3UGDA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein kinase C delta type
publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugdA01
4UXIA 3UEYA 2QPOA 1R79A 1KBEA 1PTQA 2ORWA 2ENNA 2ENZA 3UGIA 4L9MA 4UXHA 4UXJA 1KBFA 1XX6A 3CXLA 1XBTA 2UZ3A 5FUYA 5FUVA 2J87A 1TBOA 1RFHA 3UFFA 2B8TA 1TBNA 2QQ0A 1FAQA 3UGLA 1W4RA 1XA6A 5FUXA 2J9RA 4FKDA 2DB6A 2ORVA 1FARA 3KY9A 2JA1A 1Y8FA 2WVJA 3E2IA 2GVIA 3UGDA 1PTRA 2VRWB 4B6DA 2ELIA 2QQEA 2E73A 2FNFX 3UEJA 2YUUA 3BJIA 5FUWA 2ROWA
chains in the Genus database with same CATH superfamily
1ULMA 2GIVA 1VDDA 2QPOA 3UEYA 1BMOA 1X4SA 3TO6A 1KBEA 2WCYA 1PTQA 3R5AA 5E3RA 1NUBA 2M5XA 2N52A 2NU3I 2ORWA 1IW4A 4JCVE 2E5RA 2ENNA 1S20A 1CT2I 1CT4I 1CT0I 1TIHA 1TBQR 1XX6A 2SGDI 3TOAA 3OXGA 1SGNI 1UVFA 2K9HA 1CE3A 2CWFA 2OZUA 3OVOA 1BUSA 1TBNA 2B8TA 2ERWA 2NU1I 2QQ0A 2V53A 1K7UA 2SGEI 1XA6A 2J9RA 2B0UC 4FKDA 1IY6A 1ULNA 1FARA 2LUYA 1UUCA 4HGUA 1DS3I 2LB7A 3VDUA 2UVOA 1PPFI 3PDNA 3VE5A 2QQCA 4AMLA 1PTRA 1MJAA 3UEJA 2FNFX 2ARPF 2JZMA 5J8FA 2YUUA 2CWHA 2RC4A 5FUWA 2ROWA 1R0RI 1OYVI 1N13A 2GKTI 3R5CA 3R5DA 1PJUA 1MJ9A 5CCMA 1V1HA 5JHWC 2DKVA 2JYYA 1LR8A 4UXHA 1TURA 1UVGA 4OVOA 3TOBA 3GOXA 1UHAA 2UZ3A 3CXLA 1P9GA 1DS2I 2YQPA 2J87A 1AN1I 3VDPA 2JXDA 7WGAA 5CCLA 2DIPA 2JW6A 2KMRA 1ULKA 3UFFA 1FAQA 1WKXA 1LR7A 1X74A 1Y1CA 2X3TA 3QWPA 1MJBA 4GI3C 3B4VC 4E1RA 2N1AB 2SGFI 2XRCA 3E2IA 4SGBI 2GVIA 3RU0A 2SGQI 1WGCA 1HJAI 1IY5A 1OMUA 2E73A 2QQEA 5EX0A 3TJQA 2KMPA 2V1CA 3UOEA 2QQDA 1W3SA 4UXIA 5EX3A 2BUSA 1SGPI 4MPIA 3OL0A 2F3CI 3R5BA 3BJIA 3FSXA 1Z7KB 3OXLA 3HH2C 1TOTA 3SGQI 1FY7A 1KBFA 2GKRI 2N17A 2CWGA 2LEOA 5FUYA 2KCXA 1Q9BA 1TBRR 1OMTA 2SGPI 3TO9A 1K7VA 1TBOA 1HDLA 3FSYA 4E1PA 1Z2IA 2NU4I 1P9ZA 1SGRI 1SGEI 2KMOA 3UGLA 5FUXA 1U5KA 2WGCA 3QTLD 2ORVA 5HI7A 1WGTA 2GKVA 1YU6C 2KMQA 2ODDA 2P6AC 5E3QA 3TO7A 3UGDA 3QAHA 3E59A 1PCEA 4B6DA 2ELIA 1HEVA 2CJSC 3OXFA 4DNCA 3UGIA 1FYBA 4WP4A 1K7TA 1R79A 2N71A 1SGDI 1SGYI 1NXUA 5DAEA 3MEKA 2A20A 2OD1A 2ENZA 5J8CA 2L7XA 4L9MA 1TUSA 4UXJA 1LR9A 1CHOI 1OVOA 1SGQI 1XBTA 2X52A 2NU0I 5FUVA 2Y0MA 1Y1BA 1H0ZA 1RFHA 3FC3A 2L8EA 1KMAA 1CGJI 2RIJA 1W4RA 3SGBI 2PQ8A 2DB6A 3SEKC 1CGII 3KY9A 2JA1A 1Y8FA 2WVJA 5HQ8A 2OVOA 2W0TA 5E3PA 4A24A 1MT1A 1M8CA 1TGSI 2NU2I 1V1IA 2V1CC 1CSOI 2VRWB 9WGAA 1M8BA 1WTJA 3D00A 2OU2A 1HPTA 1YTPA
