2OVOA

The crystal and molecular structure of the third domain of silver pheasant ovomucoid (omsvp3)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID THIRD DOMAIN
publication title The crystal and molecular structure of the third domain of silver pheasant ovomucoid (OMSVP3).
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Proteinase inhibitor (kazal)
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ovoA00
1SGRI 1FYBA 1DS3I 1AN1I 2P6AC 1HJAI 1R0RI 2SGFI 1BUSA 1TBRR 1OMTA 1SGYI 1IY5A 2NU4I 2QQDA 1SGDI 4OVOA 1BMOA 2N71A 1Z7KB 1CE3A 1OMUA 2KMRA 1CGII 2NU0I 1SGEI 3TJQA 1UUCA 3SGBI 1LR9A 1PCEA 2JXDA 1CT4I 2GKVA 2XRCA 2QQCA 3HH2C 1LR8A 2KMOA 1SGPI 1H0ZA 1UVFA 2NU1I 1M8CA 2SGDI 2GKTI 3B4VC 1OVOA 1TURA 1YU6C 2KMQA 1CSOI 3OVOA 1CT2I 2M5XA 2WCYA 5DAEA 1CGJI 2NU3I 1PPFI 1TUSA 1IW4A 2ERWA 1HPTA 2LEOA 4HGUA 2KCXA 1NUBA 1LR7A 1DS2I 2OVOA 1Y1BA 1MT1A 1TGSI 1Y1CA 4SGBI 3SGQI 2F3CI 1CT0I 2SGQI 1OYVI 1UVGA 2N52A 1N13A 1TIHA 1HDLA 2N17A 1SGQI 2NU2I 2V53A 1KMAA 1YTPA 1PJUA 2B0UC 2GKRI 1IY6A 2JYYA 2ARPF 1M8BA 1SGNI 2BUSA 5JHWC 2KMPA 1CHOI 4GI3C 2JZMA 2SGPI 1TBQR 3SEKC 2SGEI 3QTLD
chains in the Genus database with same CATH superfamily
1SGRI 1FYBA 1DS3I 3TOBA 1AN1I 2P6AC 4UXHA 1HJAI 2X52A 1Y8FA 1R0RI 2GIVA 2V1CA 2SGFI 2QQEA 3GOXA 1BUSA 1R79A 1MJAA 1XX6A 4UXJA 1TBRR 1OMTA 1SGYI 3OL0A 3OXLA 3PDNA 1V1HA 2L8EA 5FUXA 2NU4I 2QQDA 2RC4A 3FSYA 5CCLA 1FARA 1FY7A 1SGDI 1KBEA 1TBOA 1K7VA 2LUYA 1ULMA 4OVOA 5J8FA 2W0TA 1TOTA 1BMOA 3BJIA 3E2IA 2N71A 1K7TA 1X74A 1Z7KB 3UEYA 5J8CA 1CE3A 1OMUA 2E73A 3UGLA 2KMRA 5HI7A 1CGII 3E59A 1KBFA 4FKDA 2NU0I 2LB7A 2YUUA 1SGEI 2E5RA 3QWPA 5EX0A 3TJQA 3VDUA 1UUCA 1MJ9A 3SGBI 1LR9A 2QPOA 1WKXA 2UVOA 2OZUA 5E3RA 1FAQA 1PCEA 1ULKA 2JXDA 3R5CA 3TO6A 3UGDA 3FSXA 1CT4I 2JW6A 2GKVA 2XRCA 2VRWB 3VE5A 2CJSC 4WP4A 1V1IA 2GVIA 2QQCA 1TBNA 3HH2C 2YQPA 1LR8A 1S20A 2KMOA 2DB6A 2WVJA 1HEVA 1SGPI 4JCVE 1P9GA 4L9MA 1UVFA 2NU1I 1M8CA 1H0ZA 2SGDI 1RFHA 1WGCA 1UHAA 3R5BA 2GKTI 3B4VC 1OVOA 1TURA 3D00A 1YU6C 1PTRA 1CSOI 2KMQA 1CT2I 3OVOA 