2NU0I

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i, and tyr18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTWEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
rcsb
molecule keywords Streptogrisin B, Protease B
molecule tags Hydrolase
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu0I00
2SGDI 3HH2C 4SGBI 2XRCA 1CGII 1IY5A 1UUCA 1FYBA 1DS3I 1PJUA 1SGEI 1HPTA 1OMTA 2NU3I 1UVGA 2OVOA 1H0ZA 2NU0I 2F3CI 2M5XA 1PPFI 1AN1I 2GKRI 3SEKC 5DAEA 2KMPA 1CT2I 2SGQI 1HJAI 1BUSA 2KCXA 2ERWA 3TJQA 2LEOA 4GI3C 1LR9A 1MT1A 1CT0I 1NUBA 1SGQI 2KMQA 1CSOI 2GKVA 2V53A 1Z7KB 3QTLD 1DS2I 1SGDI 1LR7A 1SGNI 1KMAA 1TUSA 1CGJI 1OMUA 2P6AC 2JZMA 4OVOA 1HDLA 1TURA 1TIHA 2N71A 3OVOA 1M8CA 2KMRA 2B0UC 3SGBI 1Y1CA 1CE3A 2NU2I 1OVOA 1IY6A 1BMOA 2JXDA 5JHWC 2SGPI 1M8BA 1SGYI 1Y1BA 3SGQI 3B4VC 1CHOI 2ARPF 1YTPA 2JYYA 1PCEA 2KMOA 1N13A 2GKTI 1TBQR 1IW4A 2SGFI 2SGEI 1CT4I 2N52A 2QQDA 1SGRI 2BUSA 1LR8A 1SGPI 1TBRR 1TGSI 2WCYA 1R0RI 1UVFA 1YU6C 4HGUA 2QQCA 2NU4I 2NU1I 2N17A 1OYVI
chains in the Genus database with same CATH superfamily
5FUVA 2SGDI 3HH2C 1X4SA 2Y0MA 3E59A 4SGBI 1V1HA 2JA1A 2X52A 3KY9A 1MJBA 2XRCA 5E3PA 1CGII 1ULKA 1IY5A 1UUCA 1R79A 1WKXA 1KBEA 2QPOA 4A24A 1FYBA 1DS3I 3CXLA 1PJUA 3OXLA 1SGEI 2ORVA 1HPTA 1OMTA 2NU3I 4L9MA 2J9RA 5EX0A 1UVGA 4AMLA 1KBFA 2OVOA 4DNCA 2NU0I 3BJIA 2F3CI 2M5XA 3R5BA 1H0ZA 2GIVA 1PPFI 1AN1I 2GKRI 3SEKC 2UZ3A 5J8FA 1ULNA 3UFFA 1ULMA 2CWHA 5CCMA 3TO9A 1HDLA 1Z2IA 3OXFA 3TO6A 5E3RA 1PTQA 5DAEA 1CT2I 2KMPA 2SGQI 1P9ZA 1HJAI 3E2IA 3TO7A 1BUSA 2KCXA 3TOAA 2ERWA 1WGCA 3TJQA 2LEOA 3QWPA 3QAHA 2ODDA 2L8EA 4GI3C 2E5RA 1FARA 2WVJA 2X3TA 4JCVE 1LR9A 2UVOA 4MPIA 1MT1A 1CT0I 1NUBA 1SGQI 1UHAA 2FNFX 2KMQA 5CCLA 1CSOI 1FY7A 2GKVA 1Y8FA 2J87A 3UGIA 2V53A 3TOBA 1Z7KB 3QTLD 1K7UA 1DS2I 1SGDI 2N1AB 9WGAA 3OL0A 4WP4A 1LR7A 3R5CA 1HEVA 1XX6A 2ENNA 1Q9BA 1W3SA 1SGNI 1KMAA 1TUSA 2A20A 1V1IA 1K7VA 2GVIA 1CGJI 1OMUA 1S20A 2CJSC 2ORWA 2V1CA 2VRWB 3MEKA 2P6AC 3VE5A 2JZMA 1TBNA 1WGTA 3D00A 4OVOA 1TURA 2CWGA 