 3RPQA 1XN7A 3VODA 4AG9A 2J8NA 4FHTA 3EC4A 2ESNA 3K9UA 4LUAA 3ZZIA 4IHTA 4AIHA 5H84A 3TOAA 2QUFA 3ZP5A 3W6JB 4ZH4F 1EH7A 4OMYA 2H5MA 1DPUA 1WKMA 5AONA 1BI1A 2AS5F 1XDUA 1TW2A 4LLGF 2QM3A 3RJPA 1ZLJA 4HLXA 4PK3A 2J5OA 2W25A 3NE7A 4UV9A 1XMAA 2HYGD 4L89A 4JD6A 3PQKA 3C26A 2W85A 1WRJA 3HSRA 4JJXA 3K2ZA 3K1NA 1J7KA 4LLLA 5DWNA 3SFZA 2D4OA 5EEHA 4WCGA 4HZFA 5ICFA 4I49A 3KP7A 2Q44A 2F5FA 3E0KA 1I12A 5D4RA 2IW5A 1K6OA 2XAJA 1Y0UA 4LG0A 2GZWA 4LG0B 3F22A 3WGHA 3HSEA 4U7DA 3LAJA 2K5TA 3ZQ7A 4JXRA 4GXOA 2OBPA 5JFRA 1BOBA 3KP3A 4NB5A 4G7ZF 3RPUA 4MGRA 1OKRA 2FQ3A 1W7PA 5F47A 3J7AO 1RNLA 1HW2A 1LB2A 1XSVA 2HTSA 2F5DA 4IRHA 4RGSA 4KUAA 5E18F 1S3ZA 3FM5A 4KVME 4M74A 2B4BA 2HKOA 2PMUA 5IT3A 5BPIA 1F1ZA 4HOBA 4RAYA 4ONUA 3ZMVA 1VKCA 4OIRF 3ECHA 5LHGA 3NQOA 4X5KA 3DF8A 2IPQX 4KNYA 1Z4RA 2RGVA 3EYYA 1UFHA 1ODDA 4HNYB 4XLNF 4KOUA 3R6SA 3F6VA 5HDNA 2JZYA 1YIOA 5DD4A 3WG9A 1TQIA 4LK1F 2DU9A 4CO8A 2P6GA 1U6MA 4L9VA 1QSTA 2WWYA 2EV5A 2QMLA 4FD5A 4KIBA 3HYIA 4MBUA 1JE8A 4J3GA 1QPMA 4KICA 3QP6A 2Q4YA 2EFNA 3V4GA 4BQAA 3IGRA 4L5IA 3IWZA 5BQTA 4KUBA 2XVCA 4XLPF 2IL4A 1K78A 5AIQA 1QQIA 2P6FA 5BMZA 4E8OA 2RDPA 2RQPA 4IVNA 5FFZA 2QENA 5ICCA 4O3MA 1TBXA 2EFOA 1IIDA 5J8CA 4O6JA 4CS0B 2K4BA 5BPDA 2PFBA 2XHKA 6PAXA 3GEZA 5L3CA 4ZZLA 4AIKA 4G7OF 1OZPA 4OADA 3F3XA 2EJRA 1FYMA 3DPLC 2E7XA 3WR7A 4L9JA 3V7CA 2V1XA 2IJLA 3QU6A 4OIOF 2STWA 1RUOA 3COAC 1GVJA 5D5WB 2X7BA 1BI2A 5D6EA 2J5PA 4RB2C 3G8WA 3F5BA 3EDPA 3VFZA 4XRFA 1Q1HA 2Z5UA 1KUXA 2CNMA 3ZPLA 3BWGA 4KYWA 2QQBA 2QIRA 5HLGA 1JGSA 2VBWA 2R3SA 4U0YA 1KQ8A 1UFMA 2A5YB 1P4AA 1SMYF 1J9IA 2YX7A 1I21A 3FXRA 4AG7A 3CXSA 2KRFA 3D3SA 1BIBA 4M9XA 2M30A 2ZMEA 5E1XA 3GF2A 3MGDA 2ADUA 5E1ZB 1MJAA 1IN6A 4G8XA 4MNUA 4MEXF 1PUEE 4XPLA 2RNJA 5FVJA 5DYMA 3F8MA 1M4IA 4BHCA 5DUKA 3DV8A 1T38A 1T2KA 2Q04A 3E5UA 2E7WA 4WXCA 1KYZA 2IRFG 4QB9A 1I27A 3I71A 2P5LC 3MQ0A 2VODA 4UA3A 5CVJA 2H6CA 2RKHA 5LGNA 2JPCA 1D5VA 2MD5A 2EA2A 2FIAA 1S7AA 2A6EF 1J59A 4QWQA 2IVMA 1M44A 2YR2A 2G0BA 2DTRA 2JPBA 3S6FA 4K30A 4R87A 5H20A 1DUXC 3GFJA 1U2WA 2ZMEB 5EC4A 3T8RA 1O7LA 3TGNA 3D5LA 2K02A 1YW7A 4M6YA 3LA2A 4XSZF 3TE4A 3W6SA 4CYDA 1ZRCA 4R9MA 1NMTA 4L0YB 1O3SA 3T90A 1PP8F 3DDDA 1NSLA 3RTRA 5IX3A 3M9AA 5E96A 1K78B 1SD7A 2PR1A 5A2QK 5F48A 1FYLA 1NHAA 3DXJF 4DQ2A 2A6HF 1XMTA 1GXQA 4LFUA 1R22A 3DP7A 3IRRA 4EV0A 1KU3A 5C82A 2Q0YA 2L4AA 3MCZA 1IN5A 2QLZA 3FXUA 4A0XA 3FMSA 4FD6A 5D8LB 1E2XA 4OMZA 5CJ9A 1SD6A 1HKTA 2CY2A 1BBYA 4UVBA 3R0JA 4Y17A 2YU3A 2IA1A 3CO6C 2CYYA 1DDNA 3KEQA 2VBZA 2VZZA 5HLIA 3I0TA 2DPDA 3R96A 1C0WA 5DEQA 3ULQB 1O3TA 3MWMA 2QECA 3W91A 3G3ZA 2NYXA 1ZREA 4EJUA 2R1IA 2Q0OA 2PI0A 4XSXF 2PQ8A 2VT3A 3IWGA 4BMHA 3BOQA 3KETA 2B3VA 2KKOA 2V1UA 4NF1A 2XAFA 4HYEA 3TCVA 1ZRDA 5FD5A 5KTAA 3R95A 4L8AA 2B58A 1IZ1A 2FF4A 3V7RA 1W7PB 1XGSA 5FD6A 4AIJA 3D2PA 4UV8A 2VONA 3IL2A 1Q2CA 1YYVA 5H6QA 2Q8KA 1P4NA 5CVIA 5L3FA 4Q5SF 5E8GA 1TTYA 4YFXF 4HDUA 1EV7A 3K1PA 1FBUA 1QZZA 3KLOA 5D6FA 3ISPA 4MY3A 2FBHA 2XROA 2LKPA 5KTDA 2A69F 5LBQA 1U6GA 4LB5A 2UWMA 4IF5A 2G9WA 2PR8A 4A0YA 3SZPA 4QUSA 4CAXA 2IT0A 3W6XA 1TIQA 3KP4A 5AIPA 2KJBA 2XAGA 2CW0F 2WC2A 5ED4A 1P6RA 4RAZA 3B02A 3IKVA 2XGXA 1LRZA 2P4WA 2HS5A 1XEBA 2DQRA 5ICGA 1XGOA 2K27A 5HH1A 5BOXA 1MGTA 2HYFA 2F5IA 1BOAA 5FFXA 4EGZA 3BJOA 2E1CA 1Z4EA 1FP1D 2F5EA 4IPAA 3KP2A 1STZA 2QVOA 2UXXA 4TV7A 4K2EA 2BV6A 2HR3A 3ABTA 4BH9A 2FBKA 1I1SA 1ZARA 5E8IA 3D0SA 2HWVA 4LD5A 1J75A 3V8KA 4QLCU 1PDNC 3BY6A 1OYIA 1S7OA 5CVVA 1S7NA 2BGCA 4A0ZA 2RN7A 4HX8A 3JW4A 3T9YA 2FS5A 4WK8F 4N0BA 1J0RA 2ZXJA 1SFXA 1SD5A 4CAWA 2LDUA 4KFCA 2R7FA 4U88A 2M45A 5DV5A 4PK2A 3B8GA 1HBXG 4M3SA 1OMIA 3KEOA 5LGUA 3E5XA 2VOPA 1MK4A 2UXNA 5J6XA 3M7GA 4HA8A 4P5OA 1MD0A 2DW4A 3RKYA 1TQPA 1RUNA 4ON0A 3LA3A 4U5YA 5DCFA 3I4PA 2LNBA 2OQRA 4LJZF 5JQ4A 4ZBGA 3BPVA 4ASNA 2BYVE 2EUIA 1Y9WA 4AB7A 5TRDA 2XUBA 2FOKA 3RYRA 3MAJA 4A5NA 2PRBA 4CDGA 1IB1E 2A3SA 2OZ6A 1JXSA 3LQQA 4EMSA 2Z11A 1FPQA 1TNTA 1YW9A 4XNHB 2JEVA 3S6GA 1B1BA 4CHUA 4KN7X 4G7HF 4I2OA 2M5WA 4B5PA 1YREA 2W84A 2GIVA 3I54A 1YVKA 5ILVA 5FLXZ 1A04A 1IXRC 1FX7A 3JTGA 3E6DA 3FRMA 2FMYA 2Y48A 5K1YA 2B4DB 2PEXA 1F4KA 4YRHA 4JBAA 2OZUA 4EVYA 4KOXA 4HQEA 5HDKA 3BROA 1G3WA 2VE9A 1ZG5A 5EBVA 3RYOA 3L00A 4U0VA 2JRTA 4ENNA 1J2XA 2NS0A 2I00A 2M87A 3JUWA 4EQQA 4EJTA 3TKYA 1ZRFA 4B5OA 1O3RA 4CAVA 2ZXVA 4KIFA 1WQ2A 3HSFA 3FYNA 4N9HA 2TDXA 4MTEA 3R0AA 5GCNA 1KYWA 2L4MA 3ZN1A 3GLXA 4JWPA 4M9ZA 2J8MA 5HLHA 3V7SA 2DK5A 4GCVA 2JDDA 2QBYB 2Y0MA 2Z0ZA 2BEIA 2BBYA 2XAQA 5DUIA 1WSUA 2XIGA 5HS7A 4Z2YA 3L7WA 2EA4A 3JSPA 5L3EA 1U3EM 4PGHA 1HW1A 3V8IA 3WTYC 4O5VA 3VB2A 2JLMA 1TW3A 1R57A 2BUEA 3O2PE 1SMTA 1G3SA 3V8LA 1XMKA 2O0YA 2MC3A 4YG2F 5ISVA 3F21A 5CYVA 1R58A 3T1BA 1YO5C 1OYYA 1WK4A 5FB2A 1I1DA 2K4JA 4H0EA 2BL1A 2MH2A 