2NU0I

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i, and tyr18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTWEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Protease B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I, and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu0I00
2QQCA 1IY5A 2N71A 2SGDI 1CSOI 1TIHA 2SGPI 4HGUA 1CE3A 2KMOA 1KMAA 1UVGA 2KCXA 1LR8A 2QQDA 1DS2I 1OMTA 1SGNI 2XRCA 3HH2C 2NU0I 1FYBA 1HJAI 1M8CA 2JZMA 2ERWA 4SGBI 1OMUA 3SEKC 1TBQR 2P6AC 1HDLA 1CT4I 2GKVA 2N17A 2KMPA 1NUBA 1IW4A 2GKRI 1LR9A 1UVFA 2NU4I 2JXDA 1TBRR 2SGEI 1N13A 1PPFI 3SGBI 2N52A 4OVOA 3SGQI 3TJQA 3B4VC 1TGSI 1DS3I 1R0RI 2NU1I 1IY6A 1PCEA 2NU2I 2SGQI 3QTLD 1MT1A 2M5XA 2WCYA 2ARPF 2GKTI 1LR7A 1OYVI 1SGRI 1CHOI 1H0ZA 2BUSA 1SGDI 1CT0I 1AN1I 2F3CI 1YTPA 2KMRA 4GI3C 1TUSA 1CT2I 5DAEA 2SGFI 1SGYI 1YU6C 1Z7KB 1UUCA 1SGPI 1BUSA 2JYYA 2NU3I 2OVOA 2B0UC 2KMQA 1PJUA 1TURA 1SGQI 5JHWC 1CGJI 1CGII 1BMOA 2V53A 1M8BA 2LEOA 3OVOA 1Y1BA 1SGEI 1Y1CA 1OVOA 1HPTA
chains in the Genus database with same CATH superfamily
5J8CA 2QQCA 1TBOA 1V1IA 2N71A 5HI7A 2ORVA 1IY5A 2E73A 3PDNA 2ENNA 2N1AB 1W3SA 4UXHA 2OU2A 2SGDI 1K7VA 2OZUA 1CSOI 1R79A 4L9MA 1TIHA 2SGPI 4HGUA 1CE3A 2E5RA 2KMOA 4E1PA 1KMAA 2ELIA 1UVGA 3UEYA 2Y0MA 2KCXA 3MEKA 2DB6A 1FARA 1LR8A 2QQDA 1DS2I 1OMTA 1SGNI 1PTQA 5FUXA 2XRCA 3HH2C 2NU0I 2ROWA 5FUVA 2CWGA 4WP4A 1XBTA 1FYBA 1KBFA 3OXFA 1HJAI 3UFFA 1FAQA 1M8CA 2JA1A 1P9GA 2QPOA 7WGAA 2ERWA 2JZMA 2LB7A 4SGBI 1OMUA 3SEKC 3KY9A 2J9RA 2WGCA 1WGCA 1WKXA 1X4SA 1TBQR 2P6AC 5EX3A 3VDPA 1HDLA 1CT4I 1RFHA 1ULMA 2GKVA 2N17A 2X3TA 3D00A 2KMPA 1NUBA 2X52A 3TOBA 3FC3A 1IW4A 2GKRI 1KBEA 3UGDA 3TO6A 4B6DA 1LR9A 1MJAA 1UVFA 1Y8FA 1NXUA 1U5KA 2NU4I 2OD1A 2W0TA 2JXDA 3R5DA 3UGLA 1TBRR 2SGEI 1UHAA 1N13A 1V1HA 5E3RA 4A24A 1X74A 1PPFI 2JW6A 2RIJA 2N52A 3SGBI 1WGTA 4DNCA 2LUYA 4OVOA 3SGQI 3TJQA 2ENZA 3B4VC 1MJ9A 3RU0A 2CWHA 1TGSI 1W4RA 1DS3I 3GOXA 1R0RI 4JCVE 2NU1I 3TO9A 2J87A 2V1CA 2YQPA 3QWPA 2ODDA 1IY6A 3OXGA 1MJBA 1PCEA 