1TIHA 2N71A 2PQ8A 2QQ0A 3OVOA 3FC3A 1M8CA 2KMRA 2W0TA 3VDPA 2B0UC 3SGBI 1Y1CA 4UXHA 3UOEA 1MJAA 3OXGA 1CE3A 2WGCA 2CWFA 2NU2I 1OVOA 1IY6A 2ENZA 1BMOA 3UEJA 1XBTA 2B8TA 2JXDA 5JHWC 2SGPI 2RC4A 5FUXA 1M8BA 1PTRA 1SGYI 3R5DA 3UGLA 2E73A 1Y1BA 5E3QA 3FSXA 2QQEA 3SGQI 3B4VC 1WTJA 1CHOI 2K9HA 2OU2A 2DKVA 2ARPF 1YTPA 2JYYA 1K7TA 1PCEA 1U5KA 2KMOA 2LUYA 2DB6A 4B6DA 3PDNA 1FAQA 2JW6A 5HI7A 1N13A 2V1CC 1NXUA 4E1PA 3GOXA 2GKTI 1TBQR 1IW4A 4FKDA 2SGFI 2SGEI 2RIJA 1CT4I 4UXIA 2ROWA 1RFHA 2YUUA 5HQ8A 1TBOA 2N52A 2QQDA 1SGRI 2BUSA 3RU0A 1VDDA 7WGAA 1W4RA 4UXJA 5FUWA 1LR8A 1SGPI 1TBRR 2LB7A 2YQPA 5FUYA 1TGSI 1XA6A 2WCYA 5EX3A 1R0RI 1TOTA 1UVFA 1MJ9A 2OZUA 1YU6C 2DIPA 5J8CA 4HGUA 2OD1A 2QQCA 2L7XA 2NU4I 1P9GA 4E1RA 3FSYA 3UEYA 2ELIA 3UGDA 3VDUA 3R5AA 2NU1I 2N17A 1OYVI 1X74A
chains in the Genus database with same CATH topology
5FUVA 2SGDI 3HH2C 1X4SA 4SGBI 3E59A 1V1HA 2JA1A 3KY9A 2XRCA 1CGII 1IY5A 1UUCA 1R79A 1KBEA 2QPOA 4A24A 1FYBA 1DS3I 3CXLA 1PJUA 3OXLA 1SGEI 2ORVA 1HPTA 1OMTA 2NU3I 4L9MA 2J9RA 5EX0A 1UVGA 1KBFA 2OVOA 1H0ZA 2NU0I 3BJIA 2F3CI 2M5XA 1PPFI 1AN1I 2GKRI 3SEKC 2UZ3A 3UFFA 5CCMA 3OXFA 1PTQA 5DAEA 1CT2I 2KMPA 2SGQI 1HJAI 3E2IA 1BUSA 2KCXA 2ERWA 3TJQA 2LEOA 3QWPA 2ODDA 2L8EA 4GI3C 2E5RA 1FARA 2WVJA 4JCVE 1LR9A 1MT1A 1CT0I 1NUBA 1SGQI 2KMQA 2FNFX 5CCLA 1CSOI 2GKVA 1Y8FA 2J87A 3UGIA 2V53A 1Z7KB 3QTLD 1DS2I 1SGDI 2N1AB 3OL0A 1LR7A 1XX6A 2ENNA 1SGNI 1W3SA 1KMAA 1TUSA 2A20A 1V1IA 2GVIA 1CGJI 1OMUA 2CJSC 2V1CA 2ORWA 2VRWB 3MEKA 2P6AC 3VE5A 2JZMA 1TBNA 3D00A 4OVOA 1HDLA 1TURA 1TIHA 2N71A 2QQ0A 3OVOA 3FC3A 1M8CA 2KMRA 2W0TA 3VDPA 2B0UC 3SGBI 1Y1CA 4UXHA 3OXGA 1CE3A 2NU2I 1OVOA 1IY6A 2ENZA 1BMOA 3UEJA 1XBTA 2B8TA 2JXDA 5JHWC 2SGPI 5FUXA 1M8BA 1PTRA 1SGYI 3UGLA 2E73A 1Y1BA 3SGQI 2QQEA 3B4VC 1CHOI 2K9HA 2ARPF 1YTPA 2JYYA 1PCEA 1U5KA 2KMOA 2LUYA 2DB6A 4B6DA 3PDNA 1FAQA 2JW6A 5HI7A 1N13A 2V1CC 4E1PA 3GOXA 2GKTI 1TBQR 1IW4A 4FKDA 2SGFI 2SGEI 1CT4I 4UXIA 2ROWA 1RFHA 2YUUA 5HQ8A 1TBOA 2N52A 2QQDA 1SGRI 2BUSA 3RU0A 1VDDA 1W4RA 4UXJA 