5A2QZ 3GZ6A 2R7HA 4R57A 1USSA 2B4DA 5JVTA 1R1UA 1IYKA 1BO4A 1L3LA 1EH8A 1R7JA 4PDKA 2MLKA 1FOKA 3P9KA 4UBRA 2DLLA 2H94A 1USTA 4EJOA 2ZNYA 4EM1A 3SXNA 5ILUA 1HW5A 2P7VB 3FBUA 2A07F 3CDHA 2VN2A 4MI4A 2GA2A 2BE5F 3BZ6A 4M73A 3F72A 5JHUA 3GYHX 3QU3A 4RB0A 2OD5A 3M1EA 4G94A 1NE9A 4HBLA 3CLOA 3I53A 1PP7U 2EFQA 2O3FA 4U7BA 1I6XA 2GXGA 4RGUA 3ERED 3F8CA 1KZFA 1R23A 3HRSA 1MZBA 4ZZDA 4A5MA 3HRTA 3T0YA 4M9SA 3BDDA 4OINF 4OIPF 4PGGA 4CXFA 1HSTA 4JXQA 2RV8A 4M71A 2VZYA 2CQKA 2ZPAA 1U8RA 4PSXA 3SHFA 3BP8A 3E6BA 1Z9UA 2EV0A 3GVAA 4U9ZA 3DQVC 4H89A 4CICA 2ETHA 3IRQA 4IUSA 4Y15A 1Q2DA 3FXQA 2XV4S 1IAWA 1Z05A 3ZN0A 4BAYA 1LEBA 3F8FA 1KQ0A 1B6AA 1XGNA 2ZJ2A 1WI9A 4L0ZB 4AVPA 1DP7P 4IHSA 4P9UA 1OYWA 4CZZA 3FHZA 2X4HA 1FY7A 1GHEA 1MJBA 2V1DA 3JTHA 1O3QA 3IKTA 4YIIA 1E17A 4QVTA 1XCVA 2Y75A 5FGMA 3VEPA 4EGYA 1FZPB 3FXTA 4MQVA 2WPWA 2FXFA 4L9TA 4NXYA 2P5VA 5LEKA 4UVAA 3M8EA 2ZW6A 3LSTA 4EM0B 4KOTA 4XBFA 3QPHA 1U5TC 1TQMA 1Y7RA 3FMQA 3AAFA 2VXKA 2FE3A 1PU9A 3RDIA 2DI3A 1J5YA 2PJPA 4I0BA 2NMTA 5LGTA 1D8JA 4LB6B 1J4JA 4XNHC 4ESJA 1XSXA 3IC7A 4MJ8A 1IW7F 1FSEA 1LDJA 4CRZB 2Z10A 1R1TA 3O6BB 1KUYA 3ZMZA 4OIQF 5CVUA 1FBSA 5E17F 4KVXA 3I3GA 1GXPA 4GS4A 3I59A 1CJWA 2Z33A 2GA1A 4P55A 4U9YA 5KTCA 1FWZA 2EVNA 1R5GA 2PG4A 1D3YA 1S3JA 3PP9A 1S7KA 5DCMA 2DBBA 1ZN2A 1DPRA 2ZFWA 4LK0F 2P6SA 3C3WA 1M1DA 1S60A 1V4RA 1L0CA 2EB7A 3TO9A 3VOEA 4MQ9F 4RB3C 1HQCA 2HGCA 4HDVA 5DD8A 4E2AA 3BJAA 3DPTA 1IRFA 4LGWA 1UHMA 2R98A 5D8KB 2VI7A 4BHPA 1XSDA 2ISZA 1UB9A 4ENMA 3NEUA 1KU9A 1QBJA 3GFMA 1S7FA 3W6KB 4YFNF 5LLQA 4KLWA 5LHIA 1RI7A 1QO0D 3CUQA 3CUQB 2CG4A 3U2RA 2FA5A 2Z3YA 3DEUA 2C6YA 2W24A 1P92A 2VC1A 2EWNA 3P9IA 3I64A 1CF7B 2REFA 1R1VA 2Q2EA 5L3DA 2PLYA 4FX0A 1FNNA 5LRSA 1S8NA 4OAEA 3P2FA 4I02A 3EQLF 2O6GE 2VBQA 4HX4A 2IA2A 1YGHA 3I5UA 2EV6A 3MFKA 4NCZA 1XCBA 1QSMA 2AE6A 3R9FA 3TQNA 3SHPA 3ZJ0A 4AVCA 3KP5A 2LSOA 5F1RA 1Q2YA 2G3AA 2GAUA 4CRYB 4A2UA 5BS6A 1V0CA 1IN7A 2I79A 2HOEA 4FT8A 2YSRA 3R1KA 3WE3A 2OH1A 1Y9KA 4H6ZA 3OWCA 1O57A 2VBXA 4Y13A 1YFHA 2P0WA 2OZGA 5K5RA 3WGIA 3LAPA 2D1HA 5CLSA 2DK8A 3REOA 3T5XA 2Q7BA 2XKOA 2P6TA 2VC0A 4R1HA 4I98B 2FCKA 4QC6A 4KZTA 3GFLA 3MZYA 2STTA 1BN5A 3QPTA 3RYPA 2JTVA 3FZVA 3O3KA 2P6EA 5D4SA 2HQYA 4ZYEA 1V3FA 2F2EA 3F0AA 4MTDA 5F64A 1N71A 5D5VB 5E1WA 4G9YA 2OQGA 4I01A 5DDGA 1Z9CA 2WTEA 1TLHB 4JK1X 3DNSA 3WU0A 4OU0A 3LD2A 3ABUA 4BYYA 4LX9A 3TTHA 2NRAC 3GY9A 5D5XB 5IT9Z 2CNTA 2A68F 2GXBA 1VTNC 1HKQA 4NSQA 1YQAA 2DQLA 4KOSA 2FT0A 3JVNA 4MHGA 2V6CA 4NHJA 2XKPA 5KVRA 2CWEA 2Z99A 1S6LA 5IB0A 2FU4A 1YS6A 4N9IA 2LF8A 1LJ9A 3E3VA 3GYAA 2HZTA 4RI1A 4KIGA 4GYIA 4UNOA 1JHHA 5FLXK 1P4XA 3KE2A 3J80Z 2KCWA 4YGOA 1B6BA 3GX4X 1IICA 1O7FA 2Q4VA 4R79A 3GWZA 2DT5A 3SQNA 2KIUA 1QNTA 3WU1B 1K7AA 3P7NA 5F49A 1IYLA 3I9SA 3E5QA 3D8PA 4KUMA 2VEZA 4GO1A 1W4MA 2OU2A 2GWRA 4HV5A 3F8NA 3K1MA 2AXLA 4ENJA 1T98A 3R9GA 4I7HA 1IN8A 1IUYA 1AWCA 4IXAA 2FSWA 3BJ6A 4HNWB 1HSJA 5EEGA 2V79A 2PBIA 4HW0A 1HXDA 3FWEA 1FYKA 3CXQA 2D1VA 4AD9A 1FT9A 4FD4A 2K7LA 4R8HA 3GKRA 2B3UA 3HOTA 4RGRA 1U5TB 4PZJA 1KU7A 3HOSA 5C88A 4BHBA 2VQYA 1BC7C 4ZYGA 5HDGA 1IXCA 4B8XA 4BNCA 3DR6A 3T8TA 4M85A 2OAZA 2NNYA 1I5ZA 3FNCA 3QP5A 3G73A 2CFXA 3TFYA 1G6NA 2R8VA 1YS7A 2L02A 2H27A 3E97A 3ZMUA 4II9A 1XGMA 1BJAA 3R60A 1YW8A 4L9NA 3V8JA 4LLNA 4UHTA 4ENKA 3J81Z 3K9TA 2KJCA 4MHDA 2VBYA 4WF2A 2H6BA 4KOYA 3H3UA 4H6UA 4XPDC 1Z7UA 1H0MA 5TJJA 2L3DA 1KUVA 1I1GA 3R9EA 3QOPA 1FSHA 3ZMSA 3ELKA 2OZHA 5ERIA 2QQAA 1BI3A 3SXYA 4UWIA 2XRNA 3K69A 1ZGAA 3M8FA 1ON2A 2DPUA 3CTAA 1QSOA 4HF2A 2ARHA 2E1NA 5ICEA 4M72A 1RO5A 3D2MA 1XDSA 2FBIA 1QSRA 4I0AA 2QWWA 2ZCWA 3NRVA 4I09A 2WPXA 2PMHA 3C18A 3SZTA 2HV2A 3C7JA 3KZZA 3PFIA 1P0HA 3EO4A 2FNAA 4S04A 3ZMDA 1G4DA 2EK5A 2CSOA 2YPRA 2ZW4A 4OOIA 3CJNA 1VHSA 3Q5FA 2ELHA 3QAHA 3WGGA 4YFKF 1XE4A 1LDDA 3GFIA 2D2WA 3GXOA 1XF8A 3S6HA 1XIXA 3K0LA 2CGPA 3UY5A 4KT5C 1KGSA 4ETSA 3E6CC 2F5CA 2UZKA 1FBQA 1PUAA 2QQ9A 3L09A 1CM0A 2IP2A 3L2CA 5L3BA 1D8KA 4BXUA 3F23A 1U78A 1MDMB 5HS9A 5F46A 1AOYA 1HKSA 1F5TA 3FB3A 3HHHA 2VOOA 2GANA 3EYIA 1RIOH 1M4DA 4WXHA 1KQ9A 3HHGA 4EJVA 1ZGJA 5I0CA 1R5HA 1QZYA 3TO6A 3VWEA 5E20A 4HQMA 1YK3A 2GE3A 1OR7A 3LQRA 2XAHA 2ACJA 2L54A 4ESBA 4L5JA 1SFUA 2PDOA 3H3ZA 4KMUX 1MKMA 3KZYA 1B9NA 4Q4ZF 3JAMK 4KN4X 4E70A 3WE2A 2MLGA 3KFWX 1YLFA 2FXAA 2ESHA 3H4QA 3WTWC 1IRGA 4AVAA 2ZKZA 4WX9A 1IF1A 5J8FA 2CNSA 2DAOA 1ZG3A 1RZ4A 1SAXA 2P5KA 4FD7A 1ZG1A 3TO7A 4Q48A 4AWXB 5JPHA 4KOVA 4A6DA 5K5OA 2OB0A 4G6DA 4ZYDA 1XB4A 2ZBKA 2M8EA 3EY5A 3ML6A 2FRHA 2PN6A 1UHWA 2VE8A 3Q9SA 3HUGA 3HRMA 3SXOA 1REPC 2ZW5A 1W5TA 4HNXB 1P4WA 4IF4A 1ZLKA 3HTSB 3EUHA 3HRUA 4HKFA 3HIFA 3P9CA 5HMNA 3Q9VA 3WODF 2GQQA 1S7LA 5H86A 4HF1A 2HQNA 1FC3A
chains in the Genus database with same CATH superfamily