1WTJA 2NU2I 2SGQI 5E3PA 1P9ZA 1Q9BA 2FNFX 3QTLD 3CXLA 1MT1A 3VDUA 3E2IA 5CCLA 2M5XA 2K9HA 2WCYA 2ARPF 1FY7A 4AMLA 2RC4A 2WVJA 2GKTI 4UXJA 1LR7A 1OYVI 1SGRI 1VDDA 2UZ3A 1CHOI 3R5BA 5E3QA 1H0ZA 2BUSA 1SGDI 1CT0I 5HQ8A 2DKVA 3BJIA 1TOTA 2GIVA 1AN1I 1PTRA 2DIPA 2QQ0A 2F3CI 2B8TA 2L7XA 1YTPA 2KMRA 1XX6A 2V1CC 3QAHA 3R5AA 2ORWA 2A20A 2GVIA 4MPIA 4GI3C 1TUSA 1CT2I 5FUYA 2CWFA 5EX0A 5DAEA 2UVOA 2SGFI 1ULNA 1SGYI 1YU6C 3FSXA 1Z7KB 3TOAA 4E1RA 1K7TA 1UUCA 1SGPI 1BUSA 1S20A 2JYYA 2CJSC 2B0UC 2NU3I 2OVOA 9WGAA 2KMQA 2L8EA 1K7UA 1Z2IA 3FSYA 1PJUA 1TURA 1SGQI 1XA6A 3VE5A 5JHWC 5FUWA 1CGJI 1CGII 4FKDA 2QQEA 1BMOA 4UXIA 3OXLA 2V53A 1M8BA 3R5CA 3TO7A 5CCMA 2LEOA 2PQ8A 1Y1BA 2YUUA 3OVOA 1SGEI 1ULKA 2VRWB 1TBNA 3UOEA 1HEVA 3OL0A 1Y1CA 3E59A 3UEJA 1OVOA 1HPTA 3UGIA 5J8FA
chains in the Genus database with same CATH topology
2QQCA 1TBOA 1V1IA 2N71A 5HI7A 2ORVA 1IY5A 2E73A 3PDNA 2ENNA 2N1AB 1W3SA 4UXHA 2SGDI 1CSOI 1R79A 4L9MA 1TIHA 2SGPI 4HGUA 1CE3A 2E5RA 2KMOA 4E1PA 1KMAA 2ELIA 1UVGA 3UEYA 3MEKA 2KCXA 2DB6A 1FARA 1LR8A 2QQDA 1DS2I 1OMTA 1SGNI 1PTQA 5FUXA 2XRCA 3HH2C 2NU0I 2ROWA 5FUVA 1XBTA 1FYBA 3OXFA 1HJAI 3UFFA 1FAQA 1M8CA 2JA1A 2QPOA 2ERWA 2JZMA 4SGBI 1OMUA 3SEKC 3KY9A 2J9RA 1X4SA 1TBQR 2P6AC 5EX3A 3VDPA 1HDLA 1CT4I 1RFHA 2GKVA 2N17A 3VDUA 3D00A 2KMPA 1NUBA 1IW4A 3FC3A 2GKRI 1KBEA 3UGDA 4B6DA 1LR9A 1UVFA 1Y8FA 2NU4I 1U5KA 2OD1A 2W0TA 2JXDA 3UGLA 1TBRR 2SGEI 1N13A 1V1HA 4A24A 1X74A 1PPFI 2JW6A 3SGBI 2N52A 2LUYA 4OVOA 3SGQI 3TJQA 2ENZA 3B4VC 3RU0A 1TGSI 1W4RA 1DS3I 3GOXA 1R0RI 4JCVE 2NU1I 2J87A 2V1CA 2YQPA 3QWPA 2ODDA 1IY6A 3OXGA 1PCEA 2NU2I 2SGQI 3QTLD 2FNFX 3CXLA 1MT1A 3E2IA 5CCLA 2M5XA 2K9HA 2WCYA 2ARPF 2WVJA 2GKTI 4UXJA 1LR7A 1OYVI 1SGRI 1VDDA 2UZ3A 1CHOI 1H0ZA 2BUSA 1SGDI 1CT0I 5HQ8A 3BJIA 1TOTA 1AN1I 1PTRA 2DIPA 2QQ0A 2F3CI 2B8TA 2L7XA 1YTPA 2KMRA 1XX6A 2V1CC 2ORWA 2A20A 2GVIA 4GI3C 1TUSA 1CT2I 5FUYA 5EX0A 5DAEA 2SGFI 1SGYI 1YU6C 1Z7KB 4E1RA 1KBFA 1UUCA 1SGPI 1BUSA 2JYYA 2NU3I 2CJSC 2B0UC 2OVOA 2KMQA 2L8EA 1PJUA 1TURA 1SGQI 