2OVOA

The crystal and molecular structure of the third domain of silver pheasant ovomucoid (omsvp3)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID THIRD DOMAIN
publication title The crystal and molecular structure of the third domain of silver pheasant ovomucoid (OMSVP3).
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Proteinase inhibitor (kazal)
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ovoA00
2P6AC 2B0UC 2V53A 3QTLD 1LR9A 2NU0I 4GI3C 3OVOA 2NU4I 2KMOA 1CGJI 2QQCA 2N17A 5JHWC 1Y1BA 1DS2I 1Y1CA 1OMTA 1BUSA 2NU1I 2SGDI 1CE3A 1OYVI 1CSOI 1IY6A 1CGII 1R0RI 1SGRI 2KMQA 2SGEI 2KMPA 1OMUA 1TIHA 1KMAA 1NUBA 1CHOI 1MT1A 1YU6C 1IY5A 1IW4A 2JXDA 1H0ZA 1PCEA 5DAEA 1M8BA 1BMOA 1AN1I 1M8CA 2M5XA 1SGNI 3SGBI 2NU2I 3HH2C 1FYBA 2OVOA 2ARPF 2GKRI 2KCXA 1SGPI 2KMRA 1SGEI 2BUSA 2WCYA 3B4VC 1UUCA 1CT0I 2SGQI 3SGQI 2XRCA 1YTPA 1LR7A 1UVFA 1PPFI 1N13A 1CT4I 1HPTA 2N52A 4SGBI 1TURA 2N71A 2SGFI 1TGSI 1SGYI 1SGDI 3TJQA 2NU3I 1PJUA 2JZMA 2F3CI 3SEKC 1LR8A 1UVGA 1TBRR 1SGQI 2LEOA 1TBQR 1OVOA 1DS3I 1TUSA 2JYYA 2ERWA 2SGPI 2GKVA 1CT2I 2QQDA 4HGUA 2GKTI 1HJAI 1Z7KB 1HDLA 4OVOA
chains in the Genus database with same CATH superfamily
2P6AC 1UHAA 2B0UC 2V53A 2WVJA 3FSYA 1MJ9A 2ENZA 3BJIA 3QTLD 1LR9A 5HQ8A 5J8CA 2NU0I 2W0TA 4GI3C 3OVOA 4FKDA 2NU4I 1TBOA 2KMOA 1CGJI 2QQCA 1WGCA 5FUYA 1NXUA 3R5BA 2N17A 3UFFA 4OVOA 1TBNA 2ORVA 2YUUA 4E1PA 1Y1BA 5JHWC 1DS2I 1Y1CA 5HI7A 3GOXA 1OMTA 1BUSA 2UVOA 5FUVA 4A24A 2OU2A 3TOBA 1FAQA 2DIPA 1ULMA 4UXIA 2NU1I 2SGDI 1CE3A 1OYVI 2J9RA 1CSOI 1IY6A 1V1IA 4MPIA 4B6DA 1P9ZA 3VDUA 4JCVE 3TOAA 1CGII 1R0RI 1SGRI 2KMQA 2QQ0A 2SGEI 5E3RA 3UEYA 2CWGA 1W4RA 2KMPA 3QWPA 1OMUA 4E1RA 1TIHA 2Y0MA 1ULKA 2UZ3A 4WP4A 1KMAA 2ROWA 1NUBA 1FARA 2E73A 1CHOI 1MT1A 1YU6C 1IY5A 1Y8FA 1Z2IA 3TO7A 3UEJA 1MJBA 1WGTA 2J87A 5E3QA 1IW4A 3UGLA 1XX6A 2CJSC 1Q9BA 2JW6A 1MJAA 2JXDA 2L7XA 1H0ZA 1PCEA 2QPOA 5DAEA 2X3TA 9WGAA 1M8BA 1BMOA 4AMLA 3R5AA 1W3SA 1RFHA 5CCLA 1AN1I 1M8CA 1PTRA 1SGNI 2M5XA 4L9MA 5EX0A 3SGBI 3OXGA 2NU2I 3HH2C 1FYBA 2OVOA 