5E3PA 3FF5A 3WTVC 3D4UA 4JLYA 3KASA 4B5PB 3EETA 3L2UA 3IHUA 1IN4A 5FRMA 3KGQA 3A01A 2NS8A 4UWJA 2R7UA 5HOOA 4FCYA 1X4PA 4C2TA 3OYAA 1IXSB 1ULNA 1FAQA 3HUVA 1ZTRA 1UHSA 4AVBA 2MA3A 3WTZA 4JP0A 1VI0A 3U21A 4RB1A 2W4SA 4M6IA 3OYEA 1ACIA 3GZ5A 2JSCA 2BW3B 3M07A 2LOOA 4PSWA 1AMPA 1JGGA 3PQJA 2AFSA 5LHHA 3SJFA 2QYOA 1ETXA 1UCRA 2Q4ZA 2IQ6A 5KK1A 2Q43A 2D4PA 4XN0A 1FP2A 3WTUC 1W0UA 2VXZA 2LR8A 1TBRR 2FMLA 4EM2A 3QB8A 2KPMA 4Y33A 4EJWA 5GAEJ 1UHAA 1Q7LA 1CSOI 1YTYA 1SGQI 3VDXA 2RIJA 4UEEA 1QPIA 4MCPA 4P4FA 1M4GA 4Y49C 1LDKB 2TRTA 3LA7A 1OCTC 1FEXA 2FE7A 2PSWA 3WABA 4G6QA 4JX4A 2FNPA 4Q47A 1SC7A 3F8KA 1GHCA 2B8TA 4YFJA 5A28A 2A61A 2KDOA 2ZSHB 3BQZA 4CPAA 5HS8A 2G7HA 1ETKA 2HKXA 3D5SC 3C2GA 3CQZJ 4J00A 4KLVA 2DXQA 2XPWA 2CUFA 1TWFJ 2FIWA 3KP6A 1OCPA 3KYCB 3SEZA 4D0PA 2DMPA 3I58A 3RIRA 5KAFC 5E3OA 3UFFA 2ISYA 3BJ7A 2ICWG 1TNSA 3CXPA 3SJEA 2K86A 1K4SA 1EE3P 2BHYA 3A1YA 3FHNA 3K70D 2ZW7A 4LITA 2DOAA 3TX8A 3IWFA 4C2MJ 3SJXA 1MNMC 5IYCJ 3TBIA 4HLYA 2JJ7A 4BQNA 4C7HA 1ZH5A 4MFLA 1XC5A 4P96A 1FIPA 4JYKA 3CMEI 1P2FA 3WTXC 1X1DA 1A2ZA 5AG7A 1SFOJ 2PC1A 2E5ZA 4NGTA 1U5TA 2WB1N 3DKYA 3GTKJ 4IRIA 2FX0A 1LEAA 3WC7A 2HQRA 4RS8A 3FX3A 5H6RA 4FX4A 4BXXJ 2JW6A 4DBRA 2VRWB 4EATA 2AJ6A 3TOBA 2P8TA 1B9MA 4A12A 3GBGA 1QZEA 1AKHB 2GBYA 2PE3A 4RS2A 3D7DA 3U9GA 2O7OA 3LWFA 5ILSA 3OOPA 3WU2C 3JAMZ 2A5WA 3H36A 4MFPA 4R3LA 3S3OA 2WGCA 1WJEA 2QSFX 3MZHA 2FL4A 3DU6A 4DNCA 1W0TA 1TWGJ 3CCRI 3CC4I 1S29A 3MMYB 3HOUJ 2JYYA 2MH9A 2EZLA 3N97A 2QZ8A 1V1HA 1CGPA 3AFHA 5FO5A 3PZJA 5B1BH 4F93B 3OV8A 3DKWA 1POGA 3RSNA 4F6AA 2VPLA 4A3IJ 2V8GA 4DZJA 3EFAA 1LFBA 2JA5J 2JT1A 2OF7A 4BQQA 3P2HA 1FLIA 2Y31A 1ZG9A 3A9LA 4N4OB 1WWZA 3N7ZA 3PB4X 2NNNA 3BPXA 3MEXA 4XPDB 1R71A 3J81K 5CNPA 4I99C 5EF6A 3K4KA 5IP9J 2OTJI 1CGJI 4XPKA 1JUMA 2ZXWH 4UUVA 1R3NA 1WI3A 4KMFA 2DMQA 2VT2A 3UGLA 5K8OA 2Q7SA 3GO5A 1H9TA 4CGZA 1QVUA 3PFYA 1YOVB 5JI6A 4Y4RA 1U9OA 3L9FA 2Z2SB 4BY7J 2LK2A 2Y30A 3KCCA 1T6SA 3BLNA 1KU2A 3FMCA 5IV0A 5D5UB 1MH3A 4OAYA 1YW4A 3CO7C 3JRDA 2O28A 2L01A 1MBGA 2ODDA 2CQXA 2WB1A 4GYGA 1YG2A 1ZAOA 4RGXA 2PJRA 3JREA 3N4MA 1ZR4A 4X1EA 4PV6A 2DA7A 4BY1J 5LD2C 4E4HA 1K6YA 4KOWA 4JZ0A 1TKHA 1OCCH 2DMNA 3CUQC 3ESWB 2O03A 1LPQA 2X6YA 4B09A 3ZR8X 2OC6A 4Q38A 2R7OA 1Z3XA 2CTCA 3K4CA 2LH9A 3ZMTA 1K4JA 5JGFA 3S2WA 1RXTA 2HPIA 1RPWA 3NE8A 4ESFA 5JM6A 4PFPA 4KDPA 2O8XA 2FSRA 3FBIB 1ELMP 1W5SA 1Z1DA 3RQ4A 2IGMA 2GLOA 2IS4A 5JLXA 4FTHA 2G3TA 4F0YA 1YLEA 2V7FA 3FMRA 1VQ6I 2BVLA 3CDIA 1F43A 1ZHFA 3ROUA 2DO7A 5L3GA 7WGAA 3KKWA 2COMA 1HDDC 1SFEA 3L2RA 3RI4A 3BJ8A 5LEJA 4ORFA 2LF7A 2X0LA 2C27A 2ZEOA 2ANPA 1YMEA 2E73A 3QAYA 2W1OA 2DOEA 1BJZA 2IA0A 5JVGF 1SQHA 1QSNA 3DBHB 3QRFF 3U1DA 1JHFA 3SJGA 1TZLA 1MMNA 4A69C 1LNWA 1V54H 1WH5A 4B6DA 2B5GB 4AUXA 1WCMJ 2B5GA 4M3EA 4CYQA 4P9FA 1ULYA 1T0FA 4JQFA 4MEYF 1I6HJ 4XOTA 1BUSA 3S6KA 2G7UA 3B73A 3H5AA 4XKVA 5JR3A 1HDLA 3G71I 1Y0NA 3OYMA 2EBJA 2QSHX 2HDCA 3DR8A 1G3TA 4F0XA 2HQ5A 2XASA 5CVRA 4R3KA 4PXDA 3A0HC 4KA4A 3J80K 3EUKL 3GUDA 2J9RA 4NGSA 1W7PD 9ANTA 5EMIA 1LANA 5G20A 3CUOA 2DXIA 2O61A 1ONVA 1MJ9A 4S05A 1HDQA 4C2UA 2D45A 2ATRA 2RC4A 1JI8A 2PJ0A 1UWYA 3E2IA 1ZYRF 1TT0A 1ERDA 2J8RA 5KCMA 4PCQA 1GVDA 1RFHA 1BC8C 3SDGA 2DA5A 3Q0WA 2BEOA 4BU2A 4KVOE 1CE3A 1IY7A 1BM9A 2GLJA 2OA4A 1EH6A 4HAMA 1K79A 2NU1I 2QSGX 4EVIA 3ABLH 1PYVA 1OPCA 4GGGA 3E6MA 2AXTC 3F0CA 4RA2A 3JSOA 2O53A 3HC7A 1JJ8C 1R00A 2CO5A 4HNVA 3LODA 2WV0A 2YX4A 3HTUA 1UUCA 3DEWA 4IHYA 2W57A 4NC6A 3JRAA 4IRGA 2DJIA 4UFXA 3VWDA 3K7AJ 1WJDA 1LQ1A 4G1PA 4PQAA 1LVAA 1QGPA 1Z6TA 3H92A 3C1DA 4XIDA 1YVOA 1XD7A 3EXNA 1BI0A 4BDZA 4LMYA 2CH0A 1LUJB 1BIAA 1ON0A 3OL0A 4OLLA 2KHMA 4MFQA 2MBFA 1ENHA 3BG9A 4WXDA 3SI1A 3GW2A 2HEOA 1YX0A 2FEZA 2ORVA 2A4NA 4YIFA 3FISA 4L18B 4UCNA 3DSBA 2K9SA 3S9LA 1MBFA 2JDCA 3DFGA 4ZYHA 2QA4I 1OCRH 2EFWA 2VQLA 3NWSA 3H9JA 2GVIA 1SAUA 4M6XA 4ZDOA 4NDLA 2N17A 1B87A 3RKWA 3KLNA 2H09A 4XM3A 1G3YA 1X1AA 4M3GA 2M7AA 1P9GA 2COBA 3HOVJ 2HI3A 5HVQC 5EDNA 3I1UA 5LRRA 4GDFA 3TDUC 2REEA 1PVEA 2BUSA 1Y56A 2XAUA 2P7CB 3LSJA 1PCAA 3R5DA 5DCMB 1T39A 3CZXA 3PGPA 2HTJA 4NQWA 4A2ZA 1R49A 3FXJA 4QTRA 4UVCA 4MFDA 2R7VA 2HOTA 1OMUA 2BSWA 3CCEI 4MY0A 4E0AA 3R61A 2HFHA 1X1CA 3F8BA 2HXOA 2ORWA 3VDPA 2DFHA 4BXFA 2B0LA 1X3UA 2DFIA 3LSPA 2L7ZA 3FXMA 1CX8A 3TT2A 3KHZA 1K7UA 1B59A 3LSGA 1F9NA 3BTCA 2V9VA 1AU7A 3B3TA 2ZO4A 1L0OC 3OY9A 5F6FA 4P4IA 3LFKA 4F7ZA 2JZMA 5FKKA 1Z67A 2DEAA 1S72I 2QBYA 2KIFA 3GTLJ 2KZGA 2A6TA 2KMUA 2Z9OA 4W1UA 3J7ZI 4Q36A 5DWMA 1KA8A 3K4JA 4I6ZA 1YIJI 3WTTC 1YR0A 2MABA 3ZCOA 1JT0A 1B4AA 1BW6A 4AIDA 4NEXA 2EFPA 2K40A 2M1BA 3BR6A 4UXNA 3A03A 3UEJA 2WYRA 4HV6A 4A6EA 3BHXA 1H9GA 2DFEA 1SD4A 1R36A 3RKXA 2Q51A 2LLKA 2SGDI 4U0WA 3MKLA 2CXAA 2DOFA 1S5KA 4KORA 2KIMA 2HUZA 4HF0A 4CGLA 3SGBI 2ZNZA 3ISZA 2LVSA 4QBJA 