1XA6A 3VE5A 5JHWC 5FUWA 1CGJI 1CGII 4FKDA 2QQEA 1BMOA 4UXIA 3OXLA 2V53A 1M8BA 5CCMA 2LEOA 3OVOA 1Y1BA 2YUUA 1SGEI 2VRWB 1TBNA 3OL0A 1Y1CA 3E59A 3UEJA 1OVOA 1HPTA 3UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQC A;  1IY5 A;  2N71 A;  2SGD I;  1CSO I;  1TIH A;  2SGP I;  4HGU A;  1CE3 A;  2KMO A;  1KMA A;  1UVG A;  2KCX A;  1LR8 A;  2QQD A;  1DS2 I;  1OMT A;  1SGN I;  2XRC A;  3HH2 C;  2NU0 I;  1FYB A;  1HJA I;  1M8C A;  2JZM A;  2ERW A;  4SGB I;  1OMU A;  3SEK C;  1TBQ R;  2P6A C;  1HDL A;  1CT4 I;  2GKV A;  2N17 A;  2KMP A;  1NUB A;  1IW4 A;  2GKR I;  1LR9 A;  1UVF A;  2NU4 I;  2JXD A;  1TBR R;  2SGE I;  1N13 A;  1PPF I;  3SGB I;  2N52 A;  4OVO A;  3SGQ I;  3TJQ A;  3B4V C;  1TGS I;  1DS3 I;  1R0R I;  2NU1 I;  1IY6 A;  1PCE A;  2NU2 I;  2SGQ I;  3QTL D;  1MT1 A;  2M5X A;  2WCY A;  2ARP F;  2GKT I;  1LR7 A;  1OYV I;  1SGR I;  1CHO I;  1H0Z A;  2BUS A;  1SGD I;  1CT0 I;  1AN1 I;  2F3C I;  1YTP A;  2KMR A;  4GI3 C;  1TUS A;  1CT2 I;  5DAE A;  2SGF I;  1SGY I;  1YU6 C;  1Z7K B;  1UUC A;  1SGP I;  1BUS A;  2JYY A;  2NU3 I;  2OVO A;  2B0U C;  2KMQ A;  1PJU A;  1TUR A;  1SGQ I;  5JHW C;  1CGJ I;  1CGI I;  1BMO A;  2V53 A;  1M8B A;  2LEO A;  3OVO A;  1Y1B A;  1SGE I;  1Y1C A;  1OVO A;  1HPT A; 
#chains in the Genus database with same CATH topology
 5J8C A;  2QQC A;  1TBO A;  1V1I A;  2N71 A;  5HI7 A;  2ORV A;  1IY5 A;  2E73 A;  3PDN A;  2ENN A;  2N1A B;  1W3S A;  4UXH A;  2OU2 A;  2SGD I;  1K7V A;  2OZU A;  1CSO I;  1R79 A;  4L9M A;  1TIH A;  2SGP I;  4HGU A;  1CE3 A;  2E5R A;  2KMO A;  4E1P A;  1KMA A;  2ELI A;  1UVG A;  3UEY A;  2Y0M A;  2KCX A;  3MEK A;  2DB6 A;  1FAR A;  1LR8 A;  2QQD A;  1DS2 I;  1OMT A;  1SGN I;  1PTQ A;  5FUX A;  2XRC A;  3HH2 C;  2NU0 I;  2ROW A;  5FUV A;  2CWG A;  4WP4 A;  1XBT A;  1FYB A;  1KBF A;  3OXF A;  1HJA I;  3UFF A;  1FAQ A;  1M8C A;  2JA1 A;  1P9G A;  2QPO A;  7WGA A;  2ERW A;  2JZM A;  2LB7 A;  4SGB I;  1OMU A;  3SEK C;  3KY9 A;  2J9R A;  2WGC A;  1WGC A;  1WKX A;  1X4S