2OVOA

The crystal and molecular structure of the third domain of silver pheasant ovomucoid (omsvp3)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal and molecular structure of the third domain of silver pheasant ovomucoid (OMSVP3).
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Proteinase inhibitor (kazal)
molecule keywords OVOMUCOID THIRD DOMAIN
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ovoA00
2N71A 1TUSA 1R0RI 3TJQA 2SGDI 2LEOA 1CGJI 1IY5A 1OMTA 1OVOA 1SGRI 5JHWC 2JYYA 1BMOA 1Y1CA 2KMRA 1PPFI 2GKRI 2B0UC 2WCYA 2QQCA 2BUSA 2KMPA 1HJAI 1TIHA 3OVOA 1YU6C 1LR9A 1MT1A 2ERWA 1OYVI 2OVOA 4SGBI 1N13A 1TBQR 1BUSA 1Y1BA 3SGQI 1AN1I 1TBRR 1IW4A 1Z7KB 2SGFI 1LR8A 2JXDA 1HPTA 1M8CA 3SEKC 1M8BA 1SGQI 2NU2I 1PCEA 1CT4I 2KCXA 3SGBI 1DS2I 1OMUA 1UVFA 2N52A 4OVOA 2JZMA 1UUCA 1CT0I 1SGPI 2KMOA 1SGDI 1PJUA 1TGSI 1SGYI 2NU1I 1IY6A 1H0ZA 1SGNI 1NUBA 4HGUA 1TURA 2GKVA 2N17A 1CT2I 2SGPI 2P6AC 2V53A 3B4VC 1KMAA 2NU4I 2GKTI 2NU0I 2SGQI 2F3CI 2M5XA 2QQDA 2KMQA 3QTLD 2SGEI 1YTPA 2NU3I 2XRCA 4GI3C 1FYBA 1LR7A 1UVGA 1CSOI 1SGEI 1CHOI 2ARPF 5DAEA 1HDLA 1CGII 3HH2C 1DS3I 1CE3A
chains in the Genus database with same CATH superfamily
2N71A 3VE5A 1TUSA 1R0RI 3OXLA 3QWPA 2E5RA 3TJQA 1WTJA 2LEOA 1UHAA 1CGJI 2SGDI 5FUVA 5FUXA 4AMLA 2RC4A 1OMTA 3OXFA 1IY5A 4L9MA 4JCVE 3D00A 1OVOA 1SGRI 5JHWC 2JYYA 1BMOA 2CWGA 1Y1CA 4FKDA 5J8FA 2KMRA 1PPFI 2GKRI 2B0UC 5EX3A 9WGAA 1V1IA 2A20A 3CXLA 2WCYA 2UVOA 2ORVA 1ULMA 2QQCA 1CE3A 2BUSA 2WVJA 2E73A 2KMPA 3TO9A 1KBEA 1WGTA 1HJAI 2B8TA 2J9RA 2L8EA 3UFFA 4A24A 1TIHA 2ENNA 3OVOA 4E1RA 3R5DA 1KBFA 3OL0A 1YU6C 1Q9BA 1LR9A 2Y0MA 1MT1A 2ERWA 1OYVI 3TOAA 2OVOA 4SGBI 1N13A 2FNFX 1TBQR 1BUSA 1XX6A 1Y1BA 3SGQI 1ULKA 2CWHA 3FSYA 1AN1I 1S20A 3BJIA 1TBRR 1HDLA 1TOTA 1IW4A 4E1PA 1Z7KB 2QQEA 2SGFI 2LUYA 1VDDA 3R5AA 7WGAA 3E2IA 5CCLA 2GVIA 4DNCA 1LR8A 2JXDA 1HPTA 3QAHA 1RFHA 2CWFA 3PDNA 1M8CA 2L7XA 1WKXA 1MJ9A 3UGLA 2DKVA 1FY7A 2VRWB 3R5CA 2UZ3A 2GIVA 3VDPA 3UGIA 5E3PA 2OZUA 2PQ8A 3SEKC 1M8BA 1SGQI 5FUWA 3RU0A 2YQPA 5HQ8A 1MJBA 