3WTSC 3PFEA 3TDZC 4AU7A 3FDYA 3V42A 2CF4A 4MLOA 2R7DA 1H8AC 3R4KA 3F6OA 3ECOA 4HX7A 4F3QA 2FD5A 1CF7A 3FIXA 2R7QA 3G3SA 3D7FA 3RZAA 1Z91A 3L2NA 3I59B 4OC1A 3PO3J 1JKOC 1R4MB 2GKTI 1ON1A 2NAZA 4IJAA 4P4BA 5K5QA 1Z6RA 4WWCA 5IT9K 1CHOI 4NGPA 4P4DA 2RVCA 1WWXA 4M3DA 1MDMA 3FM3A 2Z16A 3B35A 1Z2LA 1W1WE 2VKHA 1AA7A 3MN8A 4Y49B 3RPQA 4MHNA 1XN7A 2OVOA 2DCEA 2XEFA 3VODA 1A6QA 5KHDA 4AG9A 2J8NA 3VSKA 4FHTA 2JWTA 3S15J 5F04A 1X12A 2ESNA 3W2WA 3UKGA 2AFXA 3EC4A 3K9UA 5IY5H 4LUAA 3RCOA 3TW6A 3ZZIA 3PDNA 2BXYA 4IHTA 4AIHA 3FSYA 5H84A 3S3MA 1B72A 3TOAA 2PJ4A 1E0EA 1J09A 2QUFA 3GUXA 3ZP5A 4P10A 3W6JB 9WGAA 3QNVA 3VYTB 3JTKA 3LOCA 2V4JC 1ZO0A 2NU4I 1XMBA 4ZH4F 3VSLA 2Y69H 1EH7A 4OMYA 2NVXJ 4XNFA 2H5MA 2PIZA 1DPUA 4E7SA 1WKMA 5AONA 5ELYA 3I3LA 1BI1A 3DCFA 2AS5F 3IWWA 1XDUA 2ZENA 1TW2A 4LLGF 3BTLA 2QM3A 4LOCA 4P1WA 5GP9A 3RJPA 1ZLJA 4HLXA 4PK3A 2J5OA 2W25A 1VQ7I 3NE7A 4UV9A 1XMAA 2HYGD 3NWTA 4L89A 4JD6A 3PQKA 3C26A 4RLFA 2W85A 1TURA 1DE4C 1XFOA 1WRJA 3HSRA 2L7XA 4JJXA 1FMWA 3K2ZA 2X85A 1J7KA 2MGQA 3K1NA 4LLLA 3S17J 5DWNA 3QQAA 3QPLA 5H2FC 2R7ZJ 2VKEA 1HC8A 2K9MA 4CCJA 2ZEMA 3K4MA 2ZJRF 3SFZA 4RMNA 2D4OA 5EEHA 2ME0A 4HZFA 4WCGA 2V8DA 5ICFA 4YWYA 4B13A 3BXMA 4I49A 3KP7A 2Q44A 2IBDA 2F5FA 3CC2I 1I12A 3LSHA 5D4RA 2IW5A 3E0KA 1K6OA 3K4LA 2XAJA 3PSFA 4IHWA 1Y0UA 3AG3H 2GZWA 4LG0A 4LG0B 2OD1A 3W2AA 1YLOA 2MSYA 2AQFA 5FKLA 3F22A 3WGHA 3HSEA 3ASOH 4I76A 1PJRA 4K3NA 2L7KA 3SI0A 5CCLA 4U7DA 2QJ8A 3LAJA 3FKJA 3S16J 1OISA 1TXRA 2K5TA 3NA6A 2X3TA 2WAFA 2RFHA 2KMQA 3ZQ7A 3SGQI 4JXRA 4GXOA 1UG0A 1U9NA 2OBPA 3NARA 3CCSI 1G2HA 1W5CC 3VH9A 5JFRA 1BOBA 4UIAA 3KP3A 4NB5A 2QQEA 3T8WA 4G7ZF 2Z3OA 3RPUA 3RO0A 2SGEI 4MGRA 4NGMA 2QCOA 2R4GA 1OKRA 2FQ3A 2JUCA 2QQ0A 1W7PA 3CD6I 4X0GA 3J7AO 4WJBA 3BCAA 4QSHA 5JLWA 2J9AA 5F47A 1RNLA 1HDPA 3S3NA 1HW2A 1PYTB 5K7FA 2EWBA 1LB2A 1XSVA 4XLHA 2EQRA 1Z8WA 2HTSA 2D5VA 2CWGA 2F5DA 3G1LA 4IRHA 4RGSA 2NOGA 4UB8C 2VI6A 4KUAA 5E18F 1S3ZA 3OYJA 3FM5A 4KVME 4M74A 2B4BA 2HKOA 1GV2A 2PMUA 1NTCA 5IT3A 5BPIA 4ZX8A 1F1ZA 4HOBA 4RAYA 5J3LA 2POKA 1NSAA 4ONUA 3ZMVA 3PFOA 4ZJZA 2VPRA 4B3XA 1N25A 4OIRF 1ZR2A 1X19A 1VKCA 3ECHA 2HVSA 1XTAA 5LHGA 1ZK8A 3NQOA 1AHDP 5M5YJ 2MW8A 3S8PA 2AHQA 5M5WJ 3DF8A 4XLCA 4GFBA 2IPQX 3GTMJ 4X5KA 4KNYA 5EX0A 1Z4RA 5HODA 4A30A 2RGVA 3EYYA 1UFHA 5B3SH 3L1PA 1ODDA 2AQEA 4HNYB 1FMVA 3BZKA 4XLNF 4KOUA 3R6SA 3F6VA 2WSAA 5HDNA 3ZRGA 2JZYA 1HPTA 2ZEDA 1YIOA 5DD4A 1K61A 5FKNA 5E3RA 3WG9A 5JHWC 1TQIA 3OYLA 4WP4A 1G59A 3AL0B 3OYCA 4P45A 5HVGA 4LK1F 2DU9A 4CO8A 2ZJQF 2JA1A 5LYDA 2P6GA 5LRKA 1U6MA 4ZI6A 4L9VA 1Q9BA 3RZDJ 1QSTA 2XB0X 4PFOA 2WWYA 2O9LA 3M8JA 2EV5A 4LIUA 2F7VA 3OXGA 2WAQN 2IS6A 3HOYJ 2QMLA 4FD5A 4KIBA 3HYIA 3GTGJ 1GYTA 4N4NB 4MBUA 1JE8A 1SGPI 4J3GA 1QPMA 3H5NA 4KICA 1TC3C 3QP6A 2SGPI 1AYEA 2EFNA 3V4GA 2CIJA 2Q4YA 4RN7A 2F48A 2E35A 1X58A 2IAIA 4BQAA 3IGRA 4A32A 1Z21A 3BG3A 3OWTA 4L5IA 3IWZA 3TW7A 4JCVE 2PJ6A 5BQTA 1ZLHA 2XVCA 2K9LA 4XLPF 4KUBA 4CCLA 4KJZA 2IL4A 1K78A 4ZX9A 2F6CA 5AIQA 3GTOJ 3CC7I 3R5AA 1IUFA 3QYFA 1QQIA 3QYEA 1IV6A 3JCUC 1RESA 5BMZA 2P6FA 3EUAA 5F0FA 4E8OA 2RDPA 2RQPA 4IVNA 4PXEA 5FFZA 3S1QJ 4MRIA 2QENA 5ICCA 4NJQA 4O3MA 2WVJA 2A05A 3LSIA 1HOMA 4MPIA 5G1ZA 1TBXA 2EFOA 2HDDA 3HEFA 2W00A 1IIDA 1SEUA 1G8XA 4DJAA 4O6JA 5J8CA 3HH2C 2Z3PA 1W36D 2GXAA 4CS0B 2K4BA 4RUHA 1Z7LA 4XLEA 4BUPA 1HDUA 5BPDA 3QTLD 2PFBA 1DGRM 2XHKA 6PAXA 3GEZA 1BMOA 5L3CA 4ZZLA 4AIKA 4G7OF 1OZPA 4OADA 2P81A 3KYLA 3F3XA 1WGCA 2EJRA 2ZXIA 1FYMA 4XKBA 3DPLC 2E7XA 4AMLA 4Z65A 1JKQC 3GLJA 3WR7A 4L9JA 3V7CA 3LWUA 3C2BA 5K7ZA 4C2XA 3TEDA 4FQGA 4PJMA 2V1XA 2IJLA 3HPGA 3PNYA 3QU6A 3OYDA 3EPZA 4CA0A 4OIOF 1XBUA 2STWA 2PJAA 3KQZA 5CBMA 3LACA 1RUOA 1OQYA 3COAC 1LR7A 1GVJA 5D5WB 2X7BA 1BI2A 1NG6A 3DBLB 2J5PA 1FOYA 5D6EA 3H0DA 1N13A 4F92B 4RB2C 3CJQB 1TGSI 3G8WA 4A3LJ 3F5BA 2DA3A 4OP4A 3EDPA 1WHUA 3VFZA 4XRFA 1Q1HA 2Z5UA 4OIWA 1V55H 5IP6A 2K9HA 1KUXA 2CNMA 1VHOA 8CPAA 3ZPLA 2PJ2A 3K2KA 4TWEA 3PNVA 3BWGA 2SGQI 4KYWA 3MD2A 2QQBA 1CT0I 1UVFA 5EZGA 5HLGA 4UXHA 2QIRA 1JGSA 3BG6A 2VBWA 2R3SA 3FIWA 3TP0A 1H0ZA 4U0YA 3VYSB 4CCKA 3HOZJ 1KQ8A 1UFMA 4ITVA 2X9DA 1ZG8A 4RM3A 2R5YB 5LYIA 2A5YB 5FUWA 1P4AA 1SMYF 2CUEA 3KZIC 3CCQI 5FLVA 1J9IA 2YX7A 2R7XA 1I21A 3UOEA 2LP0A 2Q1ZB 3FXRA 1FARA 2DPTA 4AG7A 3CXSA 2KRFA 2R7RA 4IKFA 3AG2H 1BIBA 1VIXA 3D3SA 4M9XA 3FX6A 2M30A 5EJCA 2ZMEA 4BE0A 3FF3A 5E1XA 3GF2A 3MGDA 4PJ0C 5J1YA 4UY8I 2ADUA 5E1ZB 3D5RC 3N5FA 2DJNA 4KS9A 1H89C 2DA2A 1MJAA 1IN6A 5GPAA 4FISA 4C3JJ 1VQ4I 1OVOA 4G8XA 4MNUA 4MEXF 1PUEE 2CRGA 1KONA 1DU6A 2V9KA 3D7GA 4XPLA 2RNJA 1Y6IA 5FVJA 4FUUA 5DYMA 3OSGA 4IOCF 4MHZA 3F8MA 2KDZA 5FLMJ 1M4IA 1SVLA 4BHCA 5DUKA 4B10A 3DV8A 3OIQA 1T38A 2CV1A 2VL8A 1T2KA 2Q04A 2RNGA 2HOAA 4OC0A 3E5UA 2E7WA 4XKCA 4WXCA 1KYZA 