2M5XA 5FUVA 2WCYA 1Z2IA 7WGAA 5DAEA 1CGJI 3VDPA 4E1RA 3OXGA 1WTJA 5EX3A 2NU3I 1PPFI 1TUSA 1IW4A 2UZ3A 2J9RA 5E3QA 3UOEA 2ERWA 1HPTA 1K7UA 2LEOA 2X3TA 3KY9A 5E3PA 4HGUA 2KCXA 1NUBA 2ENZA 1NXUA 3TO9A 3UGIA 2ORVA 1ULNA 1LR7A 1DS2I 2OVOA 2OD1A 1Y1BA 4DNCA 3R5AA 1X4SA 1MT1A 2DIPA 3FC3A 1TGSI 1W3SA 1Y1CA 2J87A 5FUWA 3TOAA 1XBTA 4SGBI 4E1PA 2WGCA 3SGQI 2F3CI 2ROWA 1CT0I 2CWFA 5HQ8A 2CWGA 1XA6A 2SGQI 1OYVI 1UVGA 2N1AB 2N52A 1N13A 2ELIA 1TIHA 2PQ8A 2ODDA 1U5KA 4MPIA 4AMLA 1HDLA 2ENNA 2N17A 1SGQI 2NU2I 2RIJA 2V53A 1KMAA 2L7XA 1P9ZA 1YTPA 1PJUA 2B0UC 2GKRI 2QQ0A 3MEKA 2B8TA 1IY6A 2JYYA 3RU0A 2ARPF 2A20A 1M8BA 2ORWA 3TO7A 3UEJA 3R5DA 3CXLA 1SGNI 1MJBA 3QAHA 1WGTA 1Q9BA 2Y0MA 5CCMA 1VDDA 2BUSA 3OXFA 9WGAA 1IY5A 5JHWC 4A24A 2V1CC 2K9HA 2CWHA 2FNFX 2KMPA 1CHOI 4GI3C 2JZMA 3UFFA 2SGPI 2OU2A 4B6DA 2JA1A 1TBQR 1W4RA 2DKVA 2SGEI 4UXIA 3SEKC 5FUYA 1PTQA 3QTLD
chains in the Genus database with same CATH topology
1SGRI 1FYBA 1DS3I 1AN1I 2P6AC 4UXHA 1HJAI 1Y8FA 1R0RI 2V1CA 2SGFI 2QQEA 3GOXA 1BUSA 1R79A 1XX6A 4UXJA 1TBRR 1OMTA 1SGYI 3OL0A 3OXLA 3PDNA 1V1HA 2L8EA 5FUXA 2NU4I 2QQDA 5CCLA 1FARA 1SGDI 1KBEA 1TBOA 2LUYA 4OVOA 2W0TA 1TOTA 1BMOA 3BJIA 3E2IA 2N71A 1Z7KB 1X74A 3UEYA 1CE3A 1OMUA 2E73A 3UGLA 2KMRA 5HI7A 1CGII 3E59A 1KBFA 4FKDA 2NU0I 2YUUA 1SGEI 2E5RA 3QWPA 5EX0A 3TJQA 3VDUA 1UUCA 3SGBI 1LR9A 2QPOA 1FAQA 1PCEA 2JXDA 3UGDA 1CT4I 2JW6A 2GKVA 2XRCA 2VRWB 3VE5A 2CJSC 1V1IA 2GVIA 2QQCA 1TBNA 3HH2C 2YQPA 1LR8A 2KMOA 2DB6A 2WVJA 1SGPI 4JCVE 4L9MA 1H0ZA 1UVFA 2NU1I 1M8CA 2SGDI 1RFHA 2GKTI 3B4VC 1OVOA 1TURA 3D00A 1YU6C 1PTRA 1CSOI 2KMQA 1CT2I 3OVOA 2M5XA 5FUVA 2WCYA 5DAEA 1CGJI 3VDPA 4E1RA 3OXGA 5EX3A 2NU3I 1PPFI 1TUSA 1IW4A 2UZ3A 2J9RA 2ERWA 1HPTA 3KY9A 2LEOA 4HGUA 2KCXA 1NUBA 2ENZA 3UGIA 2ORVA 1LR7A 1DS2I 2OVOA 2OD1A 1Y1BA 1X4SA 1MT1A 2DIPA 3FC3A 1TGSI 1W3SA 1Y1CA 2J87A 5FUWA 1XBTA 4SGBI 4E1PA 3SGQI 2F3CI 2ROWA 1CT0I 5HQ8A 1XA6A 2SGQI 1OYVI 1UVGA 2N1AB 2N52A 1N13A 2ELIA 1TIHA 2ODDA 1U5KA 1HDLA 2ENNA 2N17A 1SGQI 2NU2I 2V53A 1KMAA 2L7XA 1YTPA 1PJUA 2B0UC 2GKRI 