A;  1TBQ R;  2P6A C;  5EX3 A;  3VDP A;  1HDL A;  1CT4 I;  1RFH A;  1ULM A;  2GKV A;  2N17 A;  2X3T A;  3D00 A;  2KMP A;  1NUB A;  2X52 A;  3TOB A;  3FC3 A;  1IW4 A;  2GKR I;  1KBE A;  3UGD A;  3TO6 A;  4B6D A;  1LR9 A;  1MJA A;  1UVF A;  1Y8F A;  1NXU A;  1U5K A;  2NU4 I;  2OD1 A;  2W0T A;  2JXD A;  3R5D A;  3UGL A;  1TBR R;  2SGE I;  1UHA A;  1N13 A;  1V1H A;  5E3R A;  4A24 A;  1X74 A;  1PPF I;  2JW6 A;  2RIJ A;  2N52 A;  3SGB I;  1WGT A;  4DNC A;  2LUY A;  4OVO A;  3SGQ I;  3TJQ A;  2ENZ A;  3B4V C;  1MJ9 A;  3RU0 A;  2CWH A;  1TGS I;  1W4R A;  1DS3 I;  3GOX A;  1R0R I;  4JCV E;  2NU1 I;  3TO9 A;  2J87 A;  2V1C A;  2YQP A;  3QWP A;  2ODD A;  1IY6 A;  3OXG A;  1MJB A;  1PCE A;  1WTJ A;  2NU2 I;  2SGQ I;  5E3P A;  1P9Z A;  1Q9B A;  2FNF X;  3QTL D;  3CXL A;  1MT1 A;  3VDU A;  3E2I A;  5CCL A;  2M5X A;  2K9H A;  2WCY A;  2ARP F;  1FY7 A;  4AML A;  2RC4 A;  2WVJ A;  2GKT I;  4UXJ A;  1LR7 A;  1OYV I;  1SGR I;  1VDD A;  2UZ3 A;  1CHO I;  3R5B A;  5E3Q A;  1H0Z A;  2BUS A;  1SGD I;  1CT0 I;  5HQ8 A;  2DKV A;  3BJI A;  1TOT A;  2GIV A;  1AN1 I;  1PTR A;  2DIP A;  2QQ0 A;  2F3C I;  2B8T A;  2L7X A;  1YTP A;  2KMR A;  1XX6 A;  2V1C C;  3QAH A;  3R5A A;  2ORW A;  2A20 A;  2GVI A;  4MPI A;  4GI3 C;  1TUS A;  1CT2 I;  5FUY A;  2CWF A;  5EX0 A;  5DAE A;  2UVO A;  2SGF I;  1ULN A;  1SGY I;  1YU6 C;  3FSX A;  1Z7K B;  3TOA A;  4E1R A;  1K7T A;  1UUC A;  1SGP I;  1BUS A;  1S20 A;  2JYY A;  2CJS C;  2B0U C;  2NU3 I;  2OVO A;  9WGA A;  2KMQ A;  2L8E A;  1K7U A;  1Z2I A;  3FSY A;  1PJU A;  1TUR A;  1SGQ I;  1XA6 A;  3VE5 A;  5JHW C;  5FUW A;  1CGJ I;  1CGI I;  4FKD A;  2QQE A;  1BMO A;  4UXI A;  3OXL A;  2V53 A;  1M8B A;  3R5C A;  3TO7 A;  5CCM A;  2LEO A;  2PQ8 A;  1Y1B A;  2YUU A;  3OVO A;  1SGE I;  1ULK A;  2VRW B;  1TBN A;  3UOE A;  1HEV A;  3OL0 A;  1Y1C A;  3E59 A;  3UEJ A;  1OVO A;  1HPT A;  3UGI A;  5J8F A; 
#chains in the Genus database with same CATH homology