2IRFG 4QB9A 1I27A 3I71A 2P5LC 1TWHJ 3RQIA 3MQ0A 2VODA 3IC1A 1KMAA 5CVJA 2DA6A 4UA3A 2VXDA 2H6CA 3GTQJ 3PUFA 3BC8A 2RKHA 2X52A 3K10A 5LGNA 1Y39A 2JPCA 1PTQA 1D5VA 2FUG2 2MD5A 5DTDA 1O4XA 3PUBA 2EA2A 3PBBA 2FIAA 2CW8A 3UGDA 2NXNB 2V77A 4IAVA 4R8FA 1S7AA 5CQGA 3GMEA 1VQPI 2A6EF 3OYGA 2HOSA 3RZOJ 1J59A 1XX6A 1QRYA 3KR5A 4TNUA 4MFEA 4QWQA 3S2DJ 3FVLA 1H8LA 3IU2A 2IVMA 1M44A 2YR2A 1W36C 1U8BA 4C9YA 2G0BA 2X1EA 2DTRA 3QPSA 2JPBA 3S6FA 1SVMA 2Y0SA 3PRTA 3GB0A 1BL0A 2QEXI 4K30A 4R87A 1MSEC 3VPRA 4UF4A 5H20A 4B3AA 1MW7A 5HNFA 1BR4A 3GFJA 1DUXC 2PJCA 2FVGA 2H8WA 4FBEA 1U2WA 2BW3A 2HNHA 1VQKI 2ZMEB 4DJLA 5EC4A 3T8RA 4GI3C 2PJ5A 4L5EA 3W3CA 1O7LA 3TGNA 1WVRA 3D5LA 4MHPA 2K02A 1YW7A 4M6YA 3LA2A 4XSZF 3TE4A 2QKMB 2ZEEA 3W6SA 4YEJA 1W3SA 1BPNA 4CYDA 2ZFUA 1ZRCA 4JYWA 4R9MA 4XRSA 1NMTA 4L0YB 3ZGKA 5GAHJ 4BINA 1O3SA 1R0RI 3T90A 1PP8F 2ABZA 2M8GX 3K4BA 3DDDA 3RTRA 1NSLA 5DM7F 3HXLA 3WG7H 5EG0B 2DF5A 3BR5A 2ME6A 1ITYA 5IX3A 3M9AA 5E96A 2MG4A 3HBLA 1SD7A 1K78B 1AKHA 2PR1A 3IJ3A 2HXIA 5A2QK 3UNGC 5F48A 1FYLA 2KRHA 1NHAA 1PUFA 3DXJF 4YU9A 4DQ2A 2LY1A 2A6HF 1XMTA 1RRJA 3Q0UA 3SI2A 1X74A 2JBJA 1GXQA 4LFUA 4PJNA 4CGPA 1R22A 3DP7A 2LKSA 3IRRA 4A3EJ 4EV0A 2M4KA 2VLAA 5I4MA 1KU3A 2JA2A 3TP3A 2Q0YA 5C82A 1VQ9I 5F1JA 2NVUB 4A37A 1CPSA 2G0EA 2BVMA 2L4AA 3FC3A 4A38A 2PRQA 1ELLP 4A3DJ 3MCZA 5THWA 1IN5A 2R7TA 2QLZA 3FXUA 1TKJA 2EILH 2EPFA 2ZEPA 4A0XA 3FMSA 3MKYB 2V1NA 4FD6A 2WPXA 3QYBA 5D8LB 3IV5A 3CDXA 1E2XA 4OMZA 2GOXB 5CJ9A 1SD6A 2ZXHA 4UXIA 4E7KA 4X2TA 3CP8A 1HKTA 4CCMA 1Z5RA 2CY2A 1BBYA 4UVBA 4XORA 4E1PA 2H1LA 3R0JA 4Y17A 2YU3A 1ETQA 1KBEA 2GKVA 2IA1A 4OVOA 3E7LA 3ZOBA 3CO6C 2KMOA 1Z8TA 5IP7J 2CYYA 3IH4A 1DDNA 3CCJI 3KEQA 3PO2J 1LR8A 1WJBA 1A31A 4LQGA 2VBZA 3S9NA 4E6KG 2VZZA 2Y9YA 5HLIA 2DIPA 3I0TA 2DPDA 4UUSB 4F8ZA 1BA5A 4UFVA 3R96A 1C0WA 5DEQA 4E7LA 2UV1A 1Y8QB 3KQXA 4WWVA 3ULQB 3KX2A 1O3TA 3MWMA 2QECA 3W91A 3G3ZA 5K8PA 3CJRB 3ABKH 4F55A 2NYXA 1ZREA 3RBUA 4EJUA 2R1IA 1Q1VA 4F9VA 2N71A 2IGKA 2Q0OA 4HEA2 2PI0A 2DB6A 4XSXF 2VJ4A 1CT4I 2PQ8A 2BHZA 2VT3A 4J19A 3IWGA 2CUJA 4BMHA 3BOQA 3KETA 3DGVA 2B3VA 3OS1A 2KKOA 2V1UA 1S5LC 4NF1A 2XAFA 4HYEA 2R7SA 3OVOA 3CZ6A 3KYDB 4IOAF 3TCVA 2E1OA 3I56I 1D0XA 2TCTA 1ZRDA 3F9KA 3GTJJ 2XF6A 4V2GA 4KISA 3DKXA 2GREA 3A4CA 3SYTA 4KSFA 5CPRB 2M5XA 5FD5A 5KTAA 3R95A 3H8EA 4L8AA 4DYOA 1SGRI 2B58A 1IZ1A 3VARA 2FF4A 5F27A 3V7RA 1W7PB 1ETVA 1XGSA 5FD6A 4AIJA 3D2PA 1Z7KB 4UV8A 2VONA 3IL2A 1Q2CA 5HVFA 4FE4A 2LREA 3IP4B 2LG4A 3BQYA 4PUSA 1YYVA 5H6QA 3DU5A 4NGRA 3WHCA 2Q8KA 4IX7A 3P5JA 3PIPF 1YITI 3OYIA 1P4NA 2VL1A 5CVIA 5L3FA 1BR2A 4Q5SF 5E8GA 1TTYA 4YFXF 1B72B 1CT2I 1XBTA 4DBQA 5LYLA 4HDUA 1EV7A 1K4TA 4CGNA 1P9QC 1K83J 3K1PA 4C3HJ 4HRIA 2XEJA 1FBUA 2OTLI 1QZZA 3SEKC 3KLOA 5D6FA 1IY5A 3V38A 3ISPA 4MY3A 5IB9A 2FBHA 2XROA 2LKPA 5KTDA 1PJUA 3S2HJ 1TWCJ 5J1UA 4OC2A 2A69F 5LBQA 2C6GA 1U6GA 3TC8A 4LB5A 1EKEA 2UWMA 1Y0YA 4IO9F 4D5CA 2QQ8A 2G9WA 4IF5A 2PR8A 4A0YA 2IEKA 1JT6A 2ZEGA 2PJRB 3PEIA 3C2HA 3SZPA 4QUSA 3QWPA 4CAXA 2IT0A 4KSIA 1GLNA 3W6XA 4RAFA 2CWFA 1TIQA 3KP4A 5AIPA 2KJBA 2XAGA 2R92J 2CW0F 2WC2A 1PCEA 3K70C 5ED4A 1P6RA 3B3CA 4RAZA 3B02A 3IKVA 2XGXA 4NC7A 2P4WA 1LRZA 2HS5A 2NU0I 3DEEA 2DQRA 3OMYA 1XEBA 5ICGA 2PJBA 1OBRA 1XGOA 2K27A 4XL9A 5HH1A 2YS9A 5BOXA 1MGTA 2HYFA 1MBJA 3HKZA 1BOAA 2F4MB 3OOUA 5FFXA 2F5IA 4MMOA 1UMQA 4EGZA 2E2HJ 3BJOA 4CYCA 1CP7A 2WA0A 5E3QA 2E1CA 1WZ2A 1Z4EA 1FP1D 4HSTA 1CGII 2F5EA 4XLFA 4IPAA 3KP2A 1STZA 2QVOA 2UXXA 3D67A 4MFJA 2EZKA 1HCRA 4TV7A 1LE8B 4K2EA 3KIOA 2BV6A 3W2VA 2HR3A 3ABTA 2PVVA 4BH9A 5HVHA 2FBKA 3RAMA 1I1SA 1ZARA 3A02A 3D0SA 4B4CA 5E8IA 1B8IB 1X2MA 3H0GJ 2HWVA 2M9HA 3NH5A 4HSRA 2KIQA 4LD5A 1LKXA 3V8KA 4QLCU 1J75A 3JRBA 3OXFA 1TKFA 1YHQI 1PDNC 3BY6A 4XONA 4CUGA 1OYIA 4IK2A 2L9NA 1N77A 1S7OA 1RETA 5CVVA 2BY2A 1S7NA 2BGCA 4A0ZA 2RN7A 4HX8A 3TMOA 1GT0C 3JW4A 2I10A 1KWMA 3T9YA 2IS1A 4PXCA 1LFUP 2FS5A 4WK8F 2DA4A 3OIOA 4N0BA 1J0RA 2ZXJA 1SFXA 5EGOB 2Z3KA 5LFAA 1SD5A 4CAWA 2LDUA 4KFCA 2R7FA 4UB6C 3IFEA 4U88A 3NFZA 2M45A 5DV5A 4PK2A 4OWRB 1HBXG 2JBKA 3B8GA 1WKXA 4L9MA 2ENZA 4D1QA 4JX6A 4M3SA 1OMIA 2NVYJ 3KEOA 5LGUA 1JWQA 4E1RA 4CGMA 3E5XA 4CYOA 4F9UA 1NH3A 2K85A 2C6CA 2VOPA 1ZLIA 1MK4A 3FJUA 3W6VA 2UXNA 5G21A 4ZDLA 5J6XA 3M7GA 4HA8A 3S1MJ 4ZTJA 4B14A 3ABMH 4P5OA 4E7ZA 2JEWA 1MD0A 3G1OA 2DW4A 2ODFA 2HB6A 2F5VA 4BJ5C 3FECA 3EUHC 3RKYA 1M4LA 3D7HA 1TQPA 1RUNA 2HZDA 3WC6A 2V26A 4P6YA 5K8NA 4IL6C 4ON0A 4JOMA 3B3WA 3LA3A 2CQQA 5DCFA 4FWUA 3I4PA 2BO9A 3BG7A 4U5YA 3JRUA 4KSAA 2JSPA 2LNBA 2OQRA 4LJZF 5JQ4A 2LUYA 2KCXA 3MRUA 4ZBGA 3BPVA 1E3OC 1UAAA 4ASNA 2BYVE 3D2MA 2EUIA 3BG5A 3KR4A 4PJJA 2ENNA 1Y9WA 4AB7A 4X3RA 5TRDA 2XUBA 2FOKA 2WAQA 3HZJA 3MAJA 3RYRA 4A5NA 2HPMA 2MYSA 4CDGA 2O4HA 2PRBA 1IB1E 2A3SA 2OZ6A 