5FUWA 1LR8A 1SGPI 1TBRR 2YQPA 5FUYA 1TGSI 1XA6A 2WCYA 5EX3A 1R0RI 1TOTA 1UVFA 1YU6C 2DIPA 4HGUA 2OD1A 2QQCA 2L7XA 2NU4I 4E1RA 3UEYA 2ELIA 3UGDA 3VDUA 2NU1I 2N17A 1OYVI 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGD I;  3HH2 C;  4SGB I;  2XRC A;  1CGI I;  1IY5 A;  1UUC A;  1FYB A;  1DS3 I;  1PJU A;  1SGE I;  1HPT A;  1OMT A;  2NU3 I;  1UVG A;  2OVO A;  1H0Z A;  2NU0 I;  2F3C I;  2M5X A;  1PPF I;  1AN1 I;  2GKR I;  3SEK C;  5DAE A;  2KMP A;  1CT2 I;  2SGQ I;  1HJA I;  1BUS A;  2KCX A;  2ERW A;  3TJQ A;  2LEO A;  4GI3 C;  1LR9 A;  1MT1 A;  1CT0 I;  1NUB A;  1SGQ I;  2KMQ A;  1CSO I;  2GKV A;  2V53 A;  1Z7K B;  3QTL D;  1DS2 I;  1SGD I;  1LR7 A;  1SGN I;  1KMA A;  1TUS A;  1CGJ I;  1OMU A;  2P6A C;  2JZM A;  4OVO A;  1HDL A;  1TUR A;  1TIH A;  2N71 A;  3OVO A;  1M8C A;  2KMR A;  2B0U C;  3SGB I;  1Y1C A;  1CE3 A;  2NU2 I;  1OVO A;  1IY6 A;  1BMO A;  2JXD A;  5JHW C;  2SGP I;  1M8B A;  1SGY I;  1Y1B A;  3SGQ I;  3B4V C;  1CHO I;  2ARP F;  1YTP A;  2JYY A;  1PCE A;  2KMO A;  1N13 A;  2GKT I;  1TBQ R;  1IW4 A;  2SGF I;  2SGE I;  1CT4 I;  2N52 A;  2QQD A;  1SGR I;  2BUS A;  1LR8 A;  1SGP I;  1TBR R;  1TGS I;  2WCY A;  1R0R I;  1UVF A;  1YU6 C;  4HGU A;  2QQC A;  2NU4 I;  2NU1 I;  2N17 A;  1OYV I; 
#chains in the Genus database with same CATH topology
 5FUV A;  2SGD I;  3HH2 C;  1X4S A;  2Y0M A;  3E59 A;  4SGB I;  1V1H A;  2JA1 A;  2X52 A;  3KY9 A;  1MJB A;  2XRC A;  5E3P A;  1CGI I;  1ULK A;  1IY5 A;  1UUC A;  1R79 A;  1WKX A;  1KBE A;  2QPO A;  4A24 A;  1FYB A;  1DS3 I;  3CXL A;  1PJU A;  3OXL A;  1SGE I;  2ORV A;  1HPT A;  1OMT A;  2NU3 I;  4L9M A;  2J9R A;  5EX0 A;  1UVG A;  4AML A;  1KBF A;  2OVO A;  4DNC A;  2NU0 I;  3BJI A;  2F3C I;  2M5X A;  3R5B A;  1H0Z A;  2GIV A;  1PPF I;  1AN1 I;  2GKR I;  3SEK C;  2UZ3 A;  5J8F A;  1ULN A;  3UFF A;  1ULM A;  2CWH A;  5CCM A;  3TO9 A;  1HDL A;  1Z2I A;  3OXF A;  3TO6 A;  5E3R A;  1PTQ A;  5DAE A;  1CT2 I;  2KMP A;  2SGQ I;  1P9Z A;  1HJA I;  3E2I A;  3TO7 A;  