1P9ZA 2NU2I 1PCEA 4MPIA 2ROWA 2ODDA 1TBNA 1CT4I 1X4SA 2KCXA 3SGBI 1DS2I 3MEKA 1MJAA 1OMUA 1UVFA 4UXIA 5E3QA 2YUUA 1PTQA 2N52A 2V1CA 2V1CC 1W4RA 3GOXA 1HEVA 3TO7A 1K7UA 4OVOA 1NXUA 2JZMA 2QPOA 3OXGA 3UGDA 1K7VA 1P9GA 1R79A 1UUCA 2OD1A 1FARA 1CT0I 2DIPA 2WGCA 1SGPI 2KMOA 2LB7A 2X52A 2ENZA 1SGDI 1PJUA 1ULNA 2CJSC 1TGSI 1SGYI 3UEJA 2NU1I 1FAQA 1IY6A 1H0ZA 3UEYA 1SGNI 1NUBA 2RIJA 1TURA 4HGUA 5FUYA 2GKVA 2OU2A 1V1HA 1Y8FA 3E59A 2N17A 3TOBA 1CT2I 3TO6A 1XA6A 4UXHA 5E3RA 1TBOA 2P6AC 2SGPI 2V53A 3B4VC 2NU4I 4WP4A 1KMAA 2X3TA 2GKTI 1K7TA 2DB6A 2J87A 2NU0I 2SGQI 3FSXA 2F3CI 2M5XA 2QQDA 3UOEA 4UXJA 5CCMA 2KMQA 3QTLD 2SGEI 2K9HA 1YTPA 2JA1A 2NU3I 2W0TA 2XRCA 1W3SA 2JW6A 4GI3C 2ELIA 3R5BA 1FYBA 5EX0A 1LR7A 1UVGA 1X74A 1Z2IA 2ORWA 3KY9A 1CSOI 1SGEI 1WGCA 1PTRA 5HI7A 1CHOI 3FC3A 1U5KA 1XBTA 2ARPF 1CGII 5DAEA 3VDUA 3HH2C 1DS3I 2QQ0A 4B6DA 5J8CA 2N1AB
chains in the Genus database with same CATH topology
2N71A 3VE5A 1TUSA 1R0RI 3OXLA 3QWPA 2E5RA 3TJQA 2SGDI 2LEOA 5FUXA 1CGJI 5FUVA 1IY5A 3OXFA 1OMTA 4L9MA 4JCVE 3D00A 1OVOA 1SGRI 5JHWC 2JYYA 1BMOA 1Y1CA 4FKDA 2KMRA 1PPFI 2GKRI 2B0UC 5EX3A 1V1IA 2A20A 3CXLA 2WCYA 2ORVA 2QQCA 2BUSA 2WVJA 2E73A 2KMPA 1KBEA 1HJAI 2B8TA 2J9RA 2L8EA 3UFFA 4A24A 2ENNA 1TIHA 3OVOA 4E1RA 1KBFA 3OL0A 1YU6C 1LR9A 1MT1A 2ERWA 1OYVI 2OVOA 4SGBI 1N13A 2FNFX 1TBQR 1BUSA 1XX6A 1Y1BA 3SGQI 1AN1I 3BJIA 1TBRR 1HDLA 1TOTA 1IW4A 4E1PA 1Z7KB 2QQEA 2SGFI 2LUYA 1VDDA 3E2IA 5CCLA 2GVIA 1LR8A 2JXDA 1HPTA 1RFHA 3PDNA 1M8CA 2L7XA 3UGLA 2VRWB 2UZ3A 3VDPA 3UGIA 3SEKC 1M8BA 1SGQI 5FUWA 3RU0A 2YQPA 5HQ8A 2NU2I 1PCEA 2ROWA 2ODDA 1TBNA 1CT4I 1X4SA 2KCXA 3SGBI 1DS2I 3MEKA 1OMUA 1UVFA 4UXIA 2YUUA 1PTQA 2N52A 2V1CA 2V1CC 1W4RA 3GOXA 4OVOA 2JZMA 2QPOA 3OXGA 3UGDA 1UUCA 1R79A 2OD1A 1FARA 1CT0I 2DIPA 1SGPI 2KMOA 2ENZA 1SGDI 1PJUA 2CJSC 1TGSI 1SGYI 3UEJA 2NU1I 1FAQA 1IY6A 1H0ZA 3UEYA 1SGNI 1NUBA 4HGUA 1TURA 5FUYA 2GKVA 1V1HA 1Y8FA 3E59A 2N17A 1CT2I 1XA6A 4UXHA 1TBOA 2P6AC 2SGPI 2V53A 3B4VC 2NU4I 1KMAA 2GKTI 2DB6A 2J87A 2NU0I 2SGQI 2F3CI 2M5XA 2QQDA 4UXJA 