chains in the Genus database with same CATH topology
3UEYA 2QPOA 1VDDA 1BMOA 1X4SA 1KBEA 2WCYA 1PTQA 1NUBA 2M5XA 2N52A 2NU3I 2ORWA 1IW4A 4JCVE 2E5RA 2ENNA 1CT2I 1CT4I 1CT0I 1TIHA 1TBQR 1XX6A 2SGDI 1CE3A 3OXGA 1SGNI 1UVFA 2K9HA 3OVOA 1BUSA 1TBNA 2B8TA 2ERWA 2NU1I 2QQ0A 2V53A 2SGEI 1XA6A 2J9RA 2B0UC 4FKDA 1IY6A 1FARA 2LUYA 1UUCA 4HGUA 1DS3I 3VDUA 3VE5A 1PPFI 3PDNA 2QQCA 1PTRA 3UEJA 2FNFX 2ARPF 2JZMA 2YUUA 5FUWA 2ROWA 1R0RI 1OYVI 1N13A 2GKTI 1PJUA 5CCMA 1V1HA 5JHWC 2JYYA 1LR8A 4UXHA 1TURA 1UVGA 4OVOA 3GOXA 3CXLA 2UZ3A 3VDPA 2YQPA 1DS2I 2J87A 1AN1I 5CCLA 2JXDA 3FC3A 2DIPA 2JW6A 2KMRA 3UFFA 1FAQA 1X74A 1LR7A 1Y1CA 3QWPA 4GI3C 4E1RA 3B4VC 2N1AB 2SGFI 2XRCA 3E2IA 4SGBI 2GVIA 3RU0A 2SGQI 1HJAI 1IY5A 1OMUA 2E73A 2QQEA 5EX0A 3TJQA 2KMPA 2V1CA 2QQDA 1W3SA 4UXIA 5EX3A 2BUSA 1SGPI 3OL0A 2F3CI 1Z7KB 3OXLA 3HH2C 1TOTA 3SGQI 1KBFA 2GKRI 2N17A 5FUYA 2LEOA 2KCXA 1TBRR 1OMTA 2SGPI 1TBOA 1HDLA 4E1PA 2NU4I 1SGRI 2KMOA 1SGEI 3UGLA 5FUXA 1U5KA 3QTLD 2ORVA 5HI7A 2GKVA 1YU6C 2KMQA 2ODDA 2P6AC 3UGDA 3E59A 1PCEA 4B6DA 2ELIA 2CJSC 3OXFA 3UGIA 1FYBA 1R79A 2N71A 1SGDI 1SGYI 5DAEA 3MEKA 2A20A 2OD1A 2ENZA 2L7XA 4L9MA 1TUSA 4UXJA 1LR9A 1CHOI 1OVOA 1SGQI 1XBTA 5FUVA 2NU0I 1Y1BA 1H0ZA 1RFHA 1KMAA 2L8EA 1CGJI 1W4RA 3SGBI 2DB6A 3SEKC 1CGII 3KY9A 2JA1A 1Y8FA 2WVJA 5HQ8A 2OVOA 2W0TA 4A24A 1MT1A 1M8CA 1TGSI 2NU2I 1V1IA 2V1CC 1CSOI 2VRWB 1M8BA 3BJIA 3D00A 1HPTA 1YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXI A;  3UEY A;  2QPO A;  1R79 A;  1KBE A;  1PTQ A;  2ORW A;  2ENN A;  2ENZ A;  3UGI A;  4L9M A;  4UXH A;  4UXJ A;  1KBF A;  1XX6 A;  3CXL A;  1XBT A;  2UZ3 A;  5FUY A;  5FUV A;  2J87 A;  1TBO A;  1RFH A;  3UFF A;  2B8T A;  1TBN A;  2QQ0 A;  1FAQ A;  3UGL A;  1W4R A;  1XA6 A;  5FUX A;  2J9R A;  4FKD A;  2DB6 A;  2ORV A;  1FAR A;  3KY9 A;  2JA1 A;  1Y8F A;  2WVJ A;  3E2I A;  2GVI A;  3UGD A;  1PTR A;  2VRW B;  4B6D A;  2ELI A;  2QQE A;  2E73 A;  2FNF X;  3UEJ A;  2YUU A;  3BJI A;  5FUW A;  2ROW A; 
#chains in the Genus database with same CATH topology
