2RC4A

Crystal structure of the hat domain of the human moz protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
273
structure length
264
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 59
structure length 264
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rc4A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2rc4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2rc4A02
4CHUA 1R1VA 1S7LA 4LUAA 4XNHB 1G3TA 4UVAA 1WK4A 4IHTA 4S04A 2BEOA 4G6DA 1HKTA 3RDIA 5HH1A 2EVNA 2MLKA 1ULYA 4FT8A 4FHTA 4ESFA 3HHGA 2VXKA 4U9YA 5DUKA 2FQ3A 5EEHA 3W6XA 5ERIA 1YQAA 2HR3A 4MBUA 1BI3A 2PEXA 3F8CA 1J75A 3GUDA 3QU6A 3NEUA 2P5VA 4ESJA 1FX7A 3R0AA 1QSNA 2EFWA 4N9HA 4P55A 3KCCA 1IAWA 4HW0A 4YRHA 1FYLA 1ZYRF 1YGHA 4NQWA 2LDUA 1YIOA 5IB0A 4KORA 4KVME 2Q4VA 2BYVE 4R57A 1OPCA 1IB1E 1OR7A 5LGNA 3O6BB 3WR7A 2FSWA 3GF2A 3WTTC 1D8JA 4QBJA 1T38A 5LLQA 1JGSA 3SXOA 5FLXZ 3CLOA 2ESHA 2W57A 3WTUC 1BC7C 2IA2A 3SZPA 1Z7UA 2CYYA 1OMIA 4U7BA 5J6XA 2HYGD 2R3SA 2J8MA 3E5UA 4S05A 2CWEA 3IWZA 4IRHA 3BJOA 4HBLA 2NNYA 5H20A 5F64A 5D4SA 3SXNA 4RGRA 2PSWA 2QQBA 4KMUX 2OU2A 2QQAA 3RTRA 4OOIA 1D8KA 3EYYA 3RJPA 5LEKA 4YFJA 2VBYA 3CXSA 1EH7A 3DNSA 1U6GA 3KZZA 3QB8A 2ZMEA 4HZFA 2D1VA 3VEPA 1PU9A 2VBWA 1ZARA 3RPUA 3SHPA 2R7HA 4WX9A 3HTSB 4NHJA 1O7FA 1ON1A 4XLNF 4KDPA 4UV9A 3KP7A 2L02A 4IUSA 2Z99A 3E5XA 2FSRA 4ZBGA 3KLOA 3VFZA 5FB2A 2CO5A 2STTA 1WSUA 1BOAA 2M87A 2LNBA 3GY9A 4L0YB 2ZBKA 4CYDA 1KYWA 4MEXF 4BNCA 4K2EA 2G3TA 4IJAA 3CJNA 4XNHC 4OAEA 2DPUA 2QZ8A 1DUXC 1ZG1A 2PFBA 2PMUA 1FBQA 5ICGA 1J59A 1XGOA 2FIWA 1F4KA 2Q7BA 3P7NA 4KZTA 3FB3A 1XCVA 5E20A 5F48A 1H9GA 1FNNA 2A68F 4MJ8A 2JT1A 1LDJA 5KTCA 3RKYA 1YO5C 1IN5A 2WV0A 1KGSA 3MEXA 3FNCA 3C7JA 4ON0A 2HTSA 3BROA 5FGMA 5LRSA 1P92A 3SHFA 2O6GE 4U7DA 1J7KA 4HQMA 1MDMA 4CAVA 3FXUA 3U1DA 3F72A 3MZHA 2A5YB 1P2FA 3TOAA 1JHFA 4YFKF 3I5UA 5TRDA 3DP7A 5BPIA 1MJBA 3R1KA 1FP1D 2R7DA 4CXFA 4LMYA 4HQEA 2BEIA 3O3KA 5DWMA 3V7CA 1UFMA 2EFOA 3TO9A 1BJAA 3ELKA 2LKPA 4U88A 1QSOA 3E3VA 2AJ6A 4JLYA 3J7AO 2ISYA 4ENJA 1K7AA 1IZ1A 4JJXA 3VWEA 5D5XB 1QBJA 1XIXA 4WXHA 3RYPA 3ERED 4HV6A 1BO4A 4U0YA 2HYFA 3WG9A 5DYMA 2V1DA 2Q44A 3EUHA 3FBUA 3N97A 1OYYA 4I49A 2CNTA 1V4RA 1R7JA 2LSOA 4ENMA 4Q4ZF 1IXCA 2NYXA 3IL2A 2EV0A 2MA3A 3TFYA 4OINF 1FY7A 1ZGAA 3KP2A 4HAMA 2B3UA 3I64A 2P6FA 1ZHFA 3I0TA 2XUBA 2ZW5A 2BGCA 2XHKA 4A5NA 4KOWA 1U2WA 1S7NA 4M74A 3V4GA 4G7HF 1B59A 3HRSA 2PDOA 4A0YA 4DNCA 2BSWA 3EXNA 1GVJA 2BL1A 4OMZA 2RGVA 3K9UA 2H6CA 1M4IA 3CXQA 2XAGA 3KEOA 4UHTA 1QO0D 4IF5A 5JQ4A 1UHMA 4L9VA 2R98A 1V0CA 3MFKA 2IA1A 2ESNA 1O3RA 1ON0A 1NSLA 2CSOA 5F47A 2VZYA 2P5LC 3VWDA 5AIQA 2ZNZA 5A2QZ 1I21A 1R23A 1HW1A 4FD7A 4LB6B 3LQQA 2DPDA 3D2MA 2E7WA 1TBXA 4GS4A 2XASA 3L7WA 3F6VA 2FOKA 5LHHA 4DQ2A 2Z3YA 2ZJ2A 3TDZC 4CAWA 2CG4A 5E1ZB 1UCRA 4L9JA 3T90A 1S29A 2PMHA 5D8KB 1Z9UA 5BQTA 1ZRFA 1JXSA 1TNTA 2XAQA 1XGNA 1FYKA 2G7UA 2YX4A 2Y48A 2A6HF 1R1TA 4GGGA 4M9XA 3S6HA 2EFNA 2YSRA 4KOUA 1B9MA 1EH8A 5ICEA 4ZYDA 4OLLA 1TW2A 1YW7A 4R87A 3F6OA 5H6QA 2WWYA 2XIGA 5TJJA 1VTNC 5C82A 1SFUA 4E70A 3EDPA 3LAJA 3VOEA 1ZLKA 1TQPA 4RB0A 4UXNA 2A6EF 4UVCA 3SQNA 1J0RA 1WI9A 3S6FA 3G8WA 1TW3A 3ML6A 2P6GA 4HA8A 3ZMSA 1F9NA 1Z91A 5IT9Z 2FXAA 3LAPA 4EMSA 2CQKA 3SZTA 5DWNA 1S6LA 1XD7A 4O3MA 4F7ZA 2R7FA 3LD2A 1G4DA 2ZW7A 3QP5A 2NRAC 1L3LA 4F6AA 4BH9A 4NSQA 2FBHA 5DEQA 2EJRA 1R22A 2FF4A 1WRJA 3R4KA 2XAHA 3KFWX 1T2KA 1FZPB 3FM3A 3BPXA 5EEGA 1CF7B 2D4OA 3D8PA 1Z1DA 4KA4A 4EJWA 5CYVA 4LK0F 5IT9K 4OU0A 2P7VB 1IUYA 4ETSA 3I71A 5ED4A 5HDNA 4TV7A 4ENKA 2B4BA 1LDDA 3D2PA 4NF1A 3ZJ0A 5DD4A 3WGGA 1IRFA 2COMA 4AB7A 3D0SA 3P9IA 1QNTA 3GYAA 1XSDA 1XMKA 1D3YA 2XGXA 3MQ0A 2F5IA 4EGYA 4AIJA 1SAXA 1MJAA 4BMHA 2DXQA 1LEBA 1Q1HA 2PI0A 3KLNA 1U3EM 4XPKA 3C26A 1HXDA 5BS6A 4XBFA 5JFRA 1Z6RA 1R57A 2HWVA 3ZN0A 4UUVA 3LQRA 2QUFA 3F8NA 2F5DA 3KP3A 1KUVA 3ZMZA 2ETHA 1M4GA 2HV2A 3I59B 4A6DA 3I9SA 2DU9A 3GFLA 1S7FA 1RZ4A 3WTWC 3IRQA 3TO6A 1I6XA 2Q8KA 5HLIA 1IXSB 5K5QA 4MNUA 2GA1A 2YR2A 2NAZA 4LK1F 2VONA 5KTDA 3L09A 3KETA 3S6GA 3BP8A 4PK3A 2B0LA 3DR6A 1QPMA 4EM0B 1KQ0A 4P96A 2H6BA 3HRTA 5F49A 4HF2A 3K2ZA 3WU1B 3E6MA 4NEXA 3JSOA 2CGPA 3IHUA 1XN7A 2H94A 2RV8A 3JUWA 3E0KA 5LHGA 4O5VA 3T1BA 1V3FA 1XEBA 2W24A 4HOBA 3CUOA 4AWXB 4G94A 3HSFA 2QENA 2VEZA 4R9MA 1YG2A 1TLHB 2RNJA 1NE9A 5D5UB 3FMRA 1FC3A 5IX3A 4UWJA 3NQOA 3Q9VA 2K4JA 3K1MA 3M7GA 2BE5F 1SD5A 1FSHA 3L00A 1LDKB 1RNLA 3V8IA 2P4WA 1IN7A 2GA2A 3R60A 2ZNYA 5DCMB 4MI4A 4JK1X 3KP5A 3WTYC 2DLLA 1DP7P 1YW8A 3EETA 5GCNA 1BBYA 2GXGA 3GFMA 2PN6A 1XDSA 4GYGA 1FLIA 1IIDA 4U9ZA 4Q48A 3RIRA 3DPTA 4D0PA 4KIGA 3AAFA 5D6FA 1YLFA 4AD9A 3GXOA 5AIPA 4R3KA 4M9SA 4HF1A 1YFHA 4XSXF 1T0FA 2ZXVA 3TT2A 3IRRA 3R9FA 4L8AA 2DO7A 1KZFA 2L54A 2K86A 3IGRA 4CZZA 3HOTA 2MC3A 2QBYA 4LLGF 3VB2A 4KOVA 4M6XA 2FE7A 3FX3A 4WXCA 4LB5A 1S8NA 1SFXA 2K27A 3EC4A 1RUOA 2DK8A 2MD5A 1I5ZA 3DPLC 2VE9A 1FP2A 1CM0A 3H3ZA 1ZGJA 3BZ6A 1IW7F 3B02A 3IC7A 4KN4X 4Y17A 3Q9SA 1O3QA 3ECOA 2OZHA 2X7BA 3BOQA 4G8XA 3DDDA 1LQ1A 2VI7A 1I12A 4XRFA 4OIOF 2JDDA 3CO7C 2A4NA 1W7PA 3QPHA 3GYHX 2V1XA 5HS7A 5FVJA 4QWQA 1YVKA 