5CCMA 2KMQA 3QTLD 2SGEI 2K9HA 1YTPA 2JA1A 2NU3I 2W0TA 2XRCA 1W3SA 2JW6A 4GI3C 2ELIA 1FYBA 5EX0A 1LR7A 1UVGA 1X74A 2ORWA 3KY9A 1CSOI 1SGEI 1PTRA 5HI7A 1CHOI 3FC3A 1U5KA 1XBTA 2ARPF 1CGII 5DAEA 3VDUA 3HH2C 1DS3I 2QQ0A 4B6DA 1CE3A 2N1AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N71 A;  1TUS A;  1R0R I;  3TJQ A;  2SGD I;  2LEO A;  1CGJ I;  1IY5 A;  1OMT A;  1OVO A;  1SGR I;  5JHW C;  2JYY A;  1BMO A;  1Y1C A;  2KMR A;  1PPF I;  2GKR I;  2B0U C;  2WCY A;  2QQC A;  2BUS A;  2KMP A;  1HJA I;  1TIH A;  3OVO A;  1YU6 C;  1LR9 A;  1MT1 A;  2ERW A;  1OYV I;  2OVO A;  4SGB I;  1N13 A;  1TBQ R;  1BUS A;  1Y1B A;  3SGQ I;  1AN1 I;  1TBR R;  1IW4 A;  1Z7K B;  2SGF I;  1LR8 A;  2JXD A;  1HPT A;  1M8C A;  3SEK C;  1M8B A;  1SGQ I;  2NU2 I;  1PCE A;  1CT4 I;  2KCX A;  3SGB I;  1DS2 I;  1OMU A;  1UVF A;  2N52 A;  4OVO A;  2JZM A;  1UUC A;  1CT0 I;  1SGP I;  2KMO A;  1SGD I;  1PJU A;  1TGS I;  1SGY I;  2NU1 I;  1IY6 A;  1H0Z A;  1SGN I;  1NUB A;  4HGU A;  1TUR A;  2GKV A;  2N17 A;  1CT2 I;  2SGP I;  2P6A C;  2V53 A;  3B4V C;  1KMA A;  2NU4 I;  2GKT I;  2NU0 I;  2SGQ I;  2F3C I;  2M5X A;  2QQD A;  2KMQ A;  3QTL D;  2SGE I;  1YTP A;  2NU3 I;  2XRC A;  4GI3 C;  1FYB A;  1LR7 A;  1UVG A;  1CSO I;  1SGE I;  1CHO I;  2ARP F;  5DAE A;  1HDL A;  1CGI I;  3HH2 C;  1DS3 I;  1CE3 A; 
#chains in the Genus database with same CATH topology
 2N71 A;  3VE5 A;  1TUS A;  1R0R I;  3OXL A;  3QWP A;  2E5R A;  3TJQ A;  1WTJ A;  2LEO A;  1UHA A;  1CGJ I;  2SGD I;  5FUV A;  5FUX A;  4AML A;  2RC4 A;  1OMT A;  3OXF A;  1IY5 A;  4L9M A;  4JCV E;  3D00 A;  1OVO A;  1SGR I;  5JHW C;  2JYY A;  1BMO A;  2CWG A;  1Y1C A;  4FKD A;  5J8F A;  2KMR A;  1PPF I;  2GKR I;  2B0U C;  5EX3 A;  9WGA A;  1V1I A;  2A20 A;  3CXL A;  2WCY A;  2UVO A;  2ORV A;  1ULM A;  2QQC A;  1CE3 A;  2BUS A;  2WVJ A;  2E73 A;  2KMP A;  3TO9 A;  1KBE A;  1WGT A;  1HJA I;  2B8T A;  2J9R A;  2L8E A;  3UFF A;  4A24 A;  1TIH A;  2ENN A;  3OVO A;  4E1R A;  3R5D A;  1KBF A;  3OL0 A;  1YU6 C;  1Q9B A;  1LR9 