1LFWA 3V7ZA 1JXSA 2LC2A 3LQQA 2Z3MA 4EMSA 2Z11A 4MFKA 2FJ1A 1FPQA 1TNTA 1YW9A 4XNHB 2JEVA 2N1AB 1XX5A 3ONQA 4C2YA 3FBNB 3S6GA 1B1BA 4NBQA 5J47A 4CHUA 3HOWJ 2R93J 1X4SA 4KN7X 4G7HF 3LL7A 2V6EA 1IDYA 1IDZA 4I2OA 2M5WA 4XMYA 1IRZA 1ETOA 4B5PA 1YREA 4XRSG 2OPTA 2W84A 3K4NA 5HLTA 2BY3A 3D66A 1CG2A 2GIVA 3I54A 1YVKA 2JA7J 4XRMA 5E79C 5ILVA 2VQGA 1Y0RA 5FLXZ 1A04A 1IXRC 1FX7A 1ETWA 3JTGA 3E6DA 1XRYA 2FMYA 2Y48A 3DLLF 5K1YA 3CT9A 2E5RA 2B4DB 3FRMA 4BBRJ 4M6VA 1AUGA 2PEXA 1X4OA 1CQTA 3GOXA 1F4KA 2JVGA 1T56A 2VJ5A 2X6XA 4JBAA 4YRHA 2OZUA 4A33A 2HU9A 5FRNA 4EVYA 1R6RA 2ID3A 1D1BA 4IEJA 4KOXA 4HQEA 4PK4A 5HDKA 3OL3A 2P6AC 3BROA 1G3WA 5M5XJ 2VE9A 1ZG5A 5EBVA 3RYOA 3S14J 3L00A 4U0VA 1P7JA 3OYKA 3B6AA 7CPAA 1XPXA 2JRTA 4ENNA 1SGEI 2CJJA 1YQEA 1J2XA 4MCRA 1A6IA 3ZQIA 3O8GA 2NS0A 4PJLA 2M87A 2I00A 3A01B 3JUWA 4EQQA 4EJTA 3H3VK 3TKYA 1B8IA 1IV8A 1OJLA 2LYCA 4ZY0A 1ZRFA 4B5OA 1ZKGA 1M8BA 2OOTA 3WT4A 1O3RA 1VQ8I 3OXLA 4CAVA 2WV1A 3BCBA 1A36A 2ZXVA 4KIFA 4B1RA 1WQ2A 2CU7A 1YTPA 4HPSA 4ZYQA 2ECCA 3HSFA 5GPCA 1TL8A 3FYNA 2Z1DA 3GZNB 4N9HA 2TDXA 5LRJA 2CUZA 4NC8A 5J4YA 5AG4A 4MTEA 5M3MJ 3OS0A 1FTTA 3J7YJ 2PCUA 3R0AA 5GCNA 1KYWA 2L4MA 3ZN1A 3GLXA 3KI9A 5C4XJ 3BR2A 2JK3A 1A35A 1SGDI 1FIAA 5AG5A 2HC9A 5FUYA 3IH2A 1Z8XA 3HGGA 4JWPA 1Y1WJ 3FEEA 4RAGA 4DUKA 5J1QA 4PXBA 3ERMA 4M9ZA 4DZPA 2DYRH 3CMYA 4F91B 2J8MA 1T95A 3J7AY 2HYJA 1IJWC 2NOJB 3FXLA 2JN6A 5HLHA 3V7SA 2DK5A 4GCVA 2JXDA 3PB9X 3LSMA 2JDDA 1QMUA 4ZDPA 4R6TA 2QBYB 2Y0MA 2Z0ZA 2BEIA 2BBYA 2XAQA 3ZXSA 5FROA 3BLYA 4UUSA 2E2JJ 2ZEFA 2OCEA 5DUIA 2V1CC 2V53A 4BE2A 1WSUA 2XIGA 5HS7A 4Z2YA 3L7WA 2E2IJ 2EA4A 2EH3A 2IJZA 3JSPA 2KL4A 2ELIA 2M4GA 5L3EA 1U3EM 4PGHA 1HW1A 2ARPF 3MZ8A 3V8IA 1ETYA 3WTYC 3L2QA 4XOPA 3DTIA 4AM3A 4Y52J 2VUMJ 3QODA 4O5VA 4XR6A 3VB2A 2JLMA 2K9NA 1YJNI 1TW3A 2ZJPF 1R57A 2QGUA 4CCOA 5JHFA 2BUEA 2HVQA 3CCYA 2VASA 1IO2A 1SMTA 1G3SA 3O2PE 3QWLA 1XMKA 4NNJA 3V8LA 4A93J 3IIBA 2O0YA 3H9GA 5HNHA 3N05A 2MC3A 4G6TB 3DLAA 4FAIA 2WZNA 4YG2F 3DBRB 1LAPA 5ISVA 3F21A 3HGYA 2EZHA 1LVKA 3E1SA 1DP3A 1SFKA 5CYVA 1R58A 3T1BA 1YO5C 1QVTA 1OYYA 1WK4A 2O8KA 1VQOI 5FB2A 1I1DA 4UUTA 2K4JA 2J87A 4H0EA 1IG7A 4HNUA 1IC8A 2BL1A 2MH2A 5A2QZ 3GZ6A 1WGXA 5CCMA 1LR9A 2R7HA 3OR1C 4R57A 1USSA 4DYCA 1BW5A 2B4DA 5JVTA 3KL9A 1W4RA 2XC7A 1R1UA 4ABZA 1BO4A 1L3LA 1EH8A 1IYKA 1R7JA 4W9YA 4PDKA 2MLKA 1FOKA 1F57A 5EZHA 2M34A 3P9KA 4UBRA 2DLLA 2H94A 1USTA 2E1MB 4EJOA 2ZNYA 2N52A 2NU2I 4EM1A 1F2OA 1VQNI 2XEGA 3SXNA 5ILUA 1PTRA 1HW5A 2P7VB 2XGCA 3Q3SA 3TJQA 3FBUA 1R79A 4HGUA 2A07F 3CDHA 1YRNB 4EMEA 1UG2A 1TBOA 1IW4A 2VN2A 3G2BA 1Y1VJ 1ZELA 3MKWB 2GA2A 2I3CA 3CPXA 3GLLA 4V2FA 4MI4A 4MHYA 2BE5F 3BZ6A 4M73A 2GIZA 3BI1A 3F72A 5JHUA 5EGOA 1EA3A 3MEKA 3GYHX 3I55I 1MBEA 2KT0A 3QU3A 3S93A 4RB0A 3KHXA 2OD5A 3HL2A 1YU6C 2GFQA 2DN0A 4EFDA 4A3MJ 3M1EA 4G94A 2BXZA 3FSXA 1NE9A 2YNCC 4HBLA 3CLOA 3I53A 1PP7U 2EFQA 4BBSJ 3IEHA 2O3FA 1WJAA 5EEAA 4U7BA 1I6XA 2GXGA 4HNTA 3L2WA 4RGUA 1ULKA 3G1MA 1WTJA 4UEFA 3ERED 3D00A 1I3QJ 1YSJA 3F8CA 1EF4A 3OIPA 2FNFX 2E1MC 1KZFA 4LQ6A 2L9RA 1VZ0A 1R23A 3HRSA 1MZBA 3FKIJ 4ZZDA 4A5MA 3HRTA 3T0YA 5FJ8J 4M9SA 1YI2I 3BDDA 4OINF 4OIPF 5GADJ 2CTBA 4PGGA 2EK8A 4CXFA 1ORKA 4ZC3A 2EK9A 1HSTA 1TWAJ 4JXQA 5F09A 1OLTA 2RV8A 4M71A 3AG4H 2XSDC 2VZYA 1M1EB 2CQKA 3S1RJ 3M4OJ 1WJCA 2ZPAA 2KZVA 1U8RA 1SGYI 1JQGA 4PSXA 3SHFA 3JR9A 3BP8A 3E6BA 2KMPA 2EV0A 1Z9UA 3GVAA 4U9ZA 2BCOA 1TBNA 3DQVC 4CYNA 4H89A 4CICA 3OS2A 2WAEA 1GV5A 2ETHA 5GTIC 2L7MP 1U5KA 3IRQA 5A27A 2X6OA 1CPXA 4IUSA 1NK3P 2XRCA 4Y15A 1Q2DA 3FXQA 2XV4S 3H35A 4KITB 2E71A 1IAWA 1Z05A 1APLC 4PPZA 1QU3A 2V1CA 3ZN0A 4SGBI 1QHGA 4M3BA 4G12A 5FKOA 3S1NJ 5E3NA 4BAYA 1LEBA 3F8FA 1KQ0A 4DOZA 3TL4X 2YUUA 2AFMA 1ZG7A 1B6AA 1XGNA 2ZSIB 3CDLA 3SZGA 2HDWA 1FT7A 3HM5A 1TF9A 5F08A 4H2KA 2ZJ2A 1WI9A 4AVPA 4L0ZB 3CCUI 1DP7P 3KPHA 4IHSA 4P9UA 4NFRA 1OYWA 4CZZA 3FHZA 5AG6A 3S9MA 2DA1A 1FY7A 2X4HA 2X51A 3RU0A 2MD0A 3E59A 1GHEA 1MJBA 2V1DA 2WCYA 3JTHA 3B3SA 1O3QA 3IKTA 4YIIA 1E17A 4QVTA 1XCVA 2DFFA 2Y75A 5FGMA 3VEPA 3WHBA 5F0HA 4EGYA 3OSFA 1N75A 1U0JA 4A3JJ 1FZPB 3HLPA 3BR3A 3FXTA 4DYQA 4MQVA 1WH7A 2RREA 2WPWA 5IYDJ 2FXFA 4L9TA 5TISC 5IOZA 4NXYA 2P5VA 3OYBA 5LEKA 3I4NJ 3HPHA 4UVAA 2WY8Q 3CP2A 3M8EA 1NUBA 4NUBA 3LSTA 2ZW6A 4BGDA 4EM0B 2CQ7A 3HOXJ 3PB7X 4KOTA 2CJSC 4XBFA 1FYBA 3SFIA 3QPHA 1U5TC 1TQMA 4J01A 1Y7RA 1LCPA 1MMAA 3FMQA 2X1DA 2FE3A 3AAFA 1PU9A 2VXKA 3RDIA 1Y8RB 4OC4A 2VJIA 2DI3A 2G9DA 1GUUA 1J5YA 2PJPA 4I0BA 2MFZA 2NMTA 4RM2A 4AXVA 2NSMA 3HUGB 1RKTA 5LGTA 1BR1A 1JJ6C 1D8JA 4UCPA 4LB6B 1J4JA 1M8CA 4XNHC 4ESJA 3JRFA 1XSXA 2SGFI 3PSIA 3IC7A 4E7HA 2UVOA 3H5RA 4MJ8A 1IW7F 1FSEA 2RAEA 1LDJA 2IXSA 1VDDA 4CRZB 2NVTJ 2IGOA 2Z10A 4D7MA 2DMTA 1I50J 1R1TA 3O6BB 2DKVA 1KUYA 5JH9A 3ZMZA 4UEZA 2RB7A 