2AE6A 2PQ8A 3DV8A 5ILUA 1Q2YA 4B09A 3IKVA 5JVTA 2UXNA 4M71A 2XVCA 5CLSA 2PG4A 4N9IA 1M4DA 1XF8A 3FWEA 3WGIA 4LLNA 2P6TA 1HKQA 5FD5A 4AG7A 3Q5FA 2L3DA 3E6CC 1SD7A 4PSXA 2P6SA 5LBQA 5FD6A 4U5YA 1REPC 4L5JA 4I0AA 1YW9A 2CW0F 1PUAA 3KE2A 1BOBA 3V8LA 2EK5A 1R00A 4ZZLA 1YREA 3F8FA 2A61A 3FRMA 1XGSA 3I59A 3C1DA 3F21A 2HFHA 4NCZA 3ECHA 2VC0A 4M3SA 4I2OA 3QAHA 3JW4A 1B87A 5H86A 4LX9A 4WXDA 5K5RA 1HKSA 2VN2A 4I02A 5JI6A 3R96A 4A0ZA 3C3WA 1K79A 4HNWB 1BI2A 2DTRA 4O6JA 4KICA 4GXOA 1C0WA 3JTGA 3SFZA 4AVBA 3LSTA 1H0MA 1O7LA 5ISVA 2P0WA 1YX0A 3MGDA 5HLGA 3GO5A 1WWZA 4KOYA 4QLCU 4ZYHA 2HS5A 1J2XA 3I54A 3IWFA 1BI0A 2HQNA 2D2WA 4II9A 4KMFA 1FPQA 2KJBA 2OAZA 1FSEA 2QMLA 2Q0OA 3GFIA 1Z4EA 1U5TC 3RKXA 1B9NA 1D5VA 4IVNA 4A6EA 2MH9A 1EH6A 3CUQB 4M9ZA 4BYYA 3HSEA 4JQFA 1USTA 3GFJA 5DCMA 1S7OA 2IW5A 1Z6TA 1PP7U 3F8KA 3K0LA 4GO1A 4PGGA 2FT0A 2VOOA 4LJZF 1AOYA 3DF8A 1Z9CA 2YPRA 4L18B 3CUQC 2HKOA 5L3DA 5CVJA 4A0XA 1U5TB 4OIQF 3I3GA 1KQ9A 5ICFA 1OZPA 3RYOA 2ARHA 1UHWA 1MD0A 3HTUA 4EGZA 3ZMVA 3ZMDA 1BI1A 2NMTA 4H6ZA 3U2RA 2C6YA 1IICA 2OB0A 1HW5A 2K02A 3SXYA 4CRZB 4I09A 3VODA 2HQRA 1N71A 2IL4A 3REOA 1R5HA 1R1UA 2EA2A 5HOOA 3R61A 2V9VA 3GX4X 5DD8A 3RI4A 4RS2A 1MZBA 3BJ7A 2OQRA 5HDKA 1GXQA 4KUMA 4A12A 2RVCA 2O61A 5KK1A 1XMTA 4L0ZB 3F22A 1K78B 4HF0A 1QZYA 2FRHA 4OIPF 1G3WA 2R1IA 2XV4S 2ZMEB 4KYWA 4M85A 3J81Z 3TO7A 5JR3A 1Z4RA 2Z10A 4IXAA 1HBXG 5HVQC 4B8XA 3OV8A 5L3FA 1KQ8A 4UVBA 1IN8A 3BDDA 4BHPA 1I1DA 3RYRA 2ZPAA 2UZKA 4G7OF 1P4WA 2J8NA 3T5XA 2VXZA 3WE2A 1T39A 4ONUA 4KT5C 2VT2A 1W4MA 2O03A 4LGWA 4EV0A 1BC8C 1SD6A 2OZ6A 3DFGA 3V8KA 2OQGA 5EC4A 2FS5A 1ZAOA 4QC6A 2F5FA 2HOEA 3CXPA 3W6JB 4EQQA 4FX0A 2QVOA 1HQCA 2REEA 3T9YA 5I0CA 1U78A 4WK8F 1KU9A 3EFAA 3DKWA 3L2CA 2ISZA 3ZPLA 2ELHA 1TTYA 3B73A 4OIRF 2YX7A 2Z9OA 4HYEA 1GXPA 4YIIA 5KTAA 2TDXA 4FD6A 3TOBA 2GXBA 2RDPA 2KRFA 1WQ2A 4BQAA 1R36A 4JBAA 1I1SA 1YLEA 1W5SA 1KUXA 1P6RA 1L0OC 2D4PA 5F6FA 3HRMA 3ISPA 2VODA 3CDHA 1WKMA 1K78A 1ODDA 4EM2A 2KKOA 2O8XA 2DI3A 2JSCA 2J5OA 2FNPA 3MAJA 1A04A 5FLXK 1E17A 4E0AA 3KP4A 3T8TA 3BPVA 2YU3A 1R5GA 3QP6A 1LJ9A 4Q5SF 3E97A 4KOXA 2X4HA 2XAJA 4IRGA 1X3UA 3BWGA 1HSJA 3MWMA 5HDGA 2QLZA 3WE3A 4X5KA 1TNSA 3HUGA 3JTHA 3WODF 2EV5A 2GIVA 2GAUA 5DDGA 2BUEA 4RI1A 3DQVC 3J80Z 1GHCA 2FA5A 3LA2A 2W25A 6PAXA 4E8OA 2VBXA 3KZYA 1IF1A 2OH1A 4E2AA 1T98A 4OADA 2F2EA 1ZREA 3IWGA 1Y0UA 2HDCA 4HDUA 4KIBA 4HDVA 4R8HA 3MZYA 2EFPA 3T0YA 1ONVA 5EBVA 1Y7RA 3B8GA 4YFNF 4KOTA 3G3SA 3COAC 3WTSC 2GQQA 5HMNA 3J81K 4ESBA 3GZ5A 3W6KB 1USSA 3KEQA 2E1CA 1YS7A 4MQ9F 2L4MA 5IV0A 2IJLA 1KU7A 4HX4A 1ZH5A 1AWCA 2F5EA 1WWXA 2PBIA 2QM3A 4EJVA 1JE8A 1W5TA 2B5GA 2W84A 5L3EA 2H09A 2M30A 2QIRA 3ZP5A 2WC2A 1W7PD 3FYNA 3OOPA 1O57A 3KP6A 2ATRA 1ZN2A 2QQ9A 1S3ZA 3W6SA 2PR8A 4EJTA 1KYZA 3U9GA 4CS0B 1ZLJA 3C18A 1RXTA 5E1WA 2PRBA 2DT5A 4GYIA 2MLGA 2VC1A 2CNSA 2CFXA 4BAYA 3R6SA 4MHDA 4YFXF 2RN7A 3FXQA 3LA3A 3P9KA 3QRFF 1CGPA 2J8RA 3R9EA 4WCGA 3E6BA 1E2XA 2RQPA 2VOPA 2O3FA 5J8CA 2IP2A 1GHEA 3EQLF 5ILSA 2EV6A 4CRYB 3K1NA 2XROA 4KLVA 2Q04A 2XRNA 3TKYA 4CDGA 3PFIA 4EVYA 4HX7A 2STWA 1O3TA 2UWMA 2I79A 2L4AA 2Z33A 3DR8A 3R9GA 1B6AA 2G7HA 1VKCA 5LRRA 3FHZA 4MGRA 1QZZA 3QPTA 1ZG5A 3K1PA 1YK3A 4KNYA 1EV7A 2WPXA 2FIAA 4L9TA 4QVTA 3M9AA 2OZUA 1IYKA 4LG0B 1T6SA 4MEYF 5BOXA 2NS0A 4K30A 4YIFA 2CY2A 1I1GA 4PK2A 3LA7A 1RIOH 1LRZA 2IA0A 3FMQA 3GWZA 3RPQA 5K1YA 1NHAA 4UNOA 2MH2A 1Y9WA 5D5WB 3UY5A 4KVOE 4A2UA 2JPBA 1BN5A 3NE7A 2KIMA 4GCVA 1LVAA 1P4AA 3GKRA 2GZWA 1BIBA 1DPRA 3BJ6A 4I0BA 4Q47A 5CVRA 1Q2DA 4EVIA 2FL4A 1XGMA 3CTAA 2FU4A 1YS6A 2FEZA 3D3SA 4L5IA 4HLXA 3F8BA 1W7PB 3J80K 2DQLA 2QECA 2R8VA 3I58A 5H84A 4IHSA 1OYIA 2HGCA 3WTVC 4I01A 2Q0YA 5CJ9A 4L89A 4RS8A 4KUAA 3GEZA 3E6DA 2EB7A 3H4QA 3ZMUA 1CJWA 4LFUA 1FBSA 1DPUA 1LEAA 2PLYA 1SQHA 5D5VB 4AIKA 4JWPA 2WTEA 3PGPA 2JEVA 4BHBA 4HNYB 2V1UA 2HUZA 4PDKA 3BLNA 3JAMZ 2FNAA 1G3YA 4U0WA 4NB5A 3N4MA 3FIXA 4M73A 3GZ6A 1U6MA 3IKTA 1MGTA 2VE8A 1P4XA 3V8JA 5CVVA 2JZYA 2ZW6A 3T8RA 2JDCA 3R95A 2V6CA 1Y9KA 2DW4A 4OMYA 1IN6A 2FCKA 4EM1A 5H6RA 1RI7A 5FFZA 4G7ZF 1NMTA 4U0VA 2P7CB 1OYWA 2G3AA 1B6BA 4AVPA 4UWIA 4MHGA 2OA4A 3WGHA 1S7KA 2E1NA 4RB1A 4AG9A 1J9IA 5ICCA 3M8FA 2ADUA 2ZCWA 2G9WA 4UA3A 2Q4YA 3GLXA 1FOKA 5LHIA 3S2WA 2GANA 5E18F 2PJPA 4AVAA 4MY3A 1TQMA 2K7LA 1M1DA 4IF4A 2ZXJA 3PP9A 4ZYGA 2VZZA 2BV6A 2X0LA 1FWZA 5LGTA 3CO6C 5KVRA 3P9CA 3P2HA 2H5MA 2EFQA 2A69F 4UV8A 2KCWA 5JPHA 4Y49B 3M8EA 4R1HA 1ZRCA 4H6UA 4I7HA 5C88A 2Z5UA 4B5PB 1FBUA 2KIFA 2RC4A 4PGHA 1U8RA 5FO5A 4KFCA 1DDNA 4N0BA 3F23A 4Z2YA 4J3GA 2DBBA 4ZZDA 3FXTA 2W85A 1B4AA 3EYIA 1UFHA 4MY0A 4H89A 2Y75A 2IVMA 3F8MA 5J8FA 1RO5A 2M45A 3HOSA 1QSTA 3TCVA 5HS8A 2AXLA 5ILVA 2VBZA 2Q2EA 2HEOA 5AONA 5L3BA 1KA8A 1KU3A 2KIUA 3F3XA 2IPQX 5E1XA 3ABUA 5BPDA 2ZW4A 4RGUA 1MDMB 2QBYB 3PQKA 2VT3A 4PSWA 2UXXA 4QUSA 1RUNA 2LF8A 4FD4A 1LNWA 4HLYA 5D8LB 2XAFA 3WTZA 2DFIA 1SMYF 4YGOA 4R79A 3FF5A 1U5TA 3FZVA 4AIHA 2ACJA 3PZJA 3R0JA 2ZO4A 5IT3A 4G6QA 3GVAA 2WPWA 4Y49C 3M1EA 1K6OA 1XE4A 3ULQB 2M8EA 1R58A 2ZKZA 3K9TA 4MQVA 3O2PE 1P4NA 4LG0A 4WF2A 3S6KA 5BMZA 3GW2A 2GE3A 4BHCA 5DV5A 