2DB6A 2WGCA 2ARPF 2ENNA 2GKRI 2KCXA 3E59A 1SGPI 2KMRA 3VE5A 1SGEI 2LUYA 2BUSA 2WCYA 3B4VC 1UUCA 1CT0I 2SGQI 3SGQI 3FSXA 2RIJA 2XRCA 1YTPA 3CXLA 1LR7A 2OD1A 1UVFA 1U5KA 2ELIA 1S20A 1XA6A 1PPFI 3R5DA 7WGAA 1N13A 1CT4I 2GIVA 2QQEA 1FY7A 1TOTA 5FUXA 1KBFA 1XBTA 3PDNA 2L8EA 2YQPA 4DNCA 3OXFA 1HPTA 3OL0A 3UGIA 2N52A 1KBEA 4SGBI 4UXJA 2LB7A 3MEKA 3VDPA 1TURA 2N71A 2SGFI 3D00A 5J8FA 1TGSI 2FNFX 3UGDA 1SGYI 1SGDI 3TJQA 3FC3A 2NU3I 1HEVA 1PJUA 2JZMA 2V1CA 2A20A 1WKXA 2F3CI 5E3PA 1X74A 1WTJA 2CWHA 3RU0A 3SEKC 1LR8A 1K7TA 2B8TA 3QAHA 3TO9A 2GVIA 5FUWA 3E2IA 3R5CA 1UVGA 1PTQA 1TBRR 1K7VA 1SGQI 2ODDA 2LEOA 2OZUA 1X4SA 2X52A 3TO6A 1TBQR 1OVOA 3OXLA 2K9HA 2ORWA 1DS3I 2N1AB 1TUSA 5EX3A 1R79A 2JYYA 2ERWA 1ULNA 1K7UA 2RC4A 2SGPI 2PQ8A 2VRWB 2GKVA 5CCMA 1CT2I 1VDDA 2QQDA 4HGUA 1P9GA 2GKTI 2V1CC 1HJAI 2JA1A 1Z7KB 2CWFA 1HDLA 3KY9A 1V1HA 2E5RA 3UOEA 4UXHA 2DKVA
chains in the Genus database with same CATH topology
2P6AC 2B0UC 2V53A 2WVJA 3QTLD 3BJIA 2ENZA 1LR9A 5HQ8A 2NU0I 2W0TA 4GI3C 3OVOA 4FKDA 2NU4I 1TBOA 2KMOA 1CGJI 2QQCA 5FUYA 2N17A 3UFFA 4OVOA 1TBNA 2ORVA 2YUUA 4E1PA 1Y1BA 5JHWC 1DS2I 1Y1CA 5HI7A 3GOXA 1OMTA 1BUSA 5FUVA 4A24A 1FAQA 2DIPA 4UXIA 2NU1I 2SGDI 1CE3A 1OYVI 2J9RA 1CSOI 1IY6A 1V1IA 4B6DA 3VDUA 4JCVE 1CGII 1R0RI 1SGRI 2KMQA 2QQ0A 2SGEI 3UEYA 1W4RA 2KMPA 3QWPA 1OMUA 4E1RA 1TIHA 2UZ3A 1KMAA 2ROWA 1NUBA 1FARA 2E73A 1CHOI 1MT1A 1YU6C 1IY5A 1Y8FA 3UEJA 2J87A 1IW4A 3UGLA 1XX6A 2CJSC 2JW6A 2JXDA 2L7XA 1H0ZA 1PCEA 2QPOA 5DAEA 1M8BA 1BMOA 1W3SA 1RFHA 5CCLA 1AN1I 1M8CA 1PTRA 1SGNI 2M5XA 4L9MA 5EX0A 3SGBI 3OXGA 2NU2I 3HH2C 1FYBA 2OVOA 2DB6A 2ARPF 2ENNA 2GKRI 2KCXA 3E59A 1SGPI 2KMRA 3VE5A 1SGEI 2LUYA 2BUSA 2WCYA 3B4VC 1UUCA 1CT0I 2SGQI 3SGQI 2XRCA 1YTPA 3CXLA 1LR7A 2OD1A 1UVFA 1U5KA 2ELIA 1XA6A 1PPFI 1N13A 1CT4I 2QQEA 1TOTA 1KBFA 1XBTA 3PDNA 2L8EA 2YQPA 3OXFA 1HPTA 3OL0A 3UGIA 2N52A 1KBEA 4SGBI 4UXJA 3VDPA 3MEKA 1TURA 2N71A 2SGFI 3D00A 1TGSI 2FNFX 3UGDA 1SGYI 1SGDI 3TJQA 3FC3A 2NU3I 1PJUA 2JZMA 2V1CA 2A20A 2F3CI 1X74A 3SEKC 3RU0A 1LR8A 2B8TA 2GVIA 