 1ULM A;  2GIV A;  1VDD A;  2QPO A;  3UEY A;  1BMO A;  1X4S A;  3TO6 A;  1KBE A;  2WCY A;  1PTQ A;  3R5A A;  5E3R A;  1NUB A;  2M5X A;  2N52 A;  2NU3 I;  2ORW A;  1IW4 A;  4JCV E;  2E5R A;  2ENN A;  1S20 A;  1CT2 I;  1CT4 I;  1CT0 I;  1TIH A;  1TBQ R;  1XX6 A;  2SGD I;  3TOA A;  3OXG A;  1SGN I;  1UVF A;  2K9H A;  1CE3 A;  2CWF A;  2OZU A;  3OVO A;  1BUS A;  1TBN A;  2B8T A;  2ERW A;  2NU1 I;  2QQ0 A;  2V53 A;  1K7U A;  2SGE I;  1XA6 A;  2J9R A;  2B0U C;  4FKD A;  1IY6 A;  1ULN A;  1FAR A;  2LUY A;  1UUC A;  4HGU A;  1DS3 I;  2LB7 A;  3VDU A;  2UVO A;  1PPF I;  3PDN A;  3VE5 A;  2QQC A;  4AML A;  1PTR A;  1MJA A;  3UEJ A;  2FNF X;  2ARP F;  2JZM A;  5J8F A;  2YUU A;  2CWH A;  2RC4 A;  5FUW A;  2ROW A;  1R0R I;  1OYV I;  1N13 A;  2GKT I;  3R5C A;  3R5D A;  1PJU A;  1MJ9 A;  5CCM A;  1V1H A;  5JHW C;  2DKV A;  2JYY A;  1LR8 A;  4UXH A;  1TUR A;  1UVG A;  4OVO A;  3TOB A;  3GOX A;  1UHA A;  2UZ3 A;  3CXL A;  1P9G A;  1DS2 I;  2YQP A;  2J87 A;  1AN1 I;  3VDP A;  2JXD A;  7WGA A;  5CCL A;  2DIP A;  2JW6 A;  2KMR A;  1ULK A;  3UFF A;  1FAQ A;  1WKX A;  1LR7 A;  1X74 A;  1Y1C A;  2X3T A;  3QWP A;  1MJB A;  4GI3 C;  3B4V C;  4E1R A;  2N1A B;  2SGF I;  2XRC A;  3E2I A;  4SGB I;  2GVI A;  3RU0 A;  2SGQ I;  1WGC A;  1HJA I;  1IY5 A;  1OMU A;  2E73 A;  2QQE A;  5EX0 A;  3TJQ A;  2KMP A;  2V1C A;  3UOE A;  2QQD A;  1W3S A;  4UXI A;  5EX3 A;  2BUS A;  1SGP I;  4MPI A;  3OL0 A;  2F3C I;  3R5B A;  3BJI A;  3FSX A;  1Z7K B;  3OXL A;  3HH2 C;  1TOT A;  3SGQ I;  1FY7 A;  1KBF A;  2GKR I;  2N17 A;  2CWG A;  2LEO A;  5FUY A;  2KCX A;  1Q9B A;  1TBR R;  1OMT A;  2SGP I;  3TO9 A;  1K7V A;  1TBO A;  1HDL A;  3FSY A;  4E1P A;  1Z2I A;  2NU4 I;  1P9Z A;  1SGR I;  1SGE I;  2KMO A;  3UGL A;  5FUX A;  1U5K A;  2WGC A;  3QTL D;  2ORV A;  5HI7 A;  1WGT A;  2GKV A;  1YU6 C;  2KMQ A;  2ODD A;  2P6A C;  5E3Q A;  3TO7 A;  3UGD A;  3QAH A;  3E59 A;  1PCE A;  4B6D A;  2ELI A;  1HEV A;  2CJS C;  3OXF A;  4DNC A;  3UGI A;  1FYB A;  4WP4 A;  1K7T A;  1R79 A;  2N71 A;  1SGD I;  1SGY I;  1NXU A;  5DAE A;  3MEK A;  2A20 A;  2OD1 A;  2ENZ A;  5J8C A;  2L7X A;  4L9M A;  1TUS A;  4UXJ A;  1LR9 A;  1CHO I;  1OVO A;  1SGQ I;  1XBT A;  2X52 A;  2NU0 I;  5FUV A;  2Y0M A;  1Y1B A;  1H0Z A;  1RFH A;  3FC3 A;  2L8E A;  1KMA A;  1CGJ I;  2RIJ A;  1W4R A;  3SGB I;  2PQ8 A;  2DB6 A;  3SEK C;  1CGI I;  3KY9 A;  2JA1 A;  1Y8F A;  2WVJ A;  5HQ8 A;  2OVO A;  2W0T A;  5E3P A;  4A24 A;  1MT1 A;  1M8C A;  1TGS I;  2NU2 I;  1V1I A;  2V1C C;  1CSO I;  2VRW B;  9WGA A;  1M8B A;  1WTJ A;  3D00 A;  2OU2 A;  1HPT A;  1YTP A; 