1BUS A;  2KCX A;  3TOA A;  2ERW A;  1WGC A;  3TJQ A;  2LEO A;  3QWP A;  3QAH A;  2ODD A;  2L8E A;  4GI3 C;  2E5R A;  1FAR A;  2WVJ A;  2X3T A;  4JCV E;  1LR9 A;  2UVO A;  4MPI A;  1MT1 A;  1CT0 I;  1NUB A;  1SGQ I;  1UHA A;  2FNF X;  2KMQ A;  5CCL A;  1CSO I;  1FY7 A;  2GKV A;  1Y8F A;  2J87 A;  3UGI A;  2V53 A;  3TOB A;  1Z7K B;  3QTL D;  1K7U A;  1DS2 I;  1SGD I;  2N1A B;  9WGA A;  3OL0 A;  4WP4 A;  1LR7 A;  3R5C A;  1HEV A;  1XX6 A;  2ENN A;  1Q9B A;  1W3S A;  1SGN I;  1KMA A;  1TUS A;  2A20 A;  1V1I A;  1K7V A;  2GVI A;  1CGJ I;  1OMU A;  1S20 A;  2CJS C;  2ORW A;  2V1C A;  2VRW B;  3MEK A;  2P6A C;  3VE5 A;  2JZM A;  1TBN A;  1WGT A;  3D00 A;  4OVO A;  1TUR A;  2CWG A;  1TIH A;  2N71 A;  2PQ8 A;  2QQ0 A;  3OVO A;  3FC3 A;  1M8C A;  2KMR A;  2W0T A;  3VDP A;  2B0U C;  3SGB I;  1Y1C A;  4UXH A;  3UOE A;  1MJA A;  3OXG A;  1CE3 A;  2WGC A;  2CWF A;  2NU2 I;  1OVO A;  1IY6 A;  2ENZ A;  1BMO A;  3UEJ A;  1XBT A;  2B8T A;  2JXD A;  5JHW C;  2SGP I;  2RC4 A;  5FUX A;  1M8B A;  1PTR A;  1SGY I;  3R5D A;  3UGL A;  2E73 A;  1Y1B A;  5E3Q A;  3FSX A;  2QQE A;  3SGQ I;  3B4V C;  1WTJ A;  1CHO I;  2K9H A;  2OU2 A;  2DKV A;  2ARP F;  1YTP A;  2JYY A;  1K7T A;  1PCE A;  1U5K A;  2KMO A;  2LUY A;  2DB6 A;  4B6D A;  3PDN A;  1FAQ A;  2JW6 A;  5HI7 A;  1N13 A;  2V1C C;  1NXU A;  4E1P A;  3GOX A;  2GKT I;  1TBQ R;  1IW4 A;  4FKD A;  2SGF I;  2SGE I;  2RIJ A;  1CT4 I;  4UXI A;  2ROW A;  1RFH A;  2YUU A;  5HQ8 A;  1TBO A;  2N52 A;  2QQD A;  1SGR I;  2BUS A;  3RU0 A;  1VDD A;  7WGA A;  1W4R A;  4UXJ A;  5FUW A;  1LR8 A;  1SGP I;  1TBR R;  2LB7 A;  2YQP A;  5FUY A;  1TGS I;  1XA6 A;  2WCY A;  5EX3 A;  1R0R I;  1TOT A;  1UVF A;  1MJ9 A;  2OZU A;  1YU6 C;  2DIP A;  5J8C A;  4HGU A;  2OD1 A;  2QQC A;  2L7X A;  2NU4 I;  1P9G A;  4E1R A;  3FSY A;  3UEY A;  2ELI A;  3UGD A;  3VDU A;  3R5A A;  2NU1 I;  2N17 A;  1OYV I;  1X74 A; 
#chains in the Genus database with same CATH homology