5E8GA 1G3SA 3TE4A 2B3VA 1J5YA 1XCBA 4UBRA 4RAZA 2D45A 3ABTA 4M6YA 1CF7A 1Q2CA 4XSZF 4CICA 1ZRDA 3KKWA 1S3JA 1OKRA 4G9YA 1XMAA 5DCFA 4LLLA 2EWNA 2KJCA 4HX8A 1YVOA 2Y0MA 1QSRA 1XSVA 1FYMA 5A2QK 3H92A 1K4JA 3MCZA 4PV6A 2PR1A 1MKMA 2C27A 4JD6A 3HYIA 4FX4A 4EJUA 3QOPA 2E7XA 1ON2A 4FD5A 3OWCA 5F46A 3TQNA 2DQRA 1XB4A 5HS9A 1MK4A 3F0AA 2V79A 3I4PA 5LGUA 5JHUA 4JXQA 4YG2F 3HHHA 3V7RA 3JSPA 4H0EA 2B5GB 4ZH4F 4F0YA 2CNMA 3BJ8A 1QSMA 1B1BA 2LF7A 5L3GA 2PC1A 3DSBA 2J5PA 5D4RA 2EA4A 1TQIA 4CGZA 5CNPA 4Y15A 1SMTA 4B5OA 3TTHA 3QU3A 3D5LA 4PZJA 1O3SA 5K5OA 2G0BA 2OZGA 4KVXA 2XKOA 2K5TA 1IYLA 2FMYA 2JLMA 2VQYA 3JAMK 2I00A 3G73A 2HTJA 2ZFWA 3BJAA 2M1BA 3G3ZA 2K4BA 2OBPA 3E5QA 1IXRC 1G6NA 2QWWA 1Z05A 3H3UA 4R3LA 2B58A 3DXJF 2RKHA 4XLPF 1FT9A 4XPDB 3W91A 2JTVA 1LB2A 1JHHA 4B5PA 4JXRA 1I27A 2XKPA 4M72A 1PUEE 2GWRA 2NNNA 1BM9A 3L9FA 1TIQA 2JPCA 4RGXA 2AS5F 3EY5A 3P2FA 1SFEA 4BXUA 2Z11A 1KU2A 2A3SA 2FBIA 4L9NA 4KUBA 1MJ9A 4XPDC 2Z0ZA 3TGNA 4CO8A 3LFKA 3WTXC 2BBYA 2M5WA 1HSTA 3I53A 2DK5A 2P8TA 4EJOA 1L0CA 1HW2A 3FXRA 3N7ZA 1YR0A 1PDNC 3NRVA 5E8IA 2EUIA 2MBFA 1QQIA 4IPAA 5LEJA 4A5MA 3DEUA 4KIFA 1QGPA 2FBKA 4IRIA 2FMLA 2IT0A 3EO4A 4KOSA 2OD5A 1S60A 4PCQA 5L3CA 4CAXA 5FFXA 4P9FA 1J4JA 2VBQA 5HLHA 4MTDA 3BY6A 4ENNA 2F5CA 1UB9A 2QYOA 4QB9A 4ZYEA 2O0YA 3TDUC 4NXYA 3HSRA 3FM5A 1BIAA 1XSXA 3PQJA 5CVIA 4HNXB 1ZG3A 1SD4A 3CUQA 2REFA 1S5KA 2FE3A 2B4DA 5D6EA 1P0HA 3ZMTA 3HIFA 1H9TA 2P5KA 4RGSA 3ZQ7A 2FXFA 2L01A 2A07F 4LD5A 1S7AA 5F1RA 1YTYA 4XPLA 3V7SA 5DUIA 4Y13A 4WWCA 4RB2C 1IRGA 5E17F 3LODA 4KLWA 4ASNA 4RAYA 3FMSA 3JVNA 4HKFA 1YYVA 1KUYA 4I98B 2HZTA 2D1HA 3ZZIA 1PP8F 1F1ZA 5CVUA 2H27A 3F5BA 2P6EA 1IN4A 1VHSA 1M44A 2HQYA 4ORFA 2HKXA 4P5OA 3WU0A 2DAOA 3RKWA 3LWFA 4MTEA 2JRTA 3ZN1A 3HRUA 1STZA 4AVCA 2O28A 3K69A 3ROUA 1XDUA 1F5TA 2B4DB 4P9UA 2IRFG 5E96A 4KN7X 4HV5A 4RB3C
chains in the Genus database with same CATH superfamily
1F2OA 4CHUA 1R1VA 3QWPA 1KWMA 2LY9A 1S7LA 4LUAA 4XNHB 1G3TA 4UVAA 3SJEA 1WK4A 1SANA 4LIUA 4IHTA 3PFEA 3GTLJ 4Z65A 4S04A 2BEOA 3GTGJ 4I99C 3JCUC 1Y7EA 4G6DA 1HKTA 4CYNA 4WWVA 3K7AJ 2K85A 1BUSA 3RDIA 5HH1A 1IY6A 2EVNA 1BR1A 3ZCOA 1VQOI 2TRTA 1VQ8I 3S17J 2MFZA 2MLKA 3OYNA 1ULYA 4M6GA 4FT8A 3B2YA 4FHTA 4ZTFA 2EZIA 4ESFA 3A01A 2QKLB 3HHGA 4HEA2 2VXKA 4U9YA 5DUKA 2FQ3A 5EEHA 3I1UA 3W6XA 5FKKA 5ERIA 4IX7A 1CX8A 1YQAA 2HR3A 3S3NA 1BI3A 2PEXA 3F8CA 1Z8WA 1J75A 4MBUA 3GUDA 3QU6A 4NDLA 2PJ5A 2LEOA 3NEUA 2P5VA 2AQFA 4GI3C 4ESJA 1FX7A 2KRHA 3R0AA 1VQ4I 1QSNA 2EFWA 3KR4A 2K5CA 1KBEA 3WC5A 2F4OB 2JSPA 4N9HA 3KCCA 4P55A 3PBBA 1SGDI 1IAWA 4HW0A 5E3PA 2L7ZA 4IOCF 1S72I 4YRHA 1FIPA 4ZGYB 1TZLA 1FYLA 3LSMA 3FBIB 1ZYRF 1YGHA 4NQWA 1V5GA 2R7VA 2LDUA 1YIOA 4BU2A 4UFVA 1JQGA 3B6CA 5IB0A 3O8HA 3BTLA 1VIXA 2O5RA 4KORA 4KVME 2Q4VA 2BYVE 2M9HA 2Z3OA 1WH7A 2E71A 3BG9A 2YQPA 4R57A 1OPCA 1A35A 1IB1E 1OR7A 2LH9A 5LGNA 3O6BB 3OXLA 4ZYAA 4F3QA 4FASD 3WR7A 2FSWA 3GF2A 3WTTC 1S7EA 1BL0A 1ZO0A 3TX8A 1D8JA 3V7ZA 2CV0A 1OBRA 4QBJA 1MH4A 1T38A 5LLQA 1JGSA 2J87A 3SXOA 3OIPA 5FLXZ 1TL8A 4CCJA 4EWTA 2KDOA 2ORVA 5IYBJ 2CRGA 2DA3A 3CLOA 1FOWA 2ESHA 1DGRM 2W57A 4OAZA 2CS3A 2IA2A 4RA2A 2ZSIB 3SZPA 1Z7UA 2CYYA 3VYUB 4XKBA 4BDYA 3K2AA 3MZ8A 1XTAA 4E7KA 5DS9A 1OMIA 4U7BA 1IOFA 3SJMA 3PBEA 5J6XA 3NARA 1ZGWA 2HYGD 2R3SA 1EKEA 3D1NI 2J8MA 2DKVA 3E5UA 1IO2A 4S05A 1RKWA 2CWEA 3H5ZA 2HVQA 3IWZA 2HQAA 2LREA 1MBGA 3FXJA 4IRHA 3BJOA 3KX2A 4HBLA 2NNYA 5H20A 5F64A 5D4SA 5K7ZA 1N77A 3SXNA 4RGRA 3FX6A 3QTLD 3HPHA 2PJ1A 2PSWA 2QQBA 4KMUX 2OU2A 2QQAA 3RTRA 2QSFX 4OOIA 3LSGA 3ESWB 1SC7A 1D8KA 2VKEA 1IRXA 3EYYA 4V2GA 1JUPA 2V9KA 2VBYA 3RJPA 5LEKA 4YFJA 4XL9A 2C1CA 3CXSA 3S1NJ 1XMBA 2DPTA 1VQKI 3DKXA 2DEAA 3BHXA 4E4HA 3FMCA 1EH7A 4CGOA 3DNSA 1Y39A 1U6GA 2GLJA 2ZJPF 3RBUA 2PJBA 2R0QC 4E1RA 3KZZA 2IS6A 1X12A 1BJZA 3QB8A 2ZMEA 3EUKL 8CPAA 2R5ZB 4HZFA 4BJTA 2D1VA 2RIJA 3VEPA 1PU9A 2VBWA 1ZARA 5GPCA 4C3IJ 1DU6A 2EQRA 2KMUA 3RPUA 2N8GA 4BEHB 1A31A 3SHPA 2PMZN 4D5CA 2R7HA 4WX9A 3HTSB 2M2EA 4NHJA 1O7FA 2WVJA 4CYPA 3HDDA 3I4MJ 1ON1A 4XLNF 3LMMA 4KDPA 3BI1A 1YE9A 2GKRI 4UV9A 2Q4ZA 4A3IJ 3J7YJ 5EJCA 3KP7A 3GTJJ 2L02A 2RFHA 3QAYA 4IUSA 2Z99A 3E5XA 2FSRA 5CPAA 4ZBGA 1UZCA 3KLOA 3VFZA 4NGNA 5FB2A 1TGSI 3FEEA 2CO5A 3CJRB 2STTA 1V54H 3VDXA 4C7IA 1WSUA 1BOAA 2M87A 2DB6A 5K8PA 3RAMA 2LNBA 3CPAA 4ZDPA 1OR7C 1Y6IA 3GY9A 1MNMC 5GTIC 3W2VA 2ZBKA 1XG1A 4L0YB 1Y1VJ 3HOUJ 4RUHA 5HVGA 4CYDA 1KYWA 1NUBA 4MEXF 5EX3A 4BNCA 4K2EA 2M0MA 2G3TA 3H5NA 3D7DA 4IJAA 1WZ2A 4A37A 3D5SC 3CJNA 4XNHC 2ME0A 4K3NA 1DQUA 4F9VA 1WJDA 2H8WA 1V5EA 4OAEA 2X1DA 2QZ8A 3OYEA 1U9OA 1DUXC 2DPUA 4CUGA 1DP3A 1ZG1A 2AHQA 2PFBA 2AFOA 2PMUA 3BCAA 3E59A 1FBQA 5ICGA 2L9RA 2V7FA 4M3EA 1XGOA 1T33A 1J59A 2FIWA 4F0XA 4ZY0A 1D0XA 1F4KA 2PMZA 4P10A 2Q7BA 3P7NA 4KZTA 2JVHA 1B8IB 3FB3A 1XCVA 5E20A 5EG0A 2YS9A 5F48A 1H9GA 1FNNA 2A68F 5EG0B 2JT1A 3W2AA 4MJ8A 1LDJA 2GBYA 2YNDA 3KYDB 5KTCA 2ODDA 2V8DA 2YGWA 3RKYA 1HC8A 1YO5C 1MSEC 2R5YB 2RREA 3ZXSA 1U8BA 1IN5A 2WV0A 5E3LA 1X4PA 1KGSA 2VRWB 3OXFA 3MEXA 2XF7A 3C7JA 4ON0A 3FNCA 2WUUA 2HTSA 3BROA 5FGMA 4PJMA 5LRSA 4Y4RA 1P92A 