 2QQC A;  1TBO A;  1V1I A;  2N71 A;  5HI7 A;  2ORV A;  1IY5 A;  2E73 A;  3PDN A;  2ENN A;  2N1A B;  1W3S A;  4UXH A;  2SGD I;  1CSO I;  1R79 A;  4L9M A;  1TIH A;  2SGP I;  4HGU A;  1CE3 A;  2E5R A;  2KMO A;  4E1P A;  1KMA A;  2ELI A;  1UVG A;  3UEY A;  3MEK A;  2KCX A;  2DB6 A;  1FAR A;  1LR8 A;  2QQD A;  1DS2 I;  1OMT A;  1SGN I;  1PTQ A;  5FUX A;  2XRC A;  3HH2 C;  2NU0 I;  2ROW A;  5FUV A;  1XBT A;  1FYB A;  3OXF A;  1HJA I;  3UFF A;  1FAQ A;  1M8C A;  2JA1 A;  2QPO A;  2ERW A;  2JZM A;  4SGB I;  1OMU A;  3SEK C;  3KY9 A;  2J9R A;  1X4S A;  1TBQ R;  2P6A C;  5EX3 A;  3VDP A;  1HDL A;  1CT4 I;  1RFH A;  2GKV A;  2N17 A;  3VDU A;  3D00 A;  2KMP A;  1NUB A;  1IW4 A;  3FC3 A;  2GKR I;  1KBE A;  3UGD A;  4B6D A;  1LR9 A;  1UVF A;  1Y8F A;  2NU4 I;  1U5K A;  2OD1 A;  2W0T A;  2JXD A;  3UGL A;  1TBR R;  2SGE I;  1N13 A;  1V1H A;  4A24 A;  1X74 A;  1PPF I;  2JW6 A;  3SGB I;  2N52 A;  2LUY A;  4OVO A;  3SGQ I;  3TJQ A;  2ENZ A;  3B4V C;  3RU0 A;  1TGS I;  1W4R A;  1DS3 I;  3GOX A;  1R0R I;  4JCV E;  2NU1 I;  2J87 A;  2V1C A;  2YQP A;  3QWP A;  2ODD A;  1IY6 A;  3OXG A;  1PCE A;  2NU2 I;  2SGQ I;  3QTL D;  2FNF X;  3CXL A;  1MT1 A;  3E2I A;  5CCL A;  2M5X A;  2K9H A;  2WCY A;  2ARP F;  2WVJ A;  2GKT I;  4UXJ A;  1LR7 A;  1OYV I;  1SGR I;  1VDD A;  2UZ3 A;  1CHO I;  1H0Z A;  2BUS A;  1SGD I;  1CT0 I;  5HQ8 A;  3BJI A;  1TOT A;  1AN1 I;  1PTR A;  2DIP A;  2QQ0 A;  2F3C I;  2B8T A;  2L7X A;  1YTP A;  2KMR A;  1XX6 A;  2V1C C;  2ORW A;  2A20 A;  2GVI A;  4GI3 C;  1TUS A;  1CT2 I;  5FUY A;  5EX0 A;  5DAE A;  2SGF I;  1SGY I;  1YU6 C;  1Z7K B;  4E1R A;  1KBF A;  1UUC A;  1SGP I;  1BUS A;  2JYY A;  2NU3 I;  2CJS C;  2B0U C;  2OVO A;  2KMQ A;  2L8E A;  1PJU A;  1TUR A;  1SGQ I;  1XA6 A;  3VE5 A;  5JHW C;  5FUW A;  1CGJ I;  1CGI I;  4FKD A;  2QQE A;  1BMO A;  4UXI A;  3OXL A;  2V53 A;  1M8B A;  5CCM A;  2LEO A;  3OVO A;  1Y1B A;  2YUU A;  1SGE I;  2VRW B;  1TBN A;  3OL0 A;  1Y1C A;  3E59 A;  3UEJ A;  1OVO A;  1HPT A;  3UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...