2ZC2A 1RR8C 2EIKH 1QHHD 2E36A 5C3EJ 1MMDA 4OIQF 3FXOA 1H88C 1FJLA 1XA6A 2LEOA 4GRIA 4OC5A 3SEQA 2L2OA 5CVUA 4P44A 4JX5A 1FBSA 1D1CA 1T0FC 2JMWA 3NAUA 5IPAA 5E17F 1V1IA 4KVXA 3I3GA 5F0CA 1GXPA 2DDAA 4GS4A 4MCSA 1IOIA 1X1PA 2QKLB 4CZCA 3PBEA 3I59A 1CJWA 1HEEA 3FEDA 2Z33A 2GA1A 4P55A 2LBFB 4A3CJ 4U9YA 1XS9A 5KTCA 1FWZA 2EVNA 1R5GA 1JUSA 2PG4A 2VQCA 1D3YA 2L5QA 1S3JA 5IOYA 2R7WA 4CSWA 3RNZA 4XK4A 1K7TA 3PP9A 4U87A 3HDDA 1S7KA 1I3AA 5DCMA 4AYBA 4Z6YA 1MBHA 3DLJA 2DBBA 1ZN2A 2KRCA 3QOEA 3ZQCA 1DPRA 2EO8A 2ZFWA 4LK0F 1D0ZA 5CKTA 2P6SA 3B6CA 4F52A 4Y7NJ 1QQ9A 3IAS2 2LMDA 3C3WA 1M1DA 4QPOA 1S60A 1V4RA 1L0CA 2ELJA 2EB7A 2X1CA 1TP4A 3TO9A 3VOEA 4MFZA 4MQ9F 4RB3C 2ROWA 5HXDA 1HQCA 2HGCA 4HDVA 4A3FJ 1T33A 2XSJC 5DD8A 2B7EA 4E2AA 3BJAA 3DPTA 4OC3A 1IRFA 2Y0SN 2I8DA 4W97A 2QF7A 4BDYA 4E7JA 3CMMA 4LGWA 1UHMA 2R98A 2ZOFA 2MC4A 5D8KB 2VI7A 3K2AA 4BHPA 1XSDA 4CYPA 3OR2C 1IGNA 1UB9A 4ENMA 3NEUA 2ISZA 1KU9A 5EG0A 1QBJA 2DT7B 4XICA 3GFMA 1DU0A 1S7FA 3W6KB 4M3FA 1HEVA 4MIMA 3JRGA 2L9SA 2CQNA 4YFNF 5LLQA 4C30A 4KLWA 4GXHA 1WJFA 5LHIA 3NH4A 1RI7A 1QO0D 2XRLA 1T08B 2XGEA 3CUQA 1DGWY 3CUQB 5KAIC 2K5CA 5BNGA 2CG4A 2XPVA 3U2RA 2I5UA 5FKMA 2K3PA 2FA5A 4CH7A 1PPFI 4OMEA 2BY0A 4B12A 4MO7A 3KY9A 1P7IA 4R76A 2Z3YA 3DEUA 3E0JB 2C6YA 4QPQA 2QQCA 2W24A 1P92A 2VC1A 4NGQA 1E3PA 3A2KA 1Z0XA 2CWHA 5EYRA 2VKVA 1XOVA 1KZHA 1T8IA 2EWNA 3BI0A 3P9IA 3I64A 1CF7B 2REFA 1R1VA 2Q2EA 2Q2EB 5L3DA 4RDUA 2F4IA 2YUSA 2PLYA 3K6GA 1LFPA 4FX0A 1GDTA 1JKRC 4HG2A 1FNNA 1HA8A 1OYVI 4Q7AA 2FQ4A 1MH4A 4AVZA 5LRSA 1S8NA 2YU9J 4MCQA 2K9QA 4OAEA 3P2FA 4YRVA 4I02A 2O5RA 3EQLF 2O6GE 1VGYA 1S20A 2VBQA 3MKZA 4HX4A 1TOTA 2IA2A 1HJAI 1ARLA 1YGHA 3I5UA 2GU2A 5BWAB 3LFUA 3VATA 3M1CA 2F3CI 2EV6A 3MFKA 1YJ9I 1TF8A 1XCBA 1QSMA 4NCZA 1ZQ3P 2OV7A 2WBMA 2AE6A 3R9FA 2UZ3A 3TQNA 4AYBN 3SHPA 3ZJ0A 4AVCA 1JTXA 1HLVA 3KP5A 4ZTFA 2LSOA 5F1RA 2LBFA 1Q2YA 3L2VA 3LSRA 2G3AA 2BOAA 3H9QA 2GAUA 3IAM2 4CRYB 4A2UA 5BS6A 1KBFA 2YNEA 5J1RA 3G4SI 1V0CA 1IN7A 2I79A 1Z77A 1DQUA 2HOEA 4FT8A 1Y1BA 1MMGA 2YSRA 3R1KA 4BJTA 3WE3A 2OH1A 1Y9KA 4H6ZA 3OWCA 1E3HA 1O57A 2VBXA 4Y13A 1JTYA 1YFHA 2P0WA 2OZGA 4C7IA 5K5RA 1MIJA 3WGIA 4BEHB 1FTZA 1UELB 2B9SA 4D7NA 3BJIA 3LAPA 4B6ZA 2D1HA 2KQRA 5CLSA 1ARMA 2DK8A 3REOA 3T5XA 2Q7BA 1BLLE 2NYQA 2XKOA 2P6TA 2VC0A 4D9JA 2VIXA 5M3FJ 4M6HA 2BZTA 4R1HA 4I98B 3AL0C 1F2PA 2UUZA 2FCKA 5FUVA 2YGWA 4P4JA 4QC6A 4KZTA 3OYFA 3GFLA 3MZYA 2STTA 1BN5A 3QPTA 1MMSA 3PIOF 3RYPA 1YRNA 2WADA 1MNEA 4A31A 2JTVA 3FZVA 3O3KA 2P6EA 2QQDA 5GTHC 5D4SA 3AKZA 2HQYA 2ZOGA 2F8HA 4ZYEA 1V3FA 4ANJA 3BTIA 2F2EA 3IU1A 3F0AA 2E5NA 3MN2A 5C4JJ 4FETA 5F64A 4MTDA 2KMRA 1YW6A 1NK2P 1N71A 5D5VB 5E1WA 3R5CA 2OJED 4G9YA 4BJ6C 2QYVA 2CS3A 2OQGA 4AC0A 4I01A 5DDGA 1Z9CA 3LMSA 2WTEA 1TLHB 2EBIA 4JK1X 3WU0A 3DNSA 4OU0A 2Z3NA 2E34A 3ABUA 3I4MJ 1RTQA 3LD2A 4BYYA 4LX9A 2EINH 1VQ5I 4ZY1A 3TTHA 2W82A 1MNDA 1TT5B 1BAVA 5CPAA 2NRAC 3GY9A 1WJ5A 2DYSH 2CFOA 5D5XB 5IT9Z 2AFWA 2CNTA 2KLOA 2A68F 2JA8J 2GXBA 1VTNC 2XDVA 2Z3LA 1HKQA 4BS9A 3ZQLA 3G6EI 4NSQA 1YQAA 2DQLA 4KOSA 2FT0A 1VHEA 4MHGA 1MBKA 1EJ9A 2V6CA 3JVNA 2LB7A 4NHJA 3CJTB 2XKPA 1YX3A 3BT9A 5KVRA 3FK6A 4UIBA 2PIYA 2DMUA 2CWEA 2Y9ZA 2Z99A 3VDUA 1S6LA 2N8GA 3X2QH 5IB0A 3B2YA 3HB9A 4A24A 2ID6A 2PJ8A 2FU4A 2XF7A 4KT6A 5J40A 1YS6A 4S0HB 4A3KJ 4N9IA 2LF8A 2Y2ZA 1VQLI 1LJ9A 2BY1A 1Y8FA 3E3VA 2QPOA 3UEYA 3GYAA 2NS7A 4CCNA 2HZTA 2IGNA 4LIVA 4RI1A 2NVQJ 4BE1A 4KIGA 4P4EA 2XPUA 4GYIA 4UNOA 4R7MA 2LD5A 1WPKA 2L7FP 1JHHA 1WGTA 5FLXK 1P4XA 2CW7A 2A20A 3KE2A 5DAEA 3H8GA 4CGOA 3J80Z 2F4OB 4H4KC 3CXLA 2KCWA 2B63J 4YGOA 3A0BC 1B6BA 4DW6A 5CQEA 3GX4X 1IICA 1O7FA 2Q4VA 4R79A 4BBHA 3H1CA 3GWZA 3ISXA 2DT5A 5K8MA 1YX5A 2EIMH 5B66C 3SQNA 2AFUA 2V8HA 2KIUA 1QNTA 3S32A 3WU1B 3Q0VA 3CCMI 3P7NA 1K7AA 1N78A 3U1KA 2YNDA 3MVPA 1IYLA 3I9SA 3E5QA 5F49A 2X48A 1ULMA 3D8PA 4KUMA 2VEZA 4O23A 3B4VC 2E60A 4GO1A 1W4MA 2OU2A 2GWRA 4HV5A 2PVWA 3F8NA 1ZGWA 3K1MA 2AXLA 4ENJA 1T98A 2H8RA 2ZMEC 4I7HA 3R9GA 1IN8A 1IUYA 1AWCA 4IXAA 3SJMA 2AFZA 2RQQA 2FSWA 4B43A 3FK7A 3B7IA 3BJ6A 4HNWB 1HSJA 5EEGA 3D1NI 1Z3YA 2ELKA 2V79A 2PBIA 2L9VA 3FXKA 3PJRA 1R9TJ 3VYRB 3IWEA 3NH8A 4HW0A 1CP6A 1HXDA 3FWEA 4FE7A 3CESA 4B47A 1OR7C 1FYKA 5HQ8A 3CXQA 5D8NA 2D1VA 4AD9A 4ONWA 1FT9A 4FD4A 2K7LA 4R8HA 3GKRA 3SDBA 1XMXA 3B3VA 2B3UA 3HOTA 1UZCA 4RGRA 1RR7A 1P9ZA 3BR1A 4IZZA 1U5TB 2M0MA 4PZJA 1KU7A 3HOSA 4QIWN 5C88A 5IYBJ 5K7HA 2VJJA 3HJEA 1OMTA 1Z8LA 4BHBA 2VQYA 4XQFA 3M3YJ 1BC7C 4ZYGA 2CMPA 1Z2IA 3DPUA 5HDGA 1IXCA 4B8XA 4X8IA 2K3FA 1JKPC 2R5ZA 4BNCA 3DR6A 3T8TA 3UR3C 4M85A 2OAZA 4IQ4A 2NNYA 1I5ZA 3FNCA 3QP5A 3PM1A 1V5EA 3G73A 2CFXA 1FNOA 3TFYA 1IGBA 1S9HA 1G6NA 2R8VA 4ZGYB 2KISA 3ZQGA 1YS7A 2L02A 3HG9A 4II2A 2H27A 3E97A 5HI7A 3ZMUA 4II9A 4V19K 1XGMA 1BJAA 