1GV5A 3SHFA 4U7DA 2O6GE 1A5JA 1TKHA 1J7KA 4HQMA 4I6ZA 1MDMA 1FOYA 3FXUA 2CIJA 3U1DA 2NVQJ 3F72A 3MZHA 2A5YB 3LSIA 1P2FA 4Y7NJ 3CESA 3J7ZI 1Z7KB 3TOAA 1JHFA 3CD6I 4YFKF 3ONQA 3I5UA 3NH5A 5FROA 5TRDA 4MFQA 3DP7A 5BPIA 1MJBA 3R1KA 3DCFA 2SGPI 4HGUA 1FT7A 1FP1D 2R7DA 1VHOA 4CXFA 4MHZA 3FBNB 4LMYA 4HQEA 2BEIA 1T56A 3HEFA 3O3KA 3TBIA 1DS3I 3V7CA 1UFMA 5DWMA 1OISA 2EFOA 5C4XJ 3TO9A 2EO8A 1BJAA 4CPAA 4MLOA 2F48A 3ELKA 3H9QA 2LKPA 1FIAA 3VATA 4U88A 1EJ9A 3E3VA 1QSOA 2AJ6A 4JLYA 3CCSI 3OS2A 3J7AO 1Q7LA 2ISYA 2UV1A 3ERMA 4NC7A 4ENJA 3KL9A 2GM4A 3VPRA 1K7AA 4CYOA 2ZEOA 3JRCA 2GIZA 1IZ1A 3IJ3A 4MPIA 4JJXA 3VWEA 2FX0A 4CAVA 4DUKA 2PJRB 4UXJA 5M5WJ 3BR1A 3I3LA 2KP6A 5D5XB 1QBJA 1JGGA 1XIXA 5LYDA 1R43A 4WXHA 4B12A 2EIMH 3RYPA 3ERED 3TC8A 4HV6A 1BO4A 1ZQ3P 1R71A 4U0YA 1HDDC 1T95A 2HYFA 3WG9A 2ZEDA 1PCAA 4UEZA 4GXHA 3DTIA 5DYMA 2V1DA 2Y9ZA 2Q44A 1JWQA 2MG4A 3EUHA 3FBUA 4ZC3A 4A3GJ 2DTZA 3N97A 1OYYA 4I49A 2CNTA 1FJLA 1V4RA 4IHVA 1UG2A 1R7JA 1YIJI 2LSOA 4NJRA 4ENMA 4Q4ZF 1IXCA 2V53A 2NYXA 1D0YA 1O4XA 2A20A 4XLCA 3IL2A 1H8LA 2EV0A 2MA3A 2WB1N 3TFYA 4OINF 2VLAA 2LUYA 4TWEA 4B3XA 1FY7A 1ZGAA 3KP2A 5JLXA 1Y8FA 3S93A 3SDGA 1JJ6C 4HAMA 2MSYA 2ZSHB 3I64A 2B3UA 3JREA 2PJCA 3MKWB 3JRDA 1ZHFA 2P6FA 1RC9A 4XLFA 1HEVA 3I0TA 2XUBA 4B1RA 2ZW5A 2Z3LA 1K7VA 2BGCA 2XHKA 3BLYA 4A5NA 3RU0A 4KOWA 4LG3A 2DMNA 5AG5A 1U2WA 2HZDA 1S7NA 4M74A 1AKHB 1Z3XA 4AM3A 4J01A 3V4GA 4DW6A 4G7HF 4IZZA 1B59A 3HRSA 3UFFA 2KPMA 4UXIA 2R5ZA 1WKXA 3D68A 1MBKA 4II3A 1W0UA 3CCLI 4RMNA 3S1RJ 2PDOA 3LWUA 1HCRA 4E7ZA 4A0YA 4DNCA 2BSWA 3EXNA 3PUFA 1GVJA 4QIWN 2BL1A 3FHNA 2RGVA 4OMZA 2HDWA 4DOZA 3HOVJ 3TW7A 2H6CA 1M4IA 1TKFA 3CXQA 1SGEI 2XAGA 3KEOA 3K9UA 4AYBN 2ARPF 4UHTA 2PJ4A 4IEJA 1LE8A 4B44A 1TBRR 1QO0D 2NVYJ 3TP0A 1Z3YA 2QKMB 4IF5A 3F9KA 1GT0C 1UHMA 4L9VA 5JQ4A 2DN0A 1BC7C 2DA5A 2R98A 1V0CA 3MFKA 2IA1A 4H4KC 2ESNA 2ZELA 2IXSA 1O3RA 1ON0A 3H8FA 4Y33A 4LQ6A 4CCOA 2CSOA 1NSLA 2IJZA 2M7AA 4ZDOA 2W00A 3BQZA 2PJAA 2NOJB 5F47A 2VZYA 2P5LC 3VE5A 3VWDA 5AIQA 2ZNZA 5A2QZ 1I21A 4P6YA 6CPAA 5GP9A 3S2HJ 1R23A 1FTTA 2NYQA 2JRMA 4A3JJ 1HW1A 3BG6A 4FD7A 4LB6B 4D7MA 3LQQA 2DPDA 4JP0A 4UXHA 3D2MA 3RKQA 2E7WA 3PB9X 1TBXA 4GS4A 2XASA 3CDXA 3L7WA 3F6VA 3IAS2 4B47A 5GAGJ 1VHEA 2FOKA 1BR2A 5LHHA 1YW4A 3SI2A 4DQ2A 2Z3YA 3SEZA 2ZJ2A 1YJWI 3TDZC 4CAWA 2CG4A 5E1ZB 1UCRA 4G12A 4L9JA 3GIUA 3MD2A 1XMXA 1S29A 5G22A 2PMHA 3T90A 5D8KB 4MFJA 1Z9UA 3ABKH 3CCEI 5BQTA 1ZRFA 1JXSA 1TNTA 2ID6A 4XR6A 2XAQA 3WHCA 1XGNA 1WJAA 1H89C 1FYKA 1VDDA 2YX4A 2G7UA 2Y48A 2WSAA 5H2FC 2A6HF 1R1TA 4GGGA 4M9XA 3S6HA 3U21A 3CF5F 3JR9A 2ZJRF 2EFNA 2YSRA 4KOUA 1B9MA 1EH8A 5ICEA 4ZYDA 1HLVA 2KZGA 4OLLA 1TW2A 2Q51A 1QHGA 1YW7A 4R87A 2Q7SA 3F6OA 4X1EA 5H6QA 1MW7A 2WWYA 2V26A 2XIGA 5TJJA 1IV6A 1QA6A 1VTNC 3AG2H 4M3GA 3CF2A 4ANJA 1YI2I 1YOVB 3G6EI 1SFUA 4E70A 3OYHA 3LMSA 3EDPA 3LAJA 3VOEA 1ZLKA 2GOMA 2HOSA 1TQPA 2FJ1A 4RB0A 4UXNA 1BR4A 1VQPI 3W2WA 2QCOA 2A6EF 4ZYQA 4A38A 1T0FC 3UEYA 4MIMA 4UVCA 3SQNA 1J0RA 1WI9A 1YQEA 3KASA 3S6FA 3G8WA 3PSIA 1TW3A 2VPLA 3ML6A 2P6GA 4HA8A 2XEFA 3ZMSA 2WGCA 1F9NA 3QODA 1Z91A 5IT9Z 3CC4I 2PE3A 3D7HA 3B3VA 2FXAA 4FBEA 1H0ZA 4C3JJ 1Z21A 3WG7H 3LAPA 4EMSA 2CQKA 3SZTA 5J4YA 5DWNA 1S6LA 1XD7A 1VQ5I 4O3MA 2ECBA 4F7ZA 3FK7A 1CQTA 2R7FA 3QYFA 3LD2A 5J40A 5A27A 1G4DA 2ZW7A 3QP5A 1BAVA 2ABZA 2NRAC 2IS4A 4YELA 1L3LA 1P7IA 3HB9A 3BR2A 3B3WA 2KFDA 4F6AA 2OCEA 4BH9A 3S1MJ 3QNVA 4NSQA 2FBHA 2L5QA 5DEQA 2EJRA 3CCJI 2ERWA 1LE8B 1R22A 2FF4A 2R7QA 5D29A 1W4RA 1WRJA 2A05A 3R4KA 2XAHA 2W7NA 3KFWX 1T2KA 1FZPB 2WV1A 3FKJA 4UF4A 3FM3A 3HGYA 1IDZA 2K3PA 1POGA 2LK2A 3BPXA 1ZELA 3I55I 4XLHA 5EEGA 1CF7B 5FUXA 2D4OA 3D8PA 4YU9A 3VDUA 1Z1DA 9WGAA 5AG4A 2L0KA 4KA4A 4EJWA 4Q36A 5CYVA 4LK0F 5IT9K 4OU0A 2P7VB 1IUYA 1TURA 4ETSA 1WJEA 1VFCA 3I71A 5ED4A 4RAGA 2KHMA 3AG1H 2VQGA 2BY0A 4TV7A 5HDNA 2BVMA 4ENKA 2JA6J 1X10A 3D67A 2Z16A 2B4BA 1LDDA 1DU0A 3D2PA 4FE4A 4NF1A 2PIYA 2XGCA 1X19A 3KGQA 2BHZA 3ZJ0A 5DD4A 3JRIA 3OYKA 3WGGA 5K8NA 1ZKGA 1IRFA 3B7IA 2ZEFA 2XF6A 2COMA 3OYJA 3S8PA 1ELLP 4AB7A 3D0SA 3P9IA 1QNTA 3CC7I 1GDTA 4Y52J 2CW8A 3G4SI 3GYAA 1XSDA 1XMKA 1P9QC 3K10A 3OOUA 4B43A 2QQEA 3IU1A 2MD0A 3GTMJ 1D3YA 4XRSG 4CH7A 4OC2A 2XGXA 3MQ0A 4B4CA 4E7LA 2F5IA 4EGYA 4A3MJ 4AIJA 3VYTB 3QOEA 1SAXA 2OUMA 1MJAA 2WZNA 1TF9A 4BMHA 2DXQA 2H1KA 1VQMI 3KYCB 3DEEA 2ZJQF 1LEBA 1Q1HA 4A95A 2PI0A 3JRAA 2PJ3A 3KLNA 1U3EM 1UELB 2NVXJ 4XPKA 5J4VA 3L2NA 1SGNI 1YJNI 1TF8A 4FE7A 3G71I 2E1OA 3BTIA 1LAMA 4UIBA 2BW3A 1S9HA 3C26A 1HXDA 1WJBA 4BE2A 5BS6A 4XBFA 5JFRA 4BINA 1Z6RA 1HOMA 1R57A 2ZEMA 4IHWA 4OMEA 3I9V2 3ZQHA 4CCNA 2DFEA 2HWVA 2OC6A 3MVPA 3ZN0A 1UVGA 4UUVA 3LQRA 5E3RA 2QUFA 3F8NA 2WADA 2F5DA 4PJLA 3KP3A 1KUVA 2HPIA 2I10A 3FJUA 3ZMZA 4P44A 2ETHA 1M4GA 5FKLA 2HV2A 2OVOA 2OTJI 1ZG8A 2CUJA 2WYRA 2R4GA 3I59B 3KPHA 4A6DA 3I9SA 1OYVI 3BC8A 2X52A 2DU9A 2V9PA 3GFLA 2AFZA 1SFKA 1S7FA 1W3SA 4NJQA 1RZ4A 5E3OA 3WTWC 1LR8A 3IRQA 2JBKA 1WGXA 4FKDA 3TO6A 1I6XA 4LQGA 2R5YA 3SJXA 2Q8KA 5HLIA 1IXSB 5IPAA 4B11A 5K5QA 3DLJA 4MNUA 2W1OA 2GA1A 2YR2A 1S20A 1WVRA 1CPSA 2NAZA 4LK1F 2XEGA 2XF5A 