2QQ0A 3MEKA 2B8TA 1IY6A 2JYYA 3RU0A 2ARPF 2A20A 1M8BA 2ORWA 3UEJA 3CXLA 1SGNI 5CCMA 1VDDA 2BUSA 3OXFA 1IY5A 5JHWC 4A24A 2V1CC 2K9HA 2FNFX 2KMPA 3UFFA 1CHOI 4GI3C 2JZMA 2SGPI 4B6DA 2JA1A 1TBQR 1W4RA 3SEKC 2SGEI 4UXIA 5FUYA 1PTQA 3QTLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGR I;  1FYB A;  1DS3 I;  1AN1 I;  2P6A C;  1HJA I;  1R0R I;  2SGF I;  1BUS A;  1TBR R;  1OMT A;  1SGY I;  1IY5 A;  2NU4 I;  2QQD A;  1SGD I;  4OVO A;  1BMO A;  2N71 A;  1Z7K B;  1CE3 A;  1OMU A;  2KMR A;  1CGI I;  2NU0 I;  1SGE I;  3TJQ A;  1UUC A;  3SGB I;  1LR9 A;  1PCE A;  2JXD A;  1CT4 I;  2GKV A;  2XRC A;  2QQC A;  3HH2 C;  1LR8 A;  2KMO A;  1SGP I;  1H0Z A;  1UVF A;  2NU1 I;  1M8C A;  2SGD I;  2GKT I;  3B4V C;  1OVO A;  1TUR A;  1YU6 C;  2KMQ A;  1CSO I;  3OVO A;  1CT2 I;  2M5X A;  2WCY A;  5DAE A;  1CGJ I;  2NU3 I;  1PPF I;  1TUS A;  1IW4 A;  2ERW A;  1HPT A;  2LEO A;  4HGU A;  2KCX A;  1NUB A;  1LR7 A;  1DS2 I;  2OVO A;  1Y1B A;  1MT1 A;  1TGS I;  1Y1C A;  4SGB I;  3SGQ I;  2F3C I;  1CT0 I;  2SGQ I;  1OYV I;  1UVG A;  2N52 A;  1N13 A;  1TIH A;  1HDL A;  2N17 A;  1SGQ I;  2NU2 I;  2V53 A;  1KMA A;  1YTP A;  1PJU A;  2B0U C;  2GKR I;  1IY6 A;  2JYY A;  2ARP F;  1M8B A;  1SGN I;  2BUS A;  5JHW C;  2KMP A;  1CHO I;  4GI3 C;  2JZM A;  2SGP I;  1TBQ R;  3SEK C;  2SGE I;  3QTL D; 
#chains in the Genus database with same CATH topology
 1SGR I;  1FYB A;  1DS3 I;  3TOB A;  1AN1 I;  2P6A C;  4UXH A;  1HJA I;  2X52 A;  1Y8F A;  1R0R I;  2GIV A;  2V1C A;  2SGF I;  2QQE A;  3GOX A;  1BUS A;  1R79 A;  1MJA A;  1XX6 A;  4UXJ A;  1TBR R;  1OMT A;  1SGY I;  3OL0 A;  3OXL A;  3PDN A;  1V1H A;  2L8E A;  5FUX A;  2NU4 I;  2QQD A;  2RC4 A;  3FSY A;  5CCL A;  1FAR A;  1FY7 A;  1SGD I;  1KBE A;  1TBO A;  1K7V A;  2LUY A;  1ULM A;  4OVO A;  5J8F A;  2W0T A;  1TOT A;  1BMO A;  3BJI A;  3E2I A;  2N71 A;  1K7T A;  1X74 A;  1Z7K B;  3UEY A;  5J8C A;  1CE3 A;  1OMU A;  2E73 A;  3UGL A;  2KMR A;  5HI7 A;  1CGI I;  3E59 A;  1KBF A;  4FKD A;  2NU0 I;  2LB7 A;  2YUU A;  1SGE