3UGDA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugdA01
2ENNA 2ROWA 1FAQA 2ORVA 2J87A 2VRWB 3E2IA 3UFFA 2E73A 1KBEA 3KY9A 2ORWA 1XX6A 1R79A 3CXLA 4UXJA 3BJIA 2UZ3A 2ELIA 5FUVA 4B6DA 1TBOA 1RFHA 2ENZA 2QPOA 1FARA 3UGLA 2WVJA 1W4RA 4UXHA 1TBNA 4FKDA 4UXIA 3UGDA 3UEJA 2FNFX 2DB6A 2J9RA 3UGIA 1XBTA 2JA1A 2GVIA 1XA6A 2YUUA 1KBFA 4L9MA 5FUXA 2B8TA 1PTRA 5FUWA 5FUYA 3UEYA 2QQEA 2QQ0A 1Y8FA 1PTQA
chains in the Genus database with same CATH superfamily
1PPFI 3QTLD 2NU0I 2ROWA 3R5DA 1HEVA 1TURA 1SGYI 1OYVI 2NU2I 1SGDI 3E2IA 5CCLA 5HQ8A 1TIHA 1M8BA 2ORWA 1TOTA 3E59A 1Z2IA 3BJIA 1ULKA 5FUVA 1CT4I 2GKTI 2ENZA 1MJ9A 2DIPA 2GKRI 2OZUA 3B4VC 1LR9A 7WGAA 4A24A 3OXLA 4UXHA 1UHAA 1N13A 1TBNA 3UGDA 1LR7A 4E1RA 4E1PA 2W0TA 4OVOA 3VE5A 2RC4A 3VDUA 2KCXA 1ULMA 3UGIA 1NUBA 3QWPA 1DS3I 5HI7A 4HGUA 2NU1I 2CWFA 1MJAA 2ARPF 2OD1A 3FSYA 2ERWA 3HH2C 3TO6A 1P9ZA 1TBQR 2OU2A 3UEYA 2QQEA 1Y1BA 1FY7A 2B0UC 1W3SA 1SGEI 2WCYA 3MEKA 1HDLA 2J87A 2KMOA 2LUYA 1M8CA 3UFFA 5E3RA 1YTPA 1KBEA 3KY9A 4GI3C 1IW4A 3SGBI 2X3TA 1H0ZA 1Q9BA 2E5RA 2QQDA 1TGSI 5E3PA 2NU3I 2GIVA 1WGTA 2QQCA 3TOAA 1BUSA 3R5BA 1FYBA 2X52A 3R5CA 1TBRR 1DS2I 1HJAI 3PDNA 1X74A 3UEJA 1CT2I 9WGAA 2J9RA 3TO9A 1XBTA 2CWHA 2GVIA 2JA1A 2K9HA 2WGCA 3R5AA 5J8CA 1KBFA 4SGBI 1WTJA 1R0RI 2CWGA 1PTRA 5FUYA 3RU0A 2N1AB 1BMOA 1HPTA 2N17A 1FAQA 2VRWB 1VDDA 3OXFA 3TO7A 1SGNI 2E73A 3TJQA 5EX0A 2LB7A 2RIJA 2NU4I 2OVOA 3CXLA 3OXGA 4UXJA 2UZ3A 1S20A 4AMLA 2V53A 1MT1A 1LR8A 1U5KA 2QPOA 4B6DA 3UGLA 5CCMA 1SGPI 2KMPA 2SGFI 1CGJI 2WVJA 1AN1I 1W4RA 1K7VA 2YQPA 4WP4