5JLWA 1NK3P 2V77A 2KRCA 5J1RA 1I3AA 3D4UA 2VONA 5KTDA 3L09A 2VQLA 3KETA 3H8GA 2VJ5A 3BP8A 3WU2C 5DAEA 4KJZA 1SVLA 1FNOA 4RN7A 4A69C 2HXOA 4NNJA 2G9DA 4PK3A 1MH3A 4OC3A 2B0LA 3ZQGA 3DR6A 2ZOFA 4JYKA 3OMYA 4XORA 1QPMA 4EM0B 1KQ0A 3DLAA 2H6BA 4P96A 3HRTA 3BG3A 1AUGA 5F49A 4HF2A 3K2ZA 3WU1B 3ZQLA 4EFDA 4CAFA 5DM6F 2XEIA 4JX6A 4DYCA 3E6MA 1ZLHA 1RPWA 2UVOA 2C6CA 3JSOA 3DBRB 4NEXA 2CGPA 3B6AA 2DA7A 3KQZA 3CJTB 3IHUA 2UZ3A 1LPQA 3GTPJ 2OCCH 2DPSA 5GPAA 3OYBA 4GFBA 2XEJA 2PX9A 3ABLH 1XN7A 4A32A 4BD9A 2H94A 2RV8A 2DOEA 4IKFA 3E0KA 3JUWA 2KQRA 5LHGA 2R92J 4O5VA 3T1BA 1V3FA 5EGOA 2W24A 1XEBA 2AFWA 4HOBA 2I3CA 3CUOA 4AWXB 1CBXA 4A33A 4G94A 3HSFA 5EYRA 1RETA 5FKOA 5GADJ 2QENA 1PUFA 1D5YA 5JGFA 2QQ8A 2ZFUA 4SGBI 5M5YJ 1AYEA 2VEZA 4R9MA 3OYDA 2CTBA 4XLAA 2JUGA 3DKYA 3BZCA 1YG2A 1MNEA 2KZVA 3Q3SA 2EWBA 1TLHB 2RNJA 1NE9A 1TWHJ 2DMPA 5D5UB 1ULNA 2A6TA 1PYVA 3FMRA 1FC3A 2ZXHA 5IX3A 4UWJA 3NQOA 2Z1DA 3Q9VA 2K4JA 3BCBA 4YIRX 1H88C 4C9YA 4OC1A 3WC6A 4B6DA 3A02A 3K1MA 3M7GA 1ETXA 5C4JJ 3MRUA 2BE5F 2QQCA 4YWYA 1SD5A 1E3OC 5IY5H 3L00A 1FSHA 3KHXA 2R7SA 2DCEA 1LDKB 3NWTA 5J1UA 4B6ZA 4MFLA 5FRMA 1RNLA 1KONA 1ULMA 3V8IA 2P4WA 1IN7A 2GA2A 4E7HA 4BQOA 5FUYA 3G1OA 3R60A 2LFBA 4HPSA 2JWTA 2ZNYA 2XPUA 4B13A 5DCMB 4MI4A 4JK1X 1Y1WJ 4RAFA 2D5VA 1N75A 2ID3A 4P1WA 3KP5A 4EEFG 3WTYC 2DLLA 1DP7P 1ETYA 1DTDA 1G2HA 1YW8A 3EETA 2R7XA 1F43A 4BJ5C 2PIZA 5GCNA 3LSPA 1XJOA 1BBYA 1SAUA 2DT7B 2GXGA 2ZC2A 3GFMA 5KCMA 3C2GA 2PN6A 5K8MA 2VPRA 1XDSA 3GMEA 4GYGA 4BEHA 2HI3A 1FLIA 1PUFB 1SVOA 1IIDA 1NTCA 4U9ZA 4Q48A 4P4DA 2WAQA 4BQNA 2F5VA 3RIRA 3S9NA 3QWLA 3DPTA 4D0PA 1QQ9A 4KIGA 3AAFA 3BTJA 4W1UA 5D6FA 1YLFA 1X1CA 3GXOA 4PJNA 4AD9A 5AIPA 3L2UA 3HOXJ 4BXXJ 4R3KA 4MRIA 4M9SA 2VJ4A 4HF1A 3LL7A 3OYIA 1YFHA 4XSXF 2JK3A 2GVIA 2PVWA 1T0FA 2ZXVA 5C82A 2AFUA 3GLJA 1IY7A 4X8IA 4V19K 3IRRA 3TT2A 3K6GA 3R9FA 2WB1A 3CCQI 4L8AA 5KHDA 4B14A 2DO7A 1KZFA 2L54A 5GAEJ 4FUUA 5TISC 3SZGA 5IOYA 2K86A 2JJ7A 2E1MB 3IGRA 4CZZA 3HOTA 4IHMA 4MFKA 2LKSA 2MC3A 1VQLI 2QBYA 1UG0A 4CCMA 3VWBA 4AU7A 4DJAA 4LLGF 3VB2A 4KOVA 3IH4A 4M6XA 1X1DA 4DBQA 3CMAI 2K9LA 3JRHA 2DMTA 3FX3A 3CCUI 1Y1BA 2FE7A 2L9NA 4WXCA 3K4CA 4LB5A 3UEJA 4JZ0A 2JXDA 2JA2A 1LFPA 2E2HJ 1BW6A 1S8NA 1SFXA 2K27A 3EC4A 2NU2I 3PFYA 2DK8A 2MD5A 1RUOA 2VB6A 1I5ZA 3DPLC 4PK4A 2NU4I 2PJ8A 2VE9A 3AL0B 1FP2A 2VKVA 3SEKC 1CM0A 3SI0A 3H3ZA 3IIBA 5HVHA 1ZGJA 3BZ6A 1IW7F 3B02A 3IC7A 4KN4X 4Y17A 4UB8C 1I39A 2YNCA 1OFCX 3Q9SA 3OSGA 1O3QA 2BZTA 3ECOA 1BLLE 2F8HA 2OZHA 3BOQA 4G8XA 4Y3OA 2X7BA 1SGPI 3DDDA 3FH4A 1Q1VA 1I50J 1LQ1A 2VI7A 2CV1A 3B4VC 1TBQR 2UUZA 1FEXA 3RZAA 1I12A 4XRFA 4OIOF 4F93B 3E2IA 3BT9A 2JDDA 3CO7C 2A4NA 1Y1CA 3Q0UA 4FISA 1W7PA 3QPHA 3GYHX 2V1XA 2ZMEC 3DEWA 5EDNA 3TJQA 2OV7A 5HS7A 5J3LA 3L2WA 1XBUA 2DFHA 4P4EA 2CWHA 5FVJA 4QWQA 1YVKA 1VF9A 3TEDA 1XA6A 2AE6A 1OQYA 2EZKA 2PQ8A 2C6PA 1TIHA 3S2DJ 3DV8A 5ILUA 1Q2YA 2BW3B 4B09A 2IGKA 4XN3A 3IKVA 1KZHA 5JVTA 2VL8A 2UXNA 4M71A 2XVCA 3IAM2 5CLSA 4F92B 2PG4A 4N9IA 1M4DA 1XF8A 2L7KA 3FWEA 3WGIA 2R7UA 4LLNA 3CCVI 2P6TA 1HKQA 3GLLA 5FD5A 3U1KA 4AG7A 1LR7A 1Z0XA 3Q5FA 2Z3MA 2L3DA 3E6CC 1RTQA 3C2BA 1SD7A 4PSXA 2GLOA 2OJED 4PFPA 2P6SA 5LBQA 5FD6A 4M3BA 4U5YA 1AU7A 1REPC 2XB0X 4L5JA 3QPLA 4I0AA 1MBEA 1YW9A 4CSWA 2CW0F 3HKZA 4BS9A 5EF6A 1SGQI 2POKA 1PUAA 3PJRA 3BR3A 2P6AC 1BOBA 3KE2A 3GB0A 3V8LA 2EK5A 1R00A 1SVMA 1Y8RB 3W3CA 1TP4A 4ZZLA 3F8FA 3MEKA 2A61A 3HC7A 1YREA 3FRMA 1XGSA 3I59A 4BACA 3C1DA 1X1PA 3EPZA 2HFHA 3F21A 4NCZA 3ECHA 3OIOA 3CMYA 2VC0A 3SDBA 2E73A 4ZY1A 3S9MA 4M3SA 3QAHA 3JW4A 4I2OA 2OPTA 3Q0WA 4NBQA 5HI7A 1B87A 3B3SA 5H86A 4A2ZA 2Y2ZA 4CCKA 3R5AA 4LX9A 4R76A 4WXDA 4AUXA 5K5RA 1HKSA 2HDDA 3OL0A 2VN2A 4I02A 4E7JA 5JI6A 4RLQA 1OLTA 4P4IA 4MXUA 2IS1A 3R96A 2HNHA 2K40A 4A0ZA 3DLLF 1ZG7A 1K4TA 5EX0A 3C3WA 5DS0A 1K79A 4HNWB 2SGDI 1BI2A 3N05A 3VSLA 2DTRA 1VQ7I 4O6JA 3CC2I 4KICA 4GXOA 1C0WA 3JTGA 3SFZA 2VL1A 1YU6C 2RQQA 4AVBA 2AXTC 3LSTA 1H0MA 1O7LA 5ISVA 2P0WA 4CYCA 1YX0A 4GM5A 2M5XA 1MMGA 3VYRB 5HLGA 3MGDA 3GO5A 1Z8XA 1WWZA 4KOYA 4QLCU 2EPFA 4FWUA 2HOAA 4DGWB 1W0TA 4ZYHA 2HS5A 1X2NA 4EATA 3BI0A 2M7BA 3H36A 1J2XA 3I54A 3BZKA 2IEKA 2WY7Q 2VI6A 3IWFA 5C3EJ 4BY1J 2W0TA 1BI0A 3S15J 2HQNA 2D2WA 3DWLE 2VUMJ 1UJ8A 4II9A 1T08B 4DIQA 4KMFA 1K4SA 1DE4C 1FPQA 2KJBA 2KMQA 2OAZA 3IP4B 1YSJA 1NH3A 1ETOA 5LRKA 4V2FA 1OCZH 3CZ6A 3FSYA 1D1AA 1FSEA 1MT1A 5BNGA 2FVGA 3AKZA 2QMLA 1ZG9A 2BXZA 1QVUA 2Q0OA 3SEQA 2VQHA 3GFIA 1Z4EA 2GREA 1U5TC 3RKXA 1P9ZA 4DYRA 3KYLA 3Q0VA 5F08A 1B9NA 1D5VA 4IVNA 3KI9A 3PSFA 4A6EA 2MH9A 2W48A 1EH6A 3CUQB 1B72A 4M9ZA 4BYYA 5HVFA 2DJNA 1IY5A 1CT4I 3HSEA 3ISXA 3QPSA 1F36A 4JQFA 3V42A 3NFZA 5FKMA 1X2MA 1WFXA 5EEAA 1USTA 3GFJA 5DCMA 3OY9A 1S7OA 3CMEI 4E1PA 2IW5A 2BCOA 1GLNA 2A5WA 2CQXA 1Z6TA 1PP7U 3F8KA 3KR5A 3K0LA 4GO1A 4Z6YA 4PGGA 2FT0A 2FQ4A 3G2BA 2VOOA 4X0GA 5HNFA 5G1ZA 2R7RA 5M3FJ 4LJZF 1AHDP 2KDZA 2BOAA 4PXDA 1QRYA 1AOYA 3DF8A 2V6EA 1E0EA 1TWCJ 1Z9CA 1APLC 2YPRA 5EGOB 4MCPA 3JRFA 4MFEA 4L18B 3CUQC 2HKOA 3A9LA 1NSAA 1Z7LA 5L3DA 4HSRA 5CVJA 4A0XA 1U5TB 3OYGA 3TMOA 1LFWA 3QYEA 1XBTA 4CA0A 4OIQF 