3UGDA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugdA01
2QQ0A 2YUUA 1PTQA 1FARA 4UXHA 3UGIA 4UXIA 1RFHA 2UZ3A 1Y8FA 2WVJA 3KY9A 1TBOA 2B8TA 2ENZA 3BJIA 5FUWA 4UXJA 2QQEA 1FAQA 1R79A 5FUYA 3UGLA 3UGDA 3UFFA 2FNFX 2J9RA 4FKDA 2ELIA 2VRWB 2QPOA 2E73A 2DB6A 3UEYA 1KBFA 2JA1A 1XX6A 2ORWA 3E2IA 4B6DA 1KBEA 5FUXA 5FUVA 2GVIA 1W4RA 2J87A 2ORVA 3CXLA 1PTRA 2ENNA 1XA6A 1TBNA 1XBTA 3UEJA 4L9MA 2ROWA
chains in the Genus database with same CATH superfamily
2QQ0A 2RIJA 1K7VA 2X3TA 3SGBI 4UXIA 4GI3C 2LEOA 1TBOA 2B8TA 2WGCA 2LUYA 4E1RA 1IY6A 4JCVE 1OVOA 2GIVA 1BUSA 1SGEI 2QQEA 1K7UA 1PCEA 2GKVA 2X52A 3QAHA 1CGII 1R79A 1X4SA 2JYYA 1HPTA 3UGDA 1SGRI 1OYVI 2SGEI 1IY5A 2CJSC 2E73A 2KCXA 1BMOA 1KBFA 1XX6A 2GKRI 2QQCA 1TBRR 1TUSA 2DIPA 3OL0A 5E3RA 1DS2I 1N13A 2LB7A 1WGTA 1LR7A 1ULKA 1UVFA 1CT4I 1UVGA 2DKVA 3R5DA 1TIHA 1W4RA 2OZUA 1CT0I 1WKXA 2WCYA 1Z7KB 5EX0A 1PTRA 3R5AA 2YQPA 2F3CI 1KMAA 1XBTA 4HGUA 4L9MA 1PPFI 9WGAA 2UVOA 4UXHA 1PTQA 1SGDI 1Y1BA 1ULMA 2UZ3A 1Y8FA 4MPIA 1R0RI 1WGCA 5CCMA 1ULNA 2ENZA 2NU1I 2BUSA 1M8BA 5DAEA 4UXJA 1CSOI 2ERWA 1VDDA 2A20A 1CGJI 2OD1A 1TBQR 2KMPA 2SGDI 3FSYA 5E3PA 1H0ZA 1CT2I 1MJ9A 2VRWB 3HH2C 1FYBA 2V1CC 5CCLA 1NUBA 3TO7A 1TURA 2JA1A 5HI7A 4OVOA 2ORWA 1K7TA 3E2IA 4B6DA 2JW6A 2N17A 2ODDA 3UOEA 5J8CA 5FUXA 4WP4A 5FUVA 3QTLD 1V1IA 2NU4I 2SGPI 1FY7A 1HEVA 3SGQI 1Y1CA 2RC4A 1IW4A 1XA6A 3UEJA 1LR9A 1MT1A 3R5CA 1TOTA 2YUUA 1HDLA 1FARA 1RFHA 2WVJA 3B4VC 3KY9A 2L7XA 1HJAI 3BJIA 3D00A 3TJQA 1M8CA 1MJBA 2ARPF 1AN1I 2V53A 5FUYA 2OVOA 3UGLA 1TGSI 4FKDA 4A24A 3GOXA 1DS3I 2QPOA 1CHOI 4SGBI 2K9HA 2OU2A 3VDPA 2L8EA 3RU0A 2CWHA 2CWGA 2NU0I 3OVOA 2QQDA 3R5BA 1LR8A 1NXUA 3TOAA 1KBEA 2NU3I 2JXDA 2Y0MA 2GVIA 2N52A 1S20A 2N1AB 3FSXA 1MJAA 4E1PA 1YTPA 3CXLA 7WGAA 4AMLA 2W0TA 2ENNA 1WTJA 3SEKC 1SGQI 2ROWA 5JHWC 1OMTA 1P9ZA 1UHAA 2PQ8A 3UGIA 1CE3A 2CWFA 1V1HA 1X74A 2GKTI 5FUWA 1W3SA 3TO6A 5EX3A 2P6AC 2KMRA 2KMOA 1FAQA 2N71A 3QWPA 2M5XA 3TO9A 3UFFA 2FNFX 1Q9BA 1SGNI 2J9RA 2ELIA 2SGQI 3VE5A 5J8FA 2XRCA 2DB6A 3E59A 2V1CA 5E3QA 3UEYA 1Z2IA 1PJUA 3MEKA 3PDNA 1P9GA 3TOBA 2E5RA 3OXGA 4DNCA 1UUCA 5HQ8A 3VDUA 1SGPI 1OMUA 3FC3A 2NU2I 3OXFA 2J87A 2SGFI 2KMQA 2ORVA 3OXLA 1YU6C 1SGYI 2JZMA 1TBNA 1U5KA 2B0UC
chains in the Genus database with same CATH topology