 5FUV A;  2SGD I;  3HH2 C;  1X4S A;  4SGB I;  3E59 A;  1V1H A;  2JA1 A;  3KY9 A;  2XRC A;  1CGI I;  1IY5 A;  1UUC A;  1R79 A;  1KBE A;  2QPO A;  4A24 A;  1FYB A;  1DS3 I;  3CXL A;  1PJU A;  3OXL A;  1SGE I;  2ORV A;  1HPT A;  1OMT A;  2NU3 I;  4L9M A;  2J9R A;  5EX0 A;  1UVG A;  1KBF A;  2OVO A;  1H0Z A;  2NU0 I;  3BJI A;  2F3C I;  2M5X A;  1PPF I;  1AN1 I;  2GKR I;  3SEK C;  2UZ3 A;  3UFF A;  5CCM A;  3OXF A;  1PTQ A;  5DAE A;  1CT2 I;  2KMP A;  2SGQ I;  1HJA I;  3E2I A;  1BUS A;  2KCX A;  2ERW A;  3TJQ A;  2LEO A;  3QWP A;  2ODD A;  2L8E A;  4GI3 C;  2E5R A;  1FAR A;  2WVJ A;  4JCV E;  1LR9 A;  1MT1 A;  1CT0 I;  1NUB A;  1SGQ I;  2KMQ A;  2FNF X;  5CCL A;  1CSO I;  2GKV A;  1Y8F A;  2J87 A;  3UGI A;  2V53 A;  1Z7K B;  3QTL D;  1DS2 I;  1SGD I;  2N1A B;  3OL0 A;  1LR7 A;  1XX6 A;  2ENN A;  1SGN I;  1W3S A;  1KMA A;  1TUS A;  2A20 A;  1V1I A;  2GVI A;  1CGJ I;  1OMU A;  2CJS C;  2V1C A;  2ORW A;  2VRW B;  3MEK A;  2P6A C;  3VE5 A;  2JZM A;  1TBN A;  3D00 A;  4OVO A;  1HDL A;  1TUR A;  1TIH A;  2N71 A;  2QQ0 A;  3OVO A;  3FC3 A;  1M8C A;  2KMR A;  2W0T A;  3VDP A;  2B0U C;  3SGB I;  1Y1C A;  4UXH A;  3OXG A;  1CE3 A;  2NU2 I;  1OVO A;  1IY6 A;  2ENZ A;  1BMO A;  3UEJ A;  1XBT A;  2B8T A;  2JXD A;  5JHW C;  2SGP I;  5FUX A;  1M8B A;  1PTR A;  1SGY I;  3UGL A;  2E73 A;  1Y1B A;  3SGQ I;  2QQE A;  3B4V C;  1CHO I;  2K9H A;  2ARP F;  1YTP A;  2JYY A;  1PCE A;  1U5K A;  2KMO A;  2LUY A;  2DB6 A;  4B6D A;  3PDN A;  1FAQ A;  2JW6 A;  5HI7 A;  1N13 A;  2V1C C;  4E1P A;  3GOX A;  2GKT I;  1TBQ R;  1IW4 A;  4FKD A;  2SGF I;  2SGE I;  1CT4 I;  4UXI A;  2ROW A;  1RFH A;  2YUU A;  5HQ8 A;  1TBO A;  2N52 A;  2QQD A;  1SGR I;  2BUS A;  3RU0 A;  1VDD A;  1W4R A;  4UXJ A;  5FUW A;  1LR8 A;  1SGP I;  1TBR R;  2YQP A;  5FUY A;  1TGS I;  1XA6 A;  2WCY A;  5EX3 A;  1R0R I;  1TOT A;  1UVF A;  1YU6 C;  2DIP A;  4HGU A;  2OD1 A;  2QQC A;  2L7X A;  2NU4 I;  4E1R A;  3UEY A;  2ELI A;  3UGD A;  3VDU A;  2NU1 I;  2N17 A;  1OYV I;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...