3UNGC 4NC8A 3K2KA 3I3GA 1KQ9A 5ICFA 1OZPA 2DOAA 3DU6A 4TNUA 3RYOA 2ARHA 2NS7A 1UHWA 2XRLA 1MD0A 3HTUA 4EGZA 3B3TA 4F9UA 3ZMVA 3ZMDA 1BI1A 2NMTA 1X3WB 4H6ZA 3U2RA 4XQFA 3OYFA 2C6YA 3SYTA 3TW6A 1IICA 1MMSA 2OB0A 1HW5A 2K02A 2ZEHA 3SXYA 3V38A 4CRZB 4I09A 3VODA 2HQRA 2DDAA 1N71A 2IL4A 3REOA 1R5HA 1R1UA 4X2TA 4L5EA 2EA2A 5HOOA 3TP3A 2QEXI 9ANTA 1JUMA 3R61A 4OWRB 2V9VA 3L1PA 3GX4X 1JUSA 1V1HA 3MN2A 3UOEA 3LSRA 5DD8A 2BO9A 3RI4A 4RS2A 2COBA 3HLPA 2ROWA 3FXMA 2BXYA 2K9NA 1MZBA 3ABMH 3BJ7A 2OQRA 3FISA 3OWTA 1GXQA 4KUMA 2K9MA 4XM3A 5HDKA 3GTOJ 4A12A 2EBJA 2RVCA 2O61A 2BUSA 5KK1A 1XMTA 4L0ZB 1UUCA 2QJ8A 4NC6A 3F22A 3CLQA 1K78B 4HF0A 2X6OA 4QSHA 4AMLA 1QZYA 2FRHA 1IGNA 3BR5A 1X3ZB 2XSDC 4OIPF 4BJ6C 2GKTI 3B3CA 5FLMJ 1G3WA 2CH0A 2X6XA 2R1IA 3NH8A 2XV4S 2ZMEB 4KYWA 4M85A 4O23A 4XN0A 3J81Z 3TO7A 5JR3A 1Z4RA 4G1PA 2R7WA 4AIDA 2Z10A 4IXAA 3IU2A 1HBXG 5HVQC 4B8XA 3OV8A 3FVLA 5L3FA 1I3QJ 4IQJA 1QZEA 4IOAF 1KQ8A 3I56I 4UVBA 4FTHA 1IU8A 1XOVA 1ETQA 3FK6A 3DPUA 1IN8A 5BWAB 3BDDA 4DYOA 4BHPA 4W97A 1ZTRA 4F55A 1I1DA 3RYRA 5ELYA 2ZPAA 2C6GA 3CMMA 2UZKA 1P4WA 4G7OF 1GYTA 2J8NA 3T5XA 2VXZA 3WE2A 1T39A 4ONUA 4KT5C 2VT2A 4H2KA 1W4MA 2CV2A 2O03A 4LGWA 4EV0A 4W9YA 1IC8A 3S9LA 2JA8J 5C44J 1BC8C 1SD6A 1X4OA 2OZ6A 3DFGA 1CE3A 4ZDLA 3V8KA 1WCMJ 2B63J 2OQGA 5EC4A 1XFOA 2FS5A 3FF3A 1ZAOA 2L9SA 2BY2A 5E3MA 3O8GA 4XOPA 4QC6A 2F5FA 2HOEA 3CXPA 5JVGF 2LRDA 4XKVA 3HGGA 1X58A 3EUAA 3W6JB 4EQQA 2AFXA 2F3CI 2EZHA 2E19A 2EIJH 1HQCA 2QVOA 4FX0A 1FTZA 1XX5A 1M4LA 2REEA 3T9YA 2IQ6A 5I0CA 1U78A 3FSXA 5AG6A 3LACA 3K4MA 5B1BH 4WK8F 3KEYA 2P81A 1KU9A 2XC7A 1LKXA 1WHUA 1BMOA 3EFAA 3DKWA 3L2CA 2ISZA 1F2PA 3ZPLA 3K4KA 2ELHA 4F52A 1TTYA 2QVPA 3B73A 3PB6X 2E34A 4OIRF 2DMQA 2YX7A 2Z9OA 4HYEA 2TCTA 1GXPA 2GXAA 1AN1I 4YIIA 2CFOA 3LSJA 2CUEA 5KTAA 2TDXA 3H1CA 4MMOA 3FEDA 4FD6A 4RM3A 3M1CA 3TOBA 2GXBA 2RDPA 1TOTA 7WGAA 2KRFA 1WQ2A 4BQAA 1R36A 2M3AA 4JBAA 1I1SA 3A0BC 1YJ9I 1YLEA 1W5SA 3HG9A 1LOKA 1Z77A 1KUXA 3LOCA 5HLTA 1ERDA 1P6RA 4PXEA 1L0OC 2D4PA 1V5FA 5F6FA 3HRMA 3H5AA 3ISPA 4MFZA 3X2QH 2VODA 1MSFC 3CDHA 1WKMA 2X6YA 3NAUA 4RBOA 1PTQA 5F09A 1K78A 2M34A 3BTCA 1HF0A 3QYBA 1ODDA 4EM2A 2QSHX 2KKOA 2O8XA 2DI3A 2JSCA 2AFMA 3GZNB 2J5OA 3A2KA 2FNPA 2CQ7A 2EH3A 2JN6A 1A04A 3MAJA 3K70C 4G6TB 5FLXK 1E17A 1N25A 3JTKA 4E0AA 1OCPA 4B10A 3IUOA 2B7EA 3KP4A 3T8TA 3R5CA 3ZR8X 3BPVA 4M3DA 1OCTC 2YU3A 1R5GA 2MYSA 3QP6A 1LJ9A 5JH9A 1RESA 4Q5SF 3E97A 4KOXA 2M0CA 2X4HA 3KZIC 2XAJA 2PJRA 3SGQI 2PRQA 4IRGA 4MHPA 4S0HB 4E6KG 1AKHA 1Y0NA 2BVLA 4QTRA 2X1EA 2E2JJ 1WGCA 1GV2A 2L7XA 1SEUA 4HPQA 4F91B 1IRZA 4IK2A 2GLFA 1X3UA 5HNHA 1R79A 3BWGA 1HSJA 4NGRA 3MWMA 5HDGA 1U9NA 2QLZA 3WE3A 1TNSA 4NGTA 4X5KA 2XDVA 3HUGA 3JTHA 3WODF 2EV5A 2GIVA 2DYRH 2GAUA 2ICWG 5DDGA 2BUEA 1F57A 3DQVC 4RI1A 3J80Z 1ACIA 2DA2A 1GHCA 3UKGA 4A94A 2FA5A 3LA2A 2W25A 6PAXA 4E8OA 3W6VA 2VBXA 3KZYA 1IF1A 3S6GA 4A30A 4C2MJ 4YRVA 4HRIA 3PEIA 2OH1A 4LOCA 5LRGA 4E2AA 3JRUA 4CAEA 3HZJA 1T98A 5KAIC 4OADA 2F2EA 1ZREA 3FECA 1PTRA 3WHBA 3F0CA 3IWGA 1JKRC 4I76A 1FMVA 1Y0UA 2HDCA 4HDUA 1AMPA 4KIBA 4UFXA 4HDVA 4ZX8A 4R8HA 1JKPC 2Q43A 3MZYA 2EFPA 2KCXA 1JT6A 3T0YA 4XNFA 2Z3KA 1ONVA 2JEWA 4GDFA 3C2HA 5EBVA 4OC5A 2HYJA 2EZLA 1OMTA 1Y7RA 3B8GA 1IDYA 2B9SA 4BUPA 4YFNF 4KOTA 2DMUA 3G3SA 5CPRB 3WTSC 2GQQA 3COAC 1UAAA 5HMNA 2V8GA 3J81K 4ESBA 3GZ5A 3W6KB 1USSA 3KEQA 2E1CA 2MW8A 3UR3C 4OVOA 4L9MA 1YS7A 4MQ9F 2L4MA 5IV0A 4M3FA 2IJLA 1KU7A 3OXGA 4XIDA 1LANA 2QPOA 4MHNA 1MNDA 4A3EJ 4HX4A 5B1AH 4MFPA 1ZH5A 1ETKA 1AWCA 2F5EA 2R7TA 1WWXA 1HDLA 3PB8X 2PBIA 4RLFA 2QM3A 1Q9BA 1LFBA 2DA6A 3PO2J 1D1BA 4EJVA 2ZEGA 2PJ6A 1JE8A 1YX3A 1W5TA 5CBMA 2B5GA 2H8RA 2W84A 5L3EA 2CUFA 2H09A 2M30A 1TKJA 2QIRA 3ZP5A 2NU3I 3M07A 2WC2A 4KT6A 1W7PD 3FYNA 3OOPA 1O57A 3KP6A 2ATRA 1HDUA 1WJFA 3FDYA 1G59A 1ZN2A 5LRJA 2L9VA 2V4JC 2R93J 2QQ9A 3HKZN 1VQ6I 4JX5A 3HOWJ 1S3ZA 3PB7X 4CYQA 2KL4A 3W6SA 2PR8A 4EJTA 1KYZA 1Y0RA 3U9GA 4CS0B 1CG2A 1R5ID 1ZLJA 2IMOA 3C18A 2LR8A 1TBOA 1RXTA 1AA7A 2NVTJ 4MFDA 1VZ0A 4ITVA 5E1WA 1SGRI 2PRBA 2DT5A 4GYIA 2MLGA 2VC1A 1TC3C 2CFXA 2CNSA 4BAYA 5EMIA 3R6SA 4MHDA 4C2YA 3G1MA 5IOZA 2B0UC 1XC5A 4YFXF 2RN7A 3FXQA 1OMUA 1HDQA 3IEHA 3AG3H 3LA3A 3P9KA 4A3KJ 3L2QA 3QRFF 1CGPA 2J8RA 3R9EA 4BBHA 4WCGA 3E6BA 5HODA 2ELKA 3OS1A 3S32A 1E2XA 3HOYJ 2KISA 2RQPA 2F4IA 4C30A 2VOPA 2O3FA 2V8VA 5M5XJ 3E0JB 4XOTA 5J8CA 2IP2A 1W1WE 1WJCA 1GHEA 5F1JA 3EQLF 3IV5A 5ILSA 1K7UA 2KMOA 3AL0C 3A1YA 1YHQI 2GOXB 2LG4A 2EV6A 2EK9A 2X85A 2LMDA 4CRYB 3PRTA 5AGEA 5F04A 2FUG2 3K1NA 4E7IA 3UGLA 2XROA 1RFHA 4KLVA 2Q04A 3RO0A 3I4NJ 2XRNA 2BHYA 3TKYA 2CXAA 4X3RA 1ETVA 4CDGA 2SGEI 3PFIA 2OOTA 4EVYA 3KQXA 4HX7A 2STWA 4JX4A 1O3TA 2UWMA 2I79A 1X1BA 2L4AA 2Z33A 4MCRA 2M4GA 3DR8A 1B6AA 2G7HA 3PO3J 3R9GA 1VKCA 2HPMA 1RR8C 5LRRA 4DJLA 3FHZA 3KHZA 5CCLA 2LVSA 1QZZA 3QPTA 4MGRA 2GFQA 4CGNA 1ZG5A 3OYMA 3K1PA 1YK3A 2E2IJ 1XS9A 4KNYA 3G1LA 3ZQQA 1ARMA 1EV7A 1MBJA 1LUJB 2WPXA 1R3NA 2FIAA 4L9TA 1SGYI 4QVTA 3M9AA 3RSNA 2LD5A 3RZDJ 4OC0A 2OZUA 2CF4A 1IYKA 1MMAA 2X6WA 4LG0B 2L2OA 1T6SA 1U0JA 4MEYF 5KAFC 2NS0A 1E3HA 2E5NA 2K9SA 