5FUWA 3E2IA 1UVGA 1PTQA 1TBRR 1SGQI 2ODDA 2LEOA 1X4SA 1TBQR 1OVOA 3OXLA 2K9HA 2ORWA 1DS3I 2N1AB 1TUSA 5EX3A 1R79A 2JYYA 2ERWA 5FUXA 2SGPI 2VRWB 2GKVA 5CCMA 1CT2I 1VDDA 2QQDA 4HGUA 2GKTI 2V1CC 1HJAI 2JA1A 1Z7KB 1HDLA 3KY9A 1V1HA 2E5RA 4UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6A C;  2B0U C;  2V53 A;  3QTL D;  1LR9 A;  2NU0 I;  4GI3 C;  3OVO A;  2NU4 I;  2KMO A;  1CGJ I;  2QQC A;  2N17 A;  5JHW C;  1Y1B A;  1DS2 I;  1Y1C A;  1OMT A;  1BUS A;  2NU1 I;  2SGD I;  1CE3 A;  1OYV I;  1CSO I;  1IY6 A;  1CGI I;  1R0R I;  1SGR I;  2KMQ A;  2SGE I;  2KMP A;  1OMU A;  1TIH A;  1KMA A;  1NUB A;  1CHO I;  1MT1 A;  1YU6 C;  1IY5 A;  1IW4 A;  2JXD A;  1H0Z A;  1PCE A;  5DAE A;  1M8B A;  1BMO A;  1AN1 I;  1M8C A;  2M5X A;  1SGN I;  3SGB I;  2NU2 I;  3HH2 C;  1FYB A;  2OVO A;  2ARP F;  2GKR I;  2KCX A;  1SGP I;  2KMR A;  1SGE I;  2BUS A;  2WCY A;  3B4V C;  1UUC A;  1CT0 I;  2SGQ I;  3SGQ I;  2XRC A;  1YTP A;  1LR7 A;  1UVF A;  1PPF I;  1N13 A;  1CT4 I;  1HPT A;  2N52 A;  4SGB I;  1TUR A;  2N71 A;  2SGF I;  1TGS I;  1SGY I;  1SGD I;  3TJQ A;  2NU3 I;  1PJU A;  2JZM A;  2F3C I;  3SEK C;  1LR8 A;  1UVG A;  1TBR R;  1SGQ I;  2LEO A;  1TBQ R;  1OVO A;  1DS3 I;  1TUS A;  2JYY A;  2ERW A;  2SGP I;  2GKV A;  1CT2 I;  2QQD A;  4HGU A;  2GKT I;  1HJA I;  1Z7K B;  1HDL A;  4OVO A; 
#chains in the Genus database with same CATH topology
 2P6A C;  1UHA A;  2B0U C;  2V53 A;  2WVJ A;  3FSY A;  1MJ9 A;  2ENZ A;  3BJI A;  3QTL D;  1LR9 A;  5HQ8 A;  5J8C A;  2NU0 I;  2W0T A;  4GI3 C;  3OVO A;  4FKD A;  2NU4 I;  1TBO A;  2KMO A;  1CGJ I;  2QQC A;  1WGC A;  5FUY A;  1NXU A;  3R5B A;  2N17 A;  3UFF A;  4OVO A;  1TBN A;  2ORV A;  2YUU A;  4E1P A;  1Y1B A;  5JHW C;  1DS2 I;  1Y1C A;  5HI7 A;  3GOX A;  1OMT A;  1BUS A;  2UVO A;  5FUV A;  4A24 A;  2OU2 A;  3TOB A;  1FAQ A;  2DIP A;  1ULM A;  4UXI A;  2NU1 I;  2SGD I;  1CE3 A;  1OYV I;  2J9R A;  1CSO I;  1IY6 A;  1V1I A;  4MPI A;  4B6D A;  1P9Z A;  3VDU A;  4JCV E;  3TOA A;  1CGI I;  1R0R I;  1SGR I;  2KMQ A;  2QQ0 