I;  2E5R A;  3QWP A;  5EX0 A;  3TJQ A;  3VDU A;  1UUC A;  1MJ9 A;  3SGB I;  1LR9 A;  2QPO A;  1WKX A;  2UVO A;  2OZU A;  5E3R A;  1FAQ A;  1PCE A;  1ULK A;  2JXD A;  3R5C A;  3TO6 A;  3UGD A;  3FSX A;  1CT4 I;  2JW6 A;  2GKV A;  2XRC A;  2VRW B;  3VE5 A;  2CJS C;  4WP4 A;  1V1I A;  2GVI A;  2QQC A;  1TBN A;  3HH2 C;  2YQP A;  1LR8 A;  1S20 A;  2KMO A;  2DB6 A;  2WVJ A;  1HEV A;  1SGP I;  4JCV E;  1P9G A;  4L9M A;  1UVF A;  2NU1 I;  1M8C A;  1H0Z A;  2SGD I;  1RFH A;  1WGC A;  1UHA A;  3R5B A;  2GKT I;  3B4V C;  1OVO A;  1TUR A;  3D00 A;  1YU6 C;  1PTR A;  1CSO I;  2KMQ A;  1CT2 I;  3OVO A;  2M5X A;  5FUV A;  2WCY A;  1Z2I A;  7WGA A;  5DAE A;  1CGJ I;  3VDP A;  4E1R A;  3OXG A;  1WTJ A;  5EX3 A;  2NU3 I;  1PPF I;  1TUS A;  1IW4 A;  2UZ3 A;  2J9R A;  5E3Q A;  3UOE A;  2ERW A;  1HPT A;  1K7U A;  2LEO A;  2X3T A;  3KY9 A;  5E3P A;  4HGU A;  2KCX A;  1NUB A;  2ENZ A;  1NXU A;  3TO9 A;  3UGI A;  2ORV A;  1ULN A;  1LR7 A;  1DS2 I;  2OVO A;  2OD1 A;  1Y1B A;  4DNC A;  3R5A A;  1X4S A;  1MT1 A;  2DIP A;  3FC3 A;  1TGS I;  1W3S A;  1Y1C A;  2J87 A;  5FUW A;  3TOA A;  1XBT A;  4SGB I;  4E1P A;  2WGC A;  3SGQ I;  2F3C I;  2ROW A;  1CT0 I;  2CWF A;  5HQ8 A;  2CWG A;  1XA6 A;  2SGQ I;  1OYV I;  1UVG A;  2N1A B;  2N52 A;  1N13 A;  2ELI A;  1TIH A;  2PQ8 A;  2ODD A;  1U5K A;  4MPI A;  4AML A;  1HDL A;  2ENN A;  2N17 A;  1SGQ I;  2NU2 I;  2RIJ A;  2V53 A;  1KMA A;  2L7X A;  1P9Z A;  1YTP A;  1PJU A;  2B0U C;  2GKR I;  2QQ0 A;  3MEK A;  2B8T A;  1IY6 A;  2JYY A;  3RU0 A;  2ARP F;  2A20 A;  1M8B A;  2ORW A;  3TO7 A;  3UEJ A;  3R5D A;  3CXL A;  1SGN I;  1MJB A;  3QAH A;  1WGT A;  1Q9B A;  2Y0M A;  5CCM A;  1VDD A;  2BUS A;  3OXF A;  9WGA A;  1IY5 A;  5JHW C;  4A24 A;  2V1C C;  2K9H A;  2CWH A;  2FNF X;  2KMP A;  1CHO I;  4GI3 C;  2JZM A;  3UFF A;  2SGP I;  2OU2 A;  4B6D A;  2JA1 A;  1TBQ R;  1W4R A;  2DKV A;  2SGE I;  4UXI A;  3SEK C;  5FUY A;  1PTQ A;  3QTL D; 
#chains in the Genus database with same CATH homology