2QQ0A 3SGBI 4UXIA 4GI3C 2LEOA 1TBOA 2B8TA 2LUYA 4E1RA 1IY6A 4JCVE 1OVOA 1BUSA 1SGEI 2QQEA 1PCEA 2GKVA 1CGII 1R79A 1X4SA 2JYYA 1HPTA 3UGDA 1SGRI 1OYVI 2SGEI 1IY5A 2CJSC 2E73A 2KCXA 1BMOA 1KBFA 1XX6A 2GKRI 2QQCA 1TBRR 1TUSA 2DIPA 3OL0A 1DS2I 1N13A 2M5XA 1LR7A 1UVFA 1CT4I 1UVGA 1TIHA 1W4RA 1CT0I 2WCYA 1Z7KB 5EX0A 1PTRA 2YQPA 2F3CI 1KMAA 1XBTA 4HGUA 4L9MA 1PPFI 4UXHA 1PTQA 1SGDI 1Y1BA 2UZ3A 1Y8FA 1R0RI 5CCMA 2ENZA 2NU1I 2BUSA 1M8BA 5DAEA 4UXJA 1CSOI 2ERWA 1VDDA 2A20A 1CGJI 2OD1A 1TBQR 2KMPA 2SGDI 1H0ZA 1CT2I 2VRWB 3HH2C 1FYBA 2V1CC 5CCLA 1NUBA 1TURA 2JA1A 5HI7A 4OVOA 2ORWA 3E2IA 4B6DA 2JW6A 2N17A 2ODDA 5FUXA 5FUVA 3QTLD 1V1IA 2NU4I 2SGPI 3SGQI 1Y1CA 1IW4A 1XA6A 3UEJA 1LR9A 1MT1A 1TOTA 2YUUA 1HDLA 1FARA 1RFHA 2WVJA 3B4VC 3KY9A 2L7XA 1HJAI 3BJIA 3D00A 3TJQA 1M8CA 2ARPF 1AN1I 2V53A 5FUYA 2OVOA 3UGLA 1TGSI 4FKDA 4A24A 3GOXA 1DS3I 2QPOA 1CHOI 4SGBI 2K9HA 3VDPA 2L8EA 3RU0A 2NU0I 3OVOA 2QQDA 1LR8A 1KBEA 2NU3I 2JXDA 2GVIA 2N52A 2N1AB 4E1PA 1YTPA 3CXLA 2W0TA 2ENNA 3SEKC 1SGQI 2ROWA 5JHWC 1OMTA 3UGIA 1CE3A 1V1HA 1X74A 2GKTI 5FUWA 1W3SA 5EX3A 2P6AC 2KMRA 2KMOA 1FAQA 2N71A 3QWPA 3UFFA 2FNFX 2J9RA 1SGNI 2SGQI 2ELIA 3VE5A 2XRCA 2DB6A 3E59A 2V1CA 3UEYA 1PJUA 3MEKA 3PDNA 2E5RA 3OXGA 1UUCA 5HQ8A 3VDUA 1SGPI 1OMUA 3FC3A 2NU2I 3OXFA 2J87A 2SGFI 2KMQA 2ORVA 3OXLA 1YU6C 1SGYI 2JZMA 1TBNA 1U5KA 2B0UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ0 A;  2YUU A;  1PTQ A;  1FAR A;  4UXH A;  3UGI A;  4UXI A;  1RFH A;  2UZ3 A;  1Y8F A;  2WVJ A;  3KY9 A;  1TBO A;  2B8T A;  2ENZ A;  3BJI A;  5FUW A;  4UXJ A;  2QQE A;  1FAQ A;  1R79 A;  5FUY A;  3UGL A;  3UGD A;  3UFF A;  2FNF X;  2J9R A;  4FKD A;  2ELI A;  2VRW B;  2QPO A;  2E73 A;  2DB6 A;  3UEY A;  1KBF A;  2JA1 A;  1XX6 A;  2ORW A;  3E2I A;  4B6D A;  1KBE A;  5FUX A;  5FUV A;  2GVI A;  1W4R A;  2J87 A;  2ORV A;  3CXL A;  1PTR A;  2ENN A;  1XA6 A;  1TBN A;  1XBT A;  3UEJ A;  4L9M A;  2ROW A; 
#chains in the Genus database with same CATH topology