A;  2SGE I;  5E3R A;  3UEY A;  2CWG A;  1W4R A;  2KMP A;  3QWP A;  1OMU A;  4E1R A;  1TIH A;  2Y0M A;  1ULK A;  2UZ3 A;  4WP4 A;  1KMA A;  2ROW A;  1NUB A;  1FAR A;  2E73 A;  1CHO I;  1MT1 A;  1YU6 C;  1IY5 A;  1Y8F A;  1Z2I A;  3TO7 A;  3UEJ A;  1MJB A;  1WGT A;  2J87 A;  5E3Q A;  1IW4 A;  3UGL A;  1XX6 A;  2CJS C;  1Q9B A;  2JW6 A;  1MJA A;  2JXD A;  2L7X A;  1H0Z A;  1PCE A;  2QPO A;  5DAE A;  2X3T A;  9WGA A;  1M8B A;  1BMO A;  4AML A;  3R5A A;  1W3S A;  1RFH A;  5CCL A;  1AN1 I;  1M8C A;  1PTR A;  1SGN I;  2M5X A;  4L9M A;  5EX0 A;  3SGB I;  3OXG A;  2NU2 I;  3HH2 C;  1FYB A;  2OVO A;  2DB6 A;  2WGC A;  2ARP F;  2ENN A;  2GKR I;  2KCX A;  3E59 A;  1SGP I;  2KMR A;  3VE5 A;  1SGE I;  2LUY A;  2BUS A;  2WCY A;  3B4V C;  1UUC A;  1CT0 I;  2SGQ I;  3SGQ I;  3FSX A;  2RIJ A;  2XRC A;  1YTP A;  3CXL A;  1LR7 A;  2OD1 A;  1UVF A;  1U5K A;  2ELI A;  1S20 A;  1XA6 A;  1PPF I;  3R5D A;  7WGA A;  1N13 A;  1CT4 I;  2GIV A;  2QQE A;  1FY7 A;  1TOT A;  5FUX A;  1KBF A;  1XBT A;  3PDN A;  2L8E A;  2YQP A;  4DNC A;  3OXF A;  1HPT A;  3OL0 A;  3UGI A;  2N52 A;  1KBE A;  4SGB I;  4UXJ A;  2LB7 A;  3MEK A;  3VDP A;  1TUR A;  2N71 A;  2SGF I;  3D00 A;  5J8F A;  1TGS I;  2FNF X;  3UGD A;  1SGY I;  1SGD I;  3TJQ A;  3FC3 A;  2NU3 I;  1HEV A;  1PJU A;  2JZM A;  2V1C A;  2A20 A;  1WKX A;  2F3C I;  5E3P A;  1X74 A;  1WTJ A;  2CWH A;  3RU0 A;  3SEK C;  1LR8 A;  1K7T A;  2B8T A;  3QAH A;  3TO9 A;  2GVI A;  5FUW A;  3E2I A;  3R5C A;  1UVG A;  1PTQ A;  1TBR R;  1K7V A;  1SGQ I;  2ODD A;  2LEO A;  2OZU A;  1X4S A;  2X52 A;  3TO6 A;  1TBQ R;  1OVO A;  3OXL A;  2K9H A;  2ORW A;  1DS3 I;  2N1A B;  1TUS A;  5EX3 A;  1R79 A;  2JYY A;  2ERW A;  1ULN A;  1K7U A;  2RC4 A;  2SGP I;  2PQ8 A;  2VRW B;  2GKV A;  5CCM A;  1CT2 I;  1VDD A;  2QQD A;  4HGU A;  1P9G A;  2GKT I;  2V1C C;  1HJA I;  2JA1 A;  1Z7K B;  2CWF A;  1HDL A;  3KY9 A;  1V1H A;  2E5R A;  3UOE A;  4UXH A;  2DKV A; 
#chains in the Genus database with same CATH homology