 1SGR I;  1FYB A;  1DS3 I;  1AN1 I;  2P6A C;  4UXH A;  1HJA I;  1Y8F A;  1R0R I;  2V1C A;  2SGF I;  2QQE A;  3GOX A;  1BUS A;  1R79 A;  1XX6 A;  4UXJ A;  1TBR R;  1OMT A;  1SGY I;  3OL0 A;  3OXL A;  3PDN A;  1V1H A;  2L8E A;  5FUX A;  2NU4 I;  2QQD A;  5CCL A;  1FAR A;  1SGD I;  1KBE A;  1TBO A;  2LUY A;  4OVO A;  2W0T A;  1TOT A;  1BMO A;  3BJI A;  3E2I A;  2N71 A;  1Z7K B;  1X74 A;  3UEY A;  1CE3 A;  1OMU A;  2E73 A;  3UGL A;  2KMR A;  5HI7 A;  1CGI I;  3E59 A;  1KBF A;  4FKD A;  2NU0 I;  2YUU A;  1SGE I;  2E5R A;  3QWP A;  5EX0 A;  3TJQ A;  3VDU A;  1UUC A;  3SGB I;  1LR9 A;  2QPO A;  1FAQ A;  1PCE A;  2JXD A;  3UGD A;  1CT4 I;  2JW6 A;  2GKV A;  2XRC A;  2VRW B;  3VE5 A;  2CJS C;  1V1I A;  2GVI A;  2QQC A;  1TBN A;  3HH2 C;  2YQP A;  1LR8 A;  2KMO A;  2DB6 A;  2WVJ A;  1SGP I;  4JCV E;  4L9M A;  1H0Z A;  1UVF A;  2NU1 I;  1M8C A;  2SGD I;  1RFH A;  2GKT I;  3B4V C;  1OVO A;  1TUR A;  3D00 A;  1YU6 C;  1PTR A;  1CSO I;  2KMQ A;  1CT2 I;  3OVO A;  2M5X A;  5FUV A;  2WCY A;  5DAE A;  1CGJ I;  3VDP A;  4E1R A;  3OXG A;  5EX3 A;  2NU3 I;  1PPF I;  1TUS A;  1IW4 A;  2UZ3 A;  2J9R A;  2ERW A;  1HPT A;  3KY9 A;  2LEO A;  4HGU A;  2KCX A;  1NUB A;  2ENZ A;  3UGI A;  2ORV A;  1LR7 A;  1DS2 I;  2OVO A;  2OD1 A;  1Y1B A;  1X4S A;  1MT1 A;  2DIP A;  3FC3 A;  1TGS I;  1W3S A;  1Y1C A;  2J87 A;  5FUW A;  1XBT A;  4SGB I;  4E1P A;  3SGQ I;  2F3C I;  2ROW A;  1CT0 I;  5HQ8 A;  1XA6 A;  2SGQ I;  1OYV I;  1UVG A;  2N1A B;  2N52 A;  1N13 A;  2ELI A;  1TIH A;  2ODD A;  1U5K A;  1HDL A;  2ENN A;  2N17 A;  1SGQ I;  2NU2 I;  2V53 A;  1KMA A;  2L7X A;  1YTP A;  1PJU A;  2B0U C;  2GKR I;  2QQ0 A;  3MEK A;  2B8T A;  1IY6 A;  2JYY A;  3RU0 A;  2ARP F;  2A20 A;  1M8B A;  2ORW A;  3UEJ A;  3CXL A;  1SGN I;  5CCM A;  1VDD A;  2BUS A;  3OXF A;  1IY5 A;  5JHW C;  4A24 A;  2V1C C;  2K9H A;  2FNF X;  2KMP A;  3UFF A;  1CHO I;  4GI3 C;  2JZM A;  2SGP I;  4B6D A;  2JA1 A;  1TBQ R;  1W4R A;  3SEK C;  2SGE I;  4UXI A;  5FUY A;  1PTQ A;  3QTL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...