2ZB9A 4YIFA 5BOXA 2N71A 4K30A 1R9TJ 5EZGA 2CY2A 3NE8A 2PJ2A 4XK4A 1I1GA 1DS2I 2Z3PA 2E35A 4PK2A 4U87A 2GU2A 1CT0I 5LYFA 2Y0SN 2Y9YA 3LA7A 1V55H 2OF7A 2FNFX 4A3CJ 1TWFJ 1RIOH 1FOXA 1LRZA 2IGNA 2IA0A 2VQCA 3FMQA 3GWZA 3RPQA 5K1YA 1NHAA 5HQ8A 4UNOA 2MH2A 4KITB 1Y9WA 5JM6A 1ITYA 5D5WB 4UIAA 3LNQA 3UY5A 4KVOE 4A2UA 3MMYB 4A39A 2XAUA 2JPBA 1BN5A 3NE7A 4RDUA 2KIMA 4GCVA 5F0HA 3E1SA 1LVAA 2KIQA 4CYCB 1P4AA 4UUTA 2GKVA 2NSMA 3GKRA 2K3FA 2GZWA 4QPOA 1BIBA 1P7JA 2EK8A 1DPRA 2ECCA 1TXRA 3BJ6A 4I0BA 3J7AY 2VKHA 4Q47A 5CVRA 4UEFA 1Q2DA 3IH2A 5J1QA 2HU9A 1PCEA 4OKOA 1ARLA 2JA1A 2XSJC 4EVIA 4RM2A 2FL4A 1DGWY 4IL6C 1XGMA 3CTAA 3CZXA 2FU4A 1R4NB 4FETA 1Y8QB 3PM1A 1CP7A 3SJFA 1YS6A 1OCOH 2FEZA 4L5IA 1BA5A 3GOXA 3D3SA 1V1IA 4HLXA 1Z67A 2JQ7A 3CCYA 3F8BA 1W7PB 2XGDA 4YEJA 5K7FA 3J80K 1UHAA 2DQLA 1YRNB 5F27A 4A3DJ 2QECA 3CDIA 5CQEA 4D5FA 2R8VA 1M8CA 4C2UA 1XX6A 2ELJA 3I58A 4IHYA 1Z8LA 1N78A 5H84A 4IHSA 1OYIA 2HGCA 1YLOA 3HUVA 3WTVC 5B3SH 4I01A 2Q0YA 5CJ9A 4UUSA 1YMEA 1A2ZA 4L89A 4RS8A 2DA4A 2EILH 4UUSB 4BDZA 4KUAA 4OIDA 3GEZA 3WC7A 4NQWB 3D5RC 3E6DA 2EB7A 2CTCA 3H4QA 3ZMUA 1CJWA 4DZJA 3PNTA 4LFUA 1FBSA 1DPUA 1LEAA 1ZLIA 2PLYA 1SQHA 2R7ZJ 5D5VB 5LYLA 5I4MA 4AIKA 2PJ9A 3CT9A 3KZWA 3HH2C 1FAQA 3VH9A 3ZQFA 1IOIA 4JWPA 2NOGA 2V1CA 1MIJA 2WTEA 5F0CA 5EZHA 2JEVA 3PGPA 4BHBA 4HNYB 5FUWA 2V1UA 2QF7A 2HUZA 4PDKA 1K7TA 3BLNA 3JAMZ 2XPWA 2FNAA 1G3YA 4U0WA 2BOLA 1T8IA 4NB5A 2NVUB 3N4MA 3FIXA 2E60A 2LP0A 4M73A 4B3AA 1CPXA 3GZ6A 1IUFA 2YUUA 2XB5A 1JKOC 1ZR4A 3MKLA 3IKTA 1MGTA 1U6MA 7CPAA 2VE8A 1R4MB 4BBRJ 1P4XA 3V8JA 5CVVA 2DYSH 1WH5A 2JZYA 2ZW6A 3WABA 4A31A 2CJJA 3CQZJ 5THWA 2J9AA 2K9HA 3BR0A 4AC0A 3T8RA 2WBMA 2JDCA 2MABA 1ZR2A 3GTKJ 3R95A 2B8TA 4AXVA 2V6CA 2CW7A 2LOOA 2DW4A 4OMYA 2LLKA 1QU3A 1Y9KA 1IN6A 2FCKA 1EA3A 4EM1A 1K83J 3IWWA 5H6RA 1UHSA 2HB6A 4NGMA 1RI7A 4XMYA 5FFZA 1JJ8C 2DXIA 1ELMP 3PB4X 4G7ZF 2Y69H 4MHYA 1NMTA 4U0VA 5K8OA 2P7CB 3OS0A 1OYWA 3L2RA 2G3AA 1B6BA 4AVPA 4UWIA 4MHGA 3HJEA 5JHFA 2OA4A 3WGHA 3HM5A 1S7KA 4PQAA 2E1NA 4RB1A 4AG9A 1J9IA 5ICCA 1GUUA 3M8FA 4XLEA 4UCMA 2ADUA 1M8BA 4P4FA 2ZCWA 2G9WA 4FAIA 3VDPA 4HNUA 2Q4YA 4UA3A 3GLXA 1LFUP 1FOKA 4LITA 1K61A 3VARA 5LHIA 3S2WA 3ASOH 2GANA 5E18F 2CWFA 1MMNA 3FKIJ 2PJPA 2PJ0A 4AVAA 4MY3A 1Z2IA 1TQMA 4ZI6A 3LSHA 2K7LA 2IGMA 3RZOJ 1M1DA 3H0DA 3PIOF 4IF4A 2ZXJA 3PP9A 5A28A 3PUBA 2W82A 1YRNA 3D7GA 4ZYGA 2VZZA 2BV6A 1TWAJ 3DTKA 2I8DA 1GVDA 1U5KA 3KY9A 1Z5RA 2X0LA 4CGPA 1FWZA 1KMAA 2WAQN 3JRGA 1CHOI 5JHWC 3WT4A 5LGTA 3CO6C 5KVRA 1UVFA 1WPKA 3P9CA 3P2HA 1PVEA 2H5MA 2EFQA 2A69F 3BR6A 4UV8A 2KCWA 5JPHA 5IYCJ 4Y49B 4AYBA 1X1AA 3PL8A 3M8EA 4R1HA 1ZRCA 4H6UA 4I7HA 1S5LC 4B48A 2ME6A 3RCOA 1HDPA 3ZQCA 5C88A 2VIXA 2Z5UA 4NGPA 1VGYA 4B5PB 1QHHD 3K4LA 1FBUA 2KIFA 4NGSA 4OC4A 2X1CA 2RC4A 2JZMA 4ABZA 3H35A 3IH3A 4PGHA 3CP8A 4E7SA 1U8RA 1N13A 5FO5A 4KFCA 1DDNA 4M6IA 1QVTA 2X48A 3K4JA 4N0BA 3F23A 3GCMA 4Z2YA 2DF5A 2JVGA 3RQIA 2LY2A 4J3GA 3B35A 2DBBA 4ZZDA 3DGVA 2W85A 1B4AA 3FXTA 3EYIA 1VI0A 2DOFA 4KSAA 2L7MP 2QQ0A 2NS8A 1UFHA 1IJWC 1TT0A 2JA5J 4MY0A 4OP4A 2X9DA 4H89A 2IGOA 4FQGA 2Y75A 2IVMA 3F8MA 5K7HA 3PNVA 3S3OA 4A3BJ 5J8FA 1RO5A 2M45A 1FYBA 2E5ZA 1CSOI 3HOSA 1QSTA 2Y30A 2QYVA 4BKXA 5F0FA 4PJ0C 5HS8A 3TCVA 3BQYA 2OTLI 2AXLA 5ILVA 3HL2A 2VBZA 4CZCA 4HNVA 2Q2EA 2HEOA 4CGLA 5AONA 5AG7A 5L3BA 2HQ5A 2XPVA 1KA8A 1KU3A 2KIUA 3F3XA 2IPQX 5E1XA 1LCPA 3ABUA 5BPDA 2ZW4A 5E79C 4RGUA 1MDMB 2QBYB 3PQKA 4BQQA 2MGQA 3DBLB 2VT3A 4LIVA 5IYDJ 4PSWA 2UXXA 3BXMA 4IQ4A 4QUSA 1RUNA 4ZTJA 2DFFA 3AG4H 3CDLA 2L7FP 2LF8A 4FD4A 4UCPA 1LNWA 4HLYA 5D8LB 1EF4A 2XAFA 2LC2A 5M3MJ 2DT6A 2DFIA 3WTZA 1SMYF 1PYTB 1IV8A 2HVSA 4YGOA 4BE1A 4R79A 5DM7F 3QQAA 3FF5A 3D00A 1U5TA 3FZVA 4AIHA 2ACJA 3PZJA 2LY1A 2O53A 2YNEA 2Y31A 3R0JA 1P9GA 1VQ9I 2DDBA 3ZQIA 2LB7A 2ZOGA 4JOMA 2ZO4A 5CQGA 5IT3A 1I6HJ 4G6QA 2ANPA 3GVAA 2JBJA 4II2A 2CUZA 4CCLA 3HBLA 3M1EA 1K6OA 3FIWA 5GAHJ 4C2TA 2WPWA 4Y49C 2PCUA 1XE4A 3ULQB 3EUHC 2M8EA 5LD2C 1PPFI 1R58A 2ZKZA 1RR7A 2CQNA 3K9TA 4MQVA 4N4OB 2SGFI 3O2PE 2ODFA 1P4NA 4LG0A 1OJLA 3M8JA 4HSTA 4PXBA 4WF2A 3S6KA 3RPUD 5BMZA 2HOTA 1JTXA 4NGQA 3GW2A 4P4BA 1UMQA 2GE3A 2Q2EB 4BBSJ 3OSFA 4BHCA 3T8WA 5DV5A 5E8GA 3LSKA 2CWGA 1G3SA 3TE4A 2B3VA 4WP4A 2PJ7A 2EINH 3IFEA 5IP6A 1J5YA 2KLOA 4KS9A 2WAEA 3CP2A 1XCBA 4PXCA 3HOZJ 4UBRA 4RAZA 1FARA 2D45A 3ABTA 4M6YA 1CF7A 2E5RA 1Q2CA 4XSZF 4CICA 1ZRDA 2E36A 1ETWA 3KKWA 1S3JA 5IP7J 3S3MA 4JYWA 1BPNA 1OKRA 2QQDA 4G9YA 1XMAA 1OCCH 1ENHA 5DCFA 2EWNA 4LLLA 2LKXA 2ENNA 2KJCA 2IBDA 3TL4X 4NUBA 1D0ZA 4HX8A 1ORKA 4C3HJ 1YVOA 2Y0MA 1NXUA 3HPGA 1QSRA 1XSVA 1FYMA 3OR2C 5J1YA 5A2QK 3R5DA 4OIWA 3H92A 4JCVE 3OL3A 1K4JA 3MCZA 2OD1A 4X6AJ 4PV6A 2PR1A 5IP9J 3CJQB 3FC3A 3IC1A 1MKMA 1R0RI 2C27A 4JD6A 3HYIA 4FX4A 3DU5A 4EJUA 2HXIA 1WI3A 2E7XA 1YX5A 3QOPA 4J19A 1ON2A 4FD5A 3OWCA 2K9QA 3A03A 2IS2A 1YW6A 4M6VA 2QA4I 5F46A 3TQNA 2DQRA 1XB4A 5HS9A 1MK4A 3F0AA 5G21A 3A01B 2V79A 3I4PA 5JHUA 5LGUA 3R5BA 4JXQA 3OL4A 1UWYA 1ZK8A 1YTPA 2M4KA 4IAVA 4YG2F 4HNTA 3HHHA 3V7RA 3DTEA 3UGDA 3VYSB 2WAFA 3JSPA 4H0EA 2B5GB 4ZH4F 1KBFA 4F0YA 5TGTA 