 2P6A C;  2B0U C;  2V53 A;  2WVJ A;  3QTL D;  3BJI A;  2ENZ A;  1LR9 A;  5HQ8 A;  2NU0 I;  2W0T A;  4GI3 C;  3OVO A;  4FKD A;  2NU4 I;  1TBO A;  2KMO A;  1CGJ I;  2QQC A;  5FUY A;  2N17 A;  3UFF A;  4OVO A;  1TBN A;  2ORV A;  2YUU A;  4E1P A;  1Y1B A;  5JHW C;  1DS2 I;  1Y1C A;  5HI7 A;  3GOX A;  1OMT A;  1BUS A;  5FUV A;  4A24 A;  1FAQ A;  2DIP A;  4UXI A;  2NU1 I;  2SGD I;  1CE3 A;  1OYV I;  2J9R A;  1CSO I;  1IY6 A;  1V1I A;  4B6D A;  3VDU A;  4JCV E;  1CGI I;  1R0R I;  1SGR I;  2KMQ A;  2QQ0 A;  2SGE I;  3UEY A;  1W4R A;  2KMP A;  3QWP A;  1OMU A;  4E1R A;  1TIH A;  2UZ3 A;  1KMA A;  2ROW A;  1NUB A;  1FAR A;  2E73 A;  1CHO I;  1MT1 A;  1YU6 C;  1IY5 A;  1Y8F A;  3UEJ A;  2J87 A;  1IW4 A;  3UGL A;  1XX6 A;  2CJS C;  2JW6 A;  2JXD A;  2L7X A;  1H0Z A;  1PCE A;  2QPO A;  5DAE A;  1M8B A;  1BMO A;  1W3S A;  1RFH A;  5CCL A;  1AN1 I;  1M8C A;  1PTR A;  1SGN I;  2M5X A;  4L9M A;  5EX0 A;  3SGB I;  3OXG A;  2NU2 I;  3HH2 C;  1FYB A;  2OVO A;  2DB6 A;  2ARP F;  2ENN A;  2GKR I;  2KCX A;  3E59 A;  1SGP I;  2KMR A;  3VE5 A;  1SGE I;  2LUY A;  2BUS A;  2WCY A;  3B4V C;  1UUC A;  1CT0 I;  2SGQ I;  3SGQ I;  2XRC A;  1YTP A;  3CXL A;  1LR7 A;  2OD1 A;  1UVF A;  1U5K A;  2ELI A;  1XA6 A;  1PPF I;  1N13 A;  1CT4 I;  2QQE A;  1TOT A;  1KBF A;  1XBT A;  3PDN A;  2L8E A;  2YQP A;  3OXF A;  1HPT A;  3OL0 A;  3UGI A;  2N52 A;  1KBE A;  4SGB I;  4UXJ A;  3VDP A;  3MEK A;  1TUR A;  2N71 A;  2SGF I;  3D00 A;  1TGS I;  2FNF X;  3UGD A;  1SGY I;  1SGD I;  3TJQ A;  3FC3 A;  2NU3 I;  1PJU A;  2JZM A;  2V1C A;  2A20 A;  2F3C I;  1X74 A;  3SEK C;  3RU0 A;  1LR8 A;  2B8T A;  2GVI A;  5FUW A;  3E2I A;  1UVG A;  1PTQ A;  1TBR R;  1SGQ I;  2ODD A;  2LEO A;  1X4S A;  1TBQ R;  1OVO A;  3OXL A;  2K9H A;  2ORW A;  1DS3 I;  2N1A B;  1TUS A;  5EX3 A;  1R79 A;  2JYY A;  2ERW A;  5FUX A;  2SGP I;  2VRW B;  2GKV A;  5CCM A;  1CT2 I;  1VDD A;  2QQD A;  4HGU A;  2GKT I;  2V1C C;  1HJA I;  2JA1 A;  1Z7K B;  1HDL A;  3KY9 A;  1V1H A;  2E5R A;  4UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...