 2QQ0 A;  2RIJ A;  1K7V A;  2X3T A;  3SGB I;  4UXI A;  4GI3 C;  2LEO A;  1TBO A;  2B8T A;  2WGC A;  2LUY A;  4E1R A;  1IY6 A;  4JCV E;  1OVO A;  2GIV A;  1BUS A;  1SGE I;  2QQE A;  1K7U A;  1PCE A;  2GKV A;  2X52 A;  3QAH A;  1CGI I;  1R79 A;  1X4S A;  2JYY A;  1HPT A;  3UGD A;  1SGR I;  1OYV I;  2SGE I;  1IY5 A;  2CJS C;  2E73 A;  2KCX A;  1BMO A;  1KBF A;  1XX6 A;  2GKR I;  2QQC A;  1TBR R;  1TUS A;  2DIP A;  3OL0 A;  5E3R A;  1DS2 I;  1N13 A;  2LB7 A;  1WGT A;  1LR7 A;  1ULK A;  1UVF A;  1CT4 I;  1UVG A;  2DKV A;  3R5D A;  1TIH A;  1W4R A;  2OZU A;  1CT0 I;  1WKX A;  2WCY A;  1Z7K B;  5EX0 A;  1PTR A;  3R5A A;  2YQP A;  2F3C I;  1KMA A;  1XBT A;  4HGU A;  4L9M A;  1PPF I;  9WGA A;  2UVO A;  4UXH A;  1PTQ A;  1SGD I;  1Y1B A;  1ULM A;  2UZ3 A;  1Y8F A;  4MPI A;  1R0R I;  1WGC A;  5CCM A;  1ULN A;  2ENZ A;  2NU1 I;  2BUS A;  1M8B A;  5DAE A;  4UXJ A;  1CSO I;  2ERW A;  1VDD A;  2A20 A;  1CGJ I;  2OD1 A;  1TBQ R;  2KMP A;  2SGD I;  3FSY A;  5E3P A;  1H0Z A;  1CT2 I;  1MJ9 A;  2VRW B;  3HH2 C;  1FYB A;  2V1C C;  5CCL A;  1NUB A;  3TO7 A;  1TUR A;  2JA1 A;  5HI7 A;  4OVO A;  2ORW A;  1K7T A;  3E2I A;  4B6D A;  2JW6 A;  2N17 A;  2ODD A;  3UOE A;  5J8C A;  5FUX A;  4WP4 A;  5FUV A;  3QTL D;  1V1I A;  2NU4 I;  2SGP I;  1FY7 A;  1HEV A;  3SGQ I;  1Y1C A;  2RC4 A;  1IW4 A;  1XA6 A;  3UEJ A;  1LR9 A;  1MT1 A;  3R5C A;  1TOT A;  2YUU A;  1HDL A;  1FAR A;  1RFH A;  2WVJ A;  3B4V C;  3KY9 A;  2L7X A;  1HJA I;  3BJI A;  3D00 A;  3TJQ A;  1M8C A;  1MJB A;  2ARP F;  1AN1 I;  2V53 A;  5FUY A;  2OVO A;  3UGL A;  1TGS I;  4FKD A;  4A24 A;  3GOX A;  1DS3 I;  2QPO A;  1CHO I;  4SGB I;  2K9H A;  2OU2 A;  3VDP A;  2L8E A;  3RU0 A;  2CWH A;  2CWG A;  2NU0 I;  3OVO A;  2QQD A;  3R5B A;  1LR8 A;  1NXU A;  3TOA A;  1KBE A;  2NU3 I;  2JXD A;  2Y0M A;  2GVI A;  2N52 A;  1S20 A;  2N1A B;  3FSX A;  1MJA A;  4E1P A;  1YTP A;  3CXL A;  7WGA A;  4AML A;  2W0T A;  2ENN A;  1WTJ A;  3SEK C;  1SGQ I;  2ROW A;  5JHW C;  1OMT A;  1P9Z A;  1UHA A;  2PQ8 A;  3UGI A;  1CE3 A;  2CWF A;  1V1H A;  1X74 A;  2GKT I;  5FUW A;  1W3S A;  3TO6 A;  5EX3 A;  2P6A C;  2KMR A;  2KMO A;  1FAQ A;  2N71 A;  3QWP A;  2M5X A;  3TO9 A;  3UFF A;  2FNF X;  1Q9B A;  1SGN I;  2J9R A;  2ELI A;  2SGQ I;  3VE5 A;  5J8F A;  2XRC A;  2DB6 A;  3E59 A;  2V1C A;  5E3Q A;  3UEY A;  1Z2I A;  1PJU A;  3MEK A;  3PDN A;  1P9G A;  3TOB A;  2E5R A;  3OXG A;  4DNC A;  1UUC A;  5HQ8 A;  3VDU A;  1SGP I;  1OMU A;  3FC3 A;  2NU2 I;  3OXF A;  2J87 A;  2SGF I;  2KMQ A;  2ORV A;  3OXL A;  1YU6 C;  1SGY I;  2JZM A;  1TBN A;  1U5K A;  2B0U C; 