2O9LA 4R6TA 2CNMA 4ZY2A 3BJ8A 2HC9A 1QSMA 1W5CC 1A36A 3IO1A 4MCSA 2E1MC 1B1BA 2RB7A 2LF7A 3BJIA 1TBNA 5L3GA 2PC1A 1HA8A 2M8GX 4FCYA 3DSBA 2WY8Q 2OR4A 2J5PA 5D4RA 2ENZA 2EA4A 1TQIA 3H9JA 1JI8A 2YU9J 2BY3A 2F6CA 4CGZA 5CNPA 4N4NB 3FXKA 4Y15A 3H5RA 1SMTA 1Y56A 4B5OA 3TTHA 2IAIA 2KT0A 3QU3A 3D5LA 5GTHC 4PZJA 1O3SA 1CP6A 5K5OA 4OAYA 2G0BA 2OZGA 4MO7A 1OVOA 4KVXA 2NXNB 2XKOA 3KIOA 2K5TA 1IYLA 3ISZA 2ZEPA 2FMYA 1B8IA 4IHXA 3FXLA 2JLMA 1JT0A 3PDNA 2VQYA 2WCYA 4PUSA 3SFIA 4C68A 1RKTA 2DIPA 3JAMK 2R7OA 5FLVA 2I00A 3G73A 2HTJA 1BW5A 3CCMI 1JTYA 2ZFWA 2CJSC 3BJAA 2M1BA 1IW4A 1D1CA 3G3ZA 1PJUA 2VJIA 3A4CA 2K4BA 2OBPA 4UEEA 3E5QA 1IXRC 1G6NA 2G0EA 2NU1I 3DBHB 2QWWA 1Z05A 1W36D 4C7HA 2Y0SA 3H3UA 4MCQA 2Z2SB 4R3LA 2B58A 3DXJF 4J00A 2RKHA 4DBRA 4F8ZA 4XLPF 1FT9A 2N1AB 2EBIA 3BG5A 3GTQJ 4XPDB 5IB9A 2WA0A 2V1CC 2NU0I 1Z2LA 4EMEA 3W91A 3CXLA 2JTVA 1HPTA 2H1LA 1LB2A 1MMDA 4A3FJ 1JHHA 1HEEA 2N17A 1IGBA 1QPIA 1G8XA 3HUGB 4B5PA 2X3TA 1NG6A 3M3YJ 4GRIA 2ZEEA 2FOWA 4JXRA 1IG7A 1OCRH 1I27A 2XKPA 4M72A 1PUEE 2LBFB 2GWRA 2NNNA 1BM9A 1X74A 3L9FA 1TIQA 2JPCA 4RGXA 2LTPA 2ZXIA 5E3NA 2AS5F 3EY5A 3P2FA 4KSFA 2V1NA 4BGDA 1SFEA 2CU7A 3NA6A 4BXUA 4BXFA 5CCMA 4XRSA 2Z11A 1KU2A 2A3SA 5KNLA 2LYCA 2O4HA 1R6RA 4UY8I 2FBIA 4L9NA 1X4SA 4KUBA 1XRYA 5FJ8J 1LAPA 2ZENA 1MJ9A 4XPDC 1Z8TA 2Z0ZA 3TGNA 4CO8A 1NG7A 2I5UA 1K6YA 3FXOA 3LFKA 3WTXC 1ULKA 4R7MA 5B5EC 2JMWA 3M4OJ 2AQEA 5LYIA 2BBYA 2M5WA 1HJAI 3K4NA 4UB6C 2DJIA 2KMPA 5D8NA 3RQ4A 2W4SA 1HSTA 4BY7J 3I53A 2DK5A 4BE0A 2EIKH 2P8TA 1W36C 1M1EB 3MKYB 1WTJA 3NH4A 4EJOA 1L0CA 2QSGX 1HW2A 3FXRA 3N7ZA 1MBFA 1YR0A 1VQNI 3CPXA 4R8FA 2N52A 1PDNC 4PFOA 3NRVA 5E8IA 1A6IA 2EUIA 2DA1A 4WJBA 3OR1C 4BL0B 3E7LA 1CGJI 2MBFA 4AVZA 2SGQI 1QQIA 1FMWA 4IPAA 4UCNA 5LEJA 4A5MA 3S1QJ 2VJJA 3DEUA 3K4BA 4PJJA 2VKDA 4ONWA 2LBFA 1E3PA 4KIFA 1QGPA 1H8AC 2FBKA 4IRIA 2FMLA 2IT0A 3D66A 4PPZA 3EO4A 3VSKA 2MC4A 1R49A 2PVVA 4KOSA 3H9GA 3P5JA 2OD5A 4IO9F 5DTDA 1S60A 4PCQA 2ORWA 5L3CA 4NFRA 1EE3P 4HG2A 2CQQA 4CAXA 5FFXA 1CGII 1QMUA 4P9FA 1J4JA 4D7NA 5HLHA 1NK2P 2VBQA 3GUXA 2YUSA 3IWEA 3LFUA 4MTDA 3ZRGA 3BY6A 4KSIA 3A0HC 5FKNA 3OYCA 4ENNA 2F5CA 2F4MB 1SFOJ 2QYOA 1UB9A 2DODA 5FUVA 1BPMA 4QB9A 5G20A 4ZYEA 2J9RA 2O0YA 3TDUC 1J09A 3ZOBA 4KISA 4NXYA 5HXDA 3GBGA 3HSRA 3CCRI 3FM5A 2O8KA 3SGBI 1BIAA 2RAEA 3UGIA 2Z3NA 4XKWA 1XSXA 1LVKA 3PQJA 5CVIA 3L2VA 1RRJA 1TUSA 4HNXB 4M6HA 5LFAA 1YITI 1ZG3A 1SD4A 4P45A 3CUQA 1B72B 4Q7AA 3OVOA 4Q38A 2REFA 3PNYA 1S5KA 3K70D 2FE3A 2B4DA 5D6EA 1XPXA 1P0HA 4QPQA 3ZMTA 3HIFA 4ZJZA 2X51A 1H9TA 2P5KA 3ASNH 4RGSA 4XKCA 3ZQ7A 4D9JA 3WTUC 5FRNA 2L8EA 2HVRA 5J47A 2FXFA 3PFOA 3N5FA 2VASA 3SJGA 2L01A 4CGMA 3MN8A 4D1QA 2A07F 4LD5A 5B66C 1S7AA 4XONA 5F1RA 1YTYA 4XPLA 3HXLA 2XGEA 3V7SA 5DUIA 4A3LJ 4Y13A 4A93J 5E3QA 4WWCA 3SI1A 4RB2C 1IRGA 5E17F 3LODA 4KLWA 2CMPA 3D7FA 1PJRA 4ASNA 4RAYA 4C2ZA 1JKQC 1MBHA 3FMSA 3JVNA 4HKFA 1CT2I 1YYVA 1KUYA 2O7OA 3NWSA 4I98B 1WGTA 1A6QA 2HZTA 2D1HA 3H0GJ 3PIPF 1PP8F 3S14J 3RNZA 3ZZIA 3OIQA 2YNCC 3AFHA 1F1ZA 1TWGJ 4UFWA 1WJ5A 5CVUA 2Q1ZB 4DZPA 4DYQA 2H27A 3F5BA 4ZX9A 3H3VK 1TT5B 3JRBA 2P6EA 1IN4A 1VHSA 4A24A 1M44A 2JYYA 2HQYA 2HKXA 3BG7A 4P5OA 3WU0A 4ORFA 2DAOA 3RKWA 4XICA 2XRCA 3LWFA 2JW6A 4MTEA 2JRTA 3S16J 2AO9A 4P4JA 2ZXWH 3ZN1A 1LR9A 3HRUA 3OYAA 1STZA 4AVCA 1VNDA 2AFSA 2O28A 2V8HA 3OYLA 2QGUA 3K69A 1Y0YA 3ROUA 1XDUA 1F5TA 4C2XA 2ELIA 3MKZA 2B4DB 2KMRA 2BY1A 2F7VA 4P9UA 2JA7J 2IRFG 2JUCA 3H8EA 5E96A 3ZGKA 2VXDA 2FD5A 4KN7X 5CKTA 4XRMA 4HV5A 4RB3C 2RNGA
chains in the Genus database with same CATH topology
4CHUA 1R1VA 1S7LA 4LUAA 4XNHB 1G3TA 4UVAA 1WK4A 4IHTA 4S04A 2BEOA 4G6DA 1HKTA 4CYNA 3RDIA 5HH1A 2EVNA 2MLKA 1ULYA 4FT8A 4FHTA 4ESFA 3HHGA 2VXKA 4U9YA 5DUKA 2FQ3A 5EEHA 3W6XA 5ERIA 1YQAA 2HR3A 4MBUA 1BI3A 2PEXA 3F8CA 1J75A 3GUDA 3QU6A 3NEUA 2P5VA 4ESJA 1FX7A 3R0AA 1QSNA 2EFWA 4N9HA 4P55A 3KCCA 1IAWA 4HW0A 4ZGYB 4YRHA 1FYLA 1ZYRF 1YGHA 4NQWA 2LDUA 1YIOA 4UFVA 5IB0A 4KORA 4KVME 2Q4VA 2BYVE 2Z3OA 4R57A 1OPCA 1IB1E 1OR7A 5LGNA 3O6BB 3WR7A 2FSWA 3GF2A 3WTTC 1ZO0A 1D8JA 4QBJA 1T38A 5LLQA 1JGSA 3SXOA 5FLXZ 3CLOA 2ESHA 2W57A 3WTUC 1BC7C 2IA2A 3SZPA 1Z7UA 2CYYA 1OMIA 4U7BA 5J6XA 2HYGD 2R3SA 2J8MA 3E5UA 4S05A 3H5ZA 2CWEA 3IWZA 4IRHA 3BJOA 4HBLA 2NNYA 5H20A 5F64A 5D4SA 3SXNA 4RGRA 2PSWA 2QQBA 4KMUX 2OU2A 2QQAA 3RTRA 4OOIA 1D8KA 3EYYA 3RJPA 5LEKA 4YFJA 2VBYA 3CXSA 2DPTA 4CGOA 1EH7A 3DNSA 1U6GA 3KZZA 3QB8A 2ZMEA 4HZFA 2D1VA 3VEPA 1PU9A 2VBWA 1ZARA 3RPUA 3SHPA 2R7HA 4WX9A 3HTSB 4NHJA 1O7FA 4CYPA 1ON1A 4XLNF 4KDPA 4UV9A 3KP7A 2L02A 4IUSA 2Z99A 3E5XA 2FSRA 4ZBGA 3KLOA 3VFZA 5FB2A 2CO5A 2STTA 4C7IA 1WSUA 1BOAA 2M87A 2LNBA 3GY9A 4L0YB 2ZBKA 4CYDA 1KYWA 4MEXF 4BNCA 4K2EA 2G3TA 4IJAA 3CJNA 4XNHC 4OAEA 2DPUA 2QZ8A 1DUXC 1ZG1A 2PFBA 2PMUA 1FBQA 5ICGA 1J59A 1XGOA 2FIWA 4F0XA 1F4KA 2Q7BA 3P7NA 4KZTA 3FB3A 1XCVA 5E20A 5F48A 1H9GA 1FNNA 2A68F 4MJ8A 2JT1A 1LDJA 2YNDA 5KTCA 2YGWA 3RKYA 1YO5C 1IN5A 2WV0A 1KGSA 3MEXA 3FNCA 3C7JA 4ON0A 2WUUA 2HTSA 3BROA 5FGMA 5LRSA 1P92A 3SHFA 2O6GE 4U7DA 1J7KA 4HQMA 1MDMA 4CAVA 3FXUA 3U1DA 3F72A 3MZHA 2A5YB