#chains in the Genus database with same CATH homology
 3UEY A;  2QPO A;  1VDD A;  1BMO A;  1X4S A;  1KBE A;  2WCY A;  1PTQ A;  1NUB A;  2M5X A;  2N52 A;  2NU3 I;  2ORW A;  1IW4 A;  4JCV E;  2E5R A;  2ENN A;  1CT2 I;  1CT4 I;  1CT0 I;  1TIH A;  1TBQ R;  1XX6 A;  2SGD I;  1CE3 A;  3OXG A;  1SGN I;  1UVF A;  2K9H A;  3OVO A;  1BUS A;  1TBN A;  2B8T A;  2ERW A;  2NU1 I;  2QQ0 A;  2V53 A;  2SGE I;  1XA6 A;  2J9R A;  2B0U C;  4FKD A;  1IY6 A;  1FAR A;  2LUY A;  1UUC A;  4HGU A;  1DS3 I;  3VDU A;  3VE5 A;  1PPF I;  3PDN A;  2QQC A;  1PTR A;  3UEJ A;  2FNF X;  2ARP F;  2JZM A;  2YUU A;  5FUW A;  2ROW A;  1R0R I;  1OYV I;  1N13 A;  2GKT I;  1PJU A;  5CCM A;  1V1H A;  5JHW C;  2JYY A;  1LR8 A;  4UXH A;  1TUR A;  1UVG A;  4OVO A;  3GOX A;  3CXL A;  2UZ3 A;  3VDP A;  2YQP A;  1DS2 I;  2J87 A;  1AN1 I;  5CCL A;  2JXD A;  3FC3 A;  2DIP A;  2JW6 A;  2KMR A;  3UFF A;  1FAQ A;  1X74 A;  1LR7 A;  1Y1C A;  3QWP A;  4GI3 C;  4E1R A;  3B4V C;  2N1A B;  2SGF I;  2XRC A;  3E2I A;  4SGB I;  2GVI A;  3RU0 A;  2SGQ I;  1HJA I;  1IY5 A;  1OMU A;  2E73 A;  2QQE A;  5EX0 A;  3TJQ A;  2KMP A;  2V1C A;  2QQD A;  1W3S A;  4UXI A;  5EX3 A;  2BUS A;  1SGP I;  3OL0 A;  2F3C I;  1Z7K B;  3OXL A;  3HH2 C;  1TOT A;  3SGQ I;  1KBF A;  2GKR I;  2N17 A;  5FUY A;  2LEO A;  2KCX A;  1TBR R;  1OMT A;  2SGP I;  1TBO A;  1HDL A;  4E1P A;  2NU4 I;  1SGR I;  2KMO A;  1SGE I;  3UGL A;  5FUX A;  1U5K A;  3QTL D;  2ORV A;  5HI7 A;  2GKV A;  1YU6 C;  2KMQ A;  2ODD A;  2P6A C;  3UGD A;  3E59 A;  1PCE A;  4B6D A;  2ELI A;  2CJS C;  3OXF A;  3UGI A;  1FYB A;  1R79 A;  2N71 A;  1SGD I;  1SGY I;  5DAE A;  3MEK A;  2A20 A;  2OD1 A;  2ENZ A;  2L7X A;  4L9M A;  1TUS A;  4UXJ A;  1LR9 A;  1CHO I;  1OVO A;  1SGQ I;  1XBT A;  5FUV A;  2NU0 I;  1Y1B A;  1H0Z A;  1RFH A;  1KMA A;  2L8E A;  1CGJ I;  1W4R A;  3SGB I;  2DB6 A;  3SEK C;  1CGI I;  3KY9 A;  2JA1 A;  1Y8F A;  2WVJ A;  5HQ8 A;  2OVO A;  2W0T A;  4A24 A;  1MT1 A;  1M8C A;  1TGS I;  2NU2 I;  1V1I A;  2V1C C;  1CSO I;  2VRW B;  1M8B A;  3BJI A;  3D00 A;  1HPT A;  1YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...