#chains in the Genus database with same CATH homology
 2QQ0 A;  3SGB I;  4UXI A;  4GI3 C;  2LEO A;  1TBO A;  2B8T A;  2LUY A;  4E1R A;  1IY6 A;  4JCV E;  1OVO A;  1BUS A;  1SGE I;  2QQE A;  1PCE A;  2GKV A;  1CGI I;  1R79 A;  1X4S A;  2JYY A;  1HPT A;  3UGD A;  1SGR I;  1OYV I;  2SGE I;  1IY5 A;  2CJS C;  2E73 A;  2KCX A;  1BMO A;  1KBF A;  1XX6 A;  2GKR I;  2QQC A;  1TBR R;  1TUS A;  2DIP A;  3OL0 A;  1DS2 I;  1N13 A;  2M5X A;  1LR7 A;  1UVF A;  1CT4 I;  1UVG A;  1TIH A;  1W4R A;  1CT0 I;  2WCY A;  1Z7K B;  5EX0 A;  1PTR A;  2YQP A;  2F3C I;  1KMA A;  1XBT A;  4HGU A;  4L9M A;  1PPF I;  4UXH A;  1PTQ A;  1SGD I;  1Y1B A;  2UZ3 A;  1Y8F A;  1R0R I;  5CCM A;  2ENZ A;  2NU1 I;  2BUS A;  1M8B A;  5DAE A;  4UXJ A;  1CSO I;  2ERW A;  1VDD A;  2A20 A;  1CGJ I;  2OD1 A;  1TBQ R;  2KMP A;  2SGD I;  1H0Z A;  1CT2 I;  2VRW B;  3HH2 C;  1FYB A;  2V1C C;  5CCL A;  1NUB A;  1TUR A;  2JA1 A;  5HI7 A;  4OVO A;  2ORW A;  3E2I A;  4B6D A;  2JW6 A;  2N17 A;  2ODD A;  5FUX A;  5FUV A;  3QTL D;  1V1I A;  2NU4 I;  2SGP I;  3SGQ I;  1Y1C A;  1IW4 A;  1XA6 A;  3UEJ A;  1LR9 A;  1MT1 A;  1TOT A;  2YUU A;  1HDL A;  1FAR A;  1RFH A;  2WVJ A;  3B4V C;  3KY9 A;  2L7X A;  1HJA I;  3BJI A;  3D00 A;  3TJQ A;  1M8C A;  2ARP F;  1AN1 I;  2V53 A;  5FUY A;  2OVO A;  3UGL A;  1TGS I;  4FKD A;  4A24 A;  3GOX A;  1DS3 I;  2QPO A;  1CHO I;  4SGB I;  2K9H A;  3VDP A;  2L8E A;  3RU0 A;  2NU0 I;  3OVO A;  2QQD A;  1LR8 A;  1KBE A;  2NU3 I;  2JXD A;  2GVI A;  2N52 A;  2N1A B;  4E1P A;  1YTP A;  3CXL A;  2W0T A;  2ENN A;  3SEK C;  1SGQ I;  2ROW A;  5JHW C;  1OMT A;  3UGI A;  1CE3 A;  1V1H A;  1X74 A;  2GKT I;  5FUW A;  1W3S A;  5EX3 A;  2P6A C;  2KMR A;  2KMO A;  1FAQ A;  2N71 A;  3QWP A;  3UFF A;  2FNF X;  2J9R A;  1SGN I;  2SGQ I;  2ELI A;  3VE5 A;  2XRC A;  2DB6 A;  3E59 A;  2V1C A;  3UEY A;  1PJU A;  3MEK A;  3PDN A;  2E5R A;  3OXG A;  1UUC A;  5HQ8 A;  3VDU A;  1SGP I;  1OMU A;  3FC3 A;  2NU2 I;  3OXF A;  2J87 A;  2SGF I;  2KMQ A;  2ORV A;  3OXL A;  1YU6 C;  1SGY I;  2JZM A;  1TBN A;  1U5K A;  2B0U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...