3R60A 1YW8A 4L9NA 3V8JA 4LLNA 1UVGA 2KP6A 4NGNA 2OR4A 2M2EA 1DS3I 1LOKA 4UHTA 2L0KA 4ENKA 3J81Z 3K9TA 2KJCA 4B44A 2DTZA 2VBYA 4MHDA 4WF2A 3VWBA 1OCZH 2H6BA 2PJ7A 3H3UA 2XEIA 4KOYA 4H6UA 5LYFA 4XPDC 4YELA 1Z7UA 2HQAA 3BZCA 3CPAA 2YNCA 1H0MA 2LFBA 5TJJA 1F36A 2L3DA 1KUVA 5D29A 1I1GA 2LTPA 2XB5A 1QA6A 3QOPA 2R5ZB 3R9EA 1FSHA 2V8VA 3ZMSA 3ELKA 1IU8A 2C6PA 2OZHA 3KZWA 4A3BJ 5ERIA 2ZELA 4BACA 2QQAA 1BI3A 3SXYA 2H1KA 1XJOA 4UWIA 2XRNA 3K69A 5E3LA 1ZGAA 3CCLI 2NU3I 5EX3A 3HKZN 3M8FA 4UCMA 1ON2A 2VQHA 1IOFA 2DPUA 1RKWA 3CTAA 4NQWB 3ZQQA 3CMAI 3RKQA 1R5ID 1FOXA 3IO1A 4E7IA 1SGNI 3WC5A 1QSOA 1FOWA 3JRHA 1R4NB 5B1AH 4HF2A 2ARHA 2E1NA 5ICEA 4M72A 3OYHA 1RO5A 4EEFG 2JRMA 1XDSA 5KNLA 2FBIA 2PMZA 1QSRA 3H8FA 4I0AA 5C44J 4C68A 2QWWA 1X2NA 2ZCWA 3NRVA 4I09A 4UXJA 2LY2A 4DYRA 1LE8A 2AFOA 1X1BA 2DPSA 2PMHA 2PMZN 3ZQHA 2LRDA 3C18A 3SZTA 3ZQFA 2HV2A 3KEYA 3D68A 3C7JA 3KZZA 1PUFB 3PFIA 3GTPJ 1P0HA 3EO4A 3OYNA 2W0TA 2FNAA 2ERWA 4S04A 3ZMDA 3JRIA 3RPUD 4IQJA 1G4DA 4HPQA 2EK5A 1XG1A 4EWTA 4NJRA 1V5GA 2GOMA 4BQOA 2CSOA 4OIDA 2YPRA 4RBOA 2ZW4A 4OOIA 3CJNA 1X10A 1VHSA 3Q5FA 2X6WA 2B0UC 2ZB9A 2ELHA 3QAHA 3WGGA 2WY7Q 5DS0A 3DTEA 5TGTA 1V5FA 1AN1I 4DGWB 1K7VA 1LAMA 4YFKF 1XE4A 3LMMA 3PL8A 1LDDA 2LKXA 2IMOA 2PJ3A 3ASNH 2JA6J 3GFIA 2D2WA 3GXOA 4XN3A 1XF8A 3S6HA 1XIXA 1NG7A 3CCVI 1X3WB 1SANA 2BOLA 2GKRI 3K0LA 1HF0A 2CGPA 3FH4A 3VYUB 3UY5A 2JQ7A 1S7EA 3I9V2 4KT5C 1DTDA 1MT1A 4LG3A 4A39A 1KGSA 4ETSA 2VB6A 3E6CC 2F5CA 2UZKA 1FBQA 2M7BA 3PNTA 1PUAA 2QQ9A 4M6GA 5GAGJ 3L09A 5J4VA 1CM0A 1Y1CA 2IP2A 2OCCH 3L2CA 2W7NA 2JUGA 5L3BA 4B11A 4OAZA 1RC9A 1D8KA 4DIQA 4BXUA 3IH3A 3F23A 4CAFA 3CF2A 1U78A 1MDMB 5HS9A 5F46A 3CF5F 4BD9A 1AOYA 4ZY2A 1HKSA 3PB8X 1D5YA 1F5TA 3FB3A 1VNDA 1D0YA 1TUSA 3HHHA 2R0QC 2VOOA 2GANA 3EYIA 1RIOH 1M4DA 2DT6A 4WXHA 1SVOA 2C1CA 1KQ9A 2CV0A 4Y3OA 3HHGA 1I39A 1A5JA 1YJWI 1X3ZB 3GCMA 4EJVA 2VKDA 4XLAA 3VE5A 2QVPA 1ZGJA 4ZYAA 3BR0A 1R5HA 5I0CA 1QZYA 2CV2A 3TO6A 4II3A 4D5FA 4IHXA 4FKDA 3VWEA 2KFDA 1DS2I 5E20A 1Y7EA 2PJ1A 2AO9A 4HQMA 2XGDA 1YK3A 2GE3A 2XF5A 1OR7A 3LQRA 2XAHA 4IHVA 1YE9A 2ACJA 2L54A 2L8EA 4IHMA 4ESBA 4L5JA 1SFUA 2PDOA 2FOWA 2IS2A 3H3ZA 4KMUX 1MKMA 2DODA 2GLFA 3KZYA 1B9NA 4BL0B 3JAMK 4Q4ZF 1R43A 4BEHA 4KN4X 5DM6F 2V9PA 4E70A 2WUUA 3GIUA 4OKOA 3H5ZA 1JUPA 3WE2A 2MLGA 4MXUA 4A95A 3KFWX 1YLFA 3BTJA 2FXAA 2W48A 2ESHA 1WFXA 3WTWC 3H4QA 4BKXA 2M3AA 1IRGA 4AVAA 1D1AA 3UGIA 3LSKA 2ZKZA 4WX9A 1VFCA 2ECBA 3IUOA 2LY9A 3OL4A 4FASD 5J8FA 1IF1A 2CNSA 1VF9A 3JRCA 2DAOA 3DWLE 1ZG3A 4A3GJ 2YQPA 1RZ4A 4C3IJ 4XKWA 2HVRA 1SAXA 1MSFC 2P5KA 4FD7A 1ZG1A 1CBXA 3TO7A 4B48A 4Q48A 4AWXB 5G22A 5JPHA 1TIHA 4CYCB 4YIRX 3R5BA 5B5EC 4A6DA 5K5OA 2PJ9A 4KOVA 2OB0A 1OFCX 4G6DA 2DDBA 4ZYDA 6CPAA 4X6AJ 4GM5A 1XB4A 1UJ8A 2ZBKA 2M8EA 5FUXA 5E3MA 2OUMA 2ZEHA 1IRXA 3EY5A 3ML6A 1OCOH 2EZIA 5LRGA 2FRHA 2PN6A 5DS9A 1VQMI 2M0CA 3DTKA 4UFWA 1UHWA 2E19A 4A94A 2VE8A 3AG1H 1NXUA 3Q9SA 2R5YA 3CLQA 3HUGA 3HRMA 4C2ZA 3SXOA 1REPC 2ZW5A 1W5TA 4HNXB 1P4WA 1IY6A 4IF4A 1ZLKA 2EIJH 3HTSB 3EUHA 3HRUA 3PB6X 4CAEA 4HKFA 3HIFA 1BPMA 3P9CA 3LNQA 1TBQR 3Q9VA 3WODF 4RLQA 2GM4A 5AGEA 5HMNA 2PX9A 2GQQA 3O8HA 2JVHA 1S7LA 5H86A 4HF1A 2HQNA 1FC3A
chains in the Genus database with same CATH topology
3FF5A 3WTVC 4JLYA 4B5PB 3EETA 3IHUA 1IN4A 4UWJA 5HOOA 1IXSB 4AVBA 2MA3A 3WTZA 4RB1A 3GZ5A 2JSCA 4PSWA 3PQJA 5LHHA 2QYOA 1UCRA 5KK1A 2D4PA 3WTUC 1FP2A 3QB8A 2VXZA 2FMLA 4EM2A 4EJWA 1YTYA 4Y49C 1M4GA 1LDKB 3LA7A 2FE7A 2PSWA 4G6QA 4Q47A 2FNPA 3F8KA 1GHCA 4YFJA 5A28A 2A61A 5HS8A 2G7HA 2HKXA 4KLVA 2DXQA 2FIWA 3KP6A 4D0PA 3I58A 3RIRA 2ISYA 3BJ7A 1TNSA 3CXPA 2K86A 2ZW7A 3IWFA 4HLYA 4C7HA 1ZH5A 4MFLA 4P96A 1P2FA 3WTXC 5AG7A 2PC1A 1U5TA 4IRIA 1LEAA 2HQRA 4RS8A 3FX3A 5H6RA 4FX4A 2AJ6A 3TOBA 2P8TA 1B9MA 4A12A 4RS2A 3U9GA 3LWFA 5ILSA 3OOPA 3JAMZ 4MFPA 4R3LA 3MZHA 2FL4A 4DNCA 1S29A 2MH9A 3N97A 2QZ8A 1CGPA 5FO5A 3PZJA 3OV8A 3DKWA 4F6AA 3EFAA 2JT1A 3P2HA 1FLIA 3A9LA 3N7ZA 1WWZA 2NNNA 3BPXA 3MEXA 4XPDB 3J81K 5CNPA 4XPKA 4UUVA 4KMFA 2VT2A 3GO5A 1H9TA 4CGZA 5JI6A 3L9FA 3KCCA 3BLNA 1T6SA 5IV0A 1KU2A 5D5UB 3CO7C 2O28A 2L01A 4GYGA 1YG2A 1ZAOA 4RGXA 3N4MA 4PV6A 4KOWA 3CUQC 2O03A 4B09A 4Q38A 3ZMTA 1K4JA 3S2WA 1RXTA 4ESFA 4KDPA 2O8XA 2FSRA 1W5SA 1Z1DA 4F0YA 2G3TA 1YLEA 3FMRA 3KKWA 1ZHFA 3ROUA 2DO7A 5L3GA 2COMA 1SFEA 3RI4A 3BJ8A 5LEJA 4ORFA 2LF7A 2X0LA 2C27A 2IA0A 1SQHA 1QSNA 3QRFF 3U1DA 1JHFA 1LNWA 2B5GB 2B5GA 4CYQA 4P9FA 1ULYA 4JQFA 4MEYF 1T0FA 3S6KA 2G7UA 3B73A 5JR3A 2HDCA 3DR8A 1G3TA 2XASA 5CVRA 4R3KA 4KA4A 3J80K 3GUDA 1W7PD 5G20A 3CUOA 2O61A 1ONVA 1MJ9A 4S05A 2D45A 2ATRA 2RC4A 1ZYRF 2J8RA 4PCQA 1BC8C 2BEOA 4KVOE 1BM9A 2OA4A 1EH6A 4HAMA 1K79A 4EVIA 4GGGA 1OPCA 3JSOA 3E6MA 1R00A 2CO5A 3LODA 2WV0A 2YX4A 3HTUA 2W57A 4IRGA 4UFXA 3VWDA