A;  2Y0M A;  1MT1 A;  2ERW A;  1OYV I;  3TOA A;  2OVO A;  4SGB I;  1N13 A;  2FNF X;  1TBQ R;  1BUS A;  1XX6 A;  1Y1B A;  3SGQ I;  1ULK A;  2CWH A;  3FSY A;  1AN1 I;  1S20 A;  3BJI A;  1TBR R;  1HDL A;  1TOT A;  1IW4 A;  4E1P A;  1Z7K B;  2QQE A;  2SGF I;  2LUY A;  1VDD A;  3R5A A;  7WGA A;  3E2I A;  5CCL A;  2GVI A;  4DNC A;  1LR8 A;  2JXD A;  1HPT A;  3QAH A;  1RFH A;  2CWF A;  3PDN A;  1M8C A;  2L7X A;  1WKX A;  1MJ9 A;  3UGL A;  2DKV A;  1FY7 A;  2VRW B;  3R5C A;  2UZ3 A;  2GIV A;  3VDP A;  3UGI A;  5E3P A;  2OZU A;  2PQ8 A;  3SEK C;  1M8B A;  1SGQ I;  5FUW A;  3RU0 A;  2YQP A;  5HQ8 A;  1MJB A;  1P9Z A;  2NU2 I;  1PCE A;  4MPI A;  2ROW A;  2ODD A;  1TBN A;  1CT4 I;  1X4S A;  2KCX A;  3SGB I;  1DS2 I;  3MEK A;  1MJA A;  1OMU A;  1UVF A;  4UXI A;  5E3Q A;  2YUU A;  1PTQ A;  2N52 A;  2V1C A;  2V1C C;  1W4R A;  3GOX A;  1HEV A;  3TO7 A;  1K7U A;  4OVO A;  1NXU A;  2JZM A;  2QPO A;  3OXG A;  3UGD A;  1K7V A;  1P9G A;  1R79 A;  1UUC A;  2OD1 A;  1FAR A;  1CT0 I;  2DIP A;  2WGC A;  1SGP I;  2KMO A;  2LB7 A;  2X52 A;  2ENZ A;  1SGD I;  1PJU A;  1ULN A;  2CJS C;  1TGS I;  1SGY I;  3UEJ A;  2NU1 I;  1FAQ A;  1IY6 A;  1H0Z A;  3UEY A;  1SGN I;  1NUB A;  2RIJ A;  1TUR A;  4HGU A;  5FUY A;  2GKV A;  2OU2 A;  1V1H A;  1Y8F A;  3E59 A;  2N17 A;  3TOB A;  1CT2 I;  3TO6 A;  1XA6 A;  4UXH A;  5E3R A;  1TBO A;  2P6A C;  2SGP I;  2V53 A;  3B4V C;  2NU4 I;  4WP4 A;  1KMA A;  2X3T A;  2GKT I;  1K7T A;  2DB6 A;  2J87 A;  2NU0 I;  2SGQ I;  3FSX A;  2F3C I;  2M5X A;  2QQD A;  3UOE A;  4UXJ A;  5CCM A;  2KMQ A;  3QTL D;  2SGE I;  2K9H A;  1YTP A;  2JA1 A;  2NU3 I;  2W0T A;  2XRC A;  1W3S A;  2JW6 A;  4GI3 C;  2ELI A;  3R5B A;  1FYB A;  5EX0 A;  1LR7 A;  1UVG A;  1X74 A;  1Z2I A;  2ORW A;  3KY9 A;  1CSO I;  1SGE I;  1WGC A;  1PTR A;  5HI7 A;  1CHO I;  3FC3 A;  1U5K A;  1XBT A;  2ARP F;  1CGI I;  5DAE A;  3VDU A;  3HH2 C;  1DS3 I;  2QQ0 A;  4B6D A;  5J8C A;  2N1A B; 
#chains in the Genus database with same CATH homology
 2N71 A;  3VE5 A;  1TUS A;  1R0R I;  3OXL A;  3QWP A;  2E5R A;  3TJQ A;  2SGD I;  2LEO A;  5FUX A;  1CGJ I;  5FUV A;  1IY5 A;  3OXF A;  1OMT A;  4L9M A;  4JCV E;  3D00 A;  1OVO A;  1SGR I;  5JHW C;  2JYY A;  1BMO A;  1Y1C A;  4FKD A;  2KMR A;  1PPF I;  2GKR I;  2B0U C;  5EX3 A;  1V1I A;  2A20 A;  3CXL A;  2WCY A;  2ORV A;  2QQC A;  2BUS A;  2WVJ A;  2E73 A;  2KMP A;  1KBE A;  1HJA I;  2B8T A;  2J9R A;  2L8E A;  3UFF A;  4A24 A;  2ENN A;  1TIH A;  3OVO A;  4E1R A;  1KBF A;  3OL0 A;  1YU6 C;  1LR9 A;  1MT1 A;  2ERW A;  1OYV I;  2OVO A;  4SGB I;  1N13 A;  2FNF X;  1TBQ R;  1BUS A;  1XX6 A;  1Y1B A;  3SGQ I;  1AN1 I;  3BJI A;  1TBR R;  1HDL A;  1TOT A;  1IW4 A;  4E1P A;  1Z7K B;  2QQE A;  2SGF I;  2LUY A;  1VDD A;  3E2I A;  5CCL A;  2GVI A;  1LR8 A;  2JXD A;  1HPT A;  1RFH A;  3PDN A;  1M8C A;  2L7X A;  3UGL A;  2VRW B;  2UZ3 A;  3VDP A;  3UGI A;  3SEK C;  1M8B A;  1SGQ I;  5FUW A;  3RU0 A;  2YQP A;  5HQ8 A;  2NU2 I;  1PCE A;  2ROW A;  2ODD A;  1TBN A;  1CT4 I;  1X4S A;  2KCX A;  3SGB I;  1DS2 I;  3MEK A;  1OMU A;  1UVF A;  4UXI A;  2YUU A;  1PTQ A;  2N52 A;  2V1C A;  2V1C C;  1W4R A;  3GOX A;  4OVO A;  2JZM A;  2QPO A;  3OXG A;  3UGD A;  1UUC A;  1R79 A;  2OD1 A;  1FAR A;  1CT0 I;  2DIP A;  1SGP I;  2KMO A;  2ENZ A;  1SGD I;  1PJU A;  2CJS C;  1TGS I;  1SGY I;  3UEJ A;  2NU1 I;  1FAQ A;  1IY6 A;  1H0Z A;  3UEY A;  1SGN I;  1NUB A;  4HGU A;  1TUR A;  5FUY A;  2GKV A;  1V1H A;  1Y8F A;  3E59 A;  2N17 A;  1CT2 I;  1XA6 A;  4UXH A;  1TBO A;  2P6A C;  2SGP I;  2V53 A;  3B4V C;  2NU4 I;  1KMA A;  2GKT I;  2DB6 A;  2J87 A;  2NU0 I;  2SGQ I;  2F3C I;  2M5X A;  2QQD A;  4UXJ A;  5CCM A;  2KMQ A;  3QTL D;  2SGE I;  2K9H A;  1YTP A;  2JA1 A;  2NU3 I;  2W0T A;  2XRC A;  1W3S A;  2JW6 A;  4GI3 C;  2ELI A;  1FYB A;  5EX0 A;  1LR7 A;  1UVG A;  1X74 A;  2ORW A;  3KY9 A;  1CSO I;  1SGE I;  1PTR A;  5HI7 A;  1CHO I;  3FC3 A;  1U5K A;  1XBT A;  2ARP F;  1CGI I;  5DAE A;  3VDU A;  3HH2 C;  1DS3 I;  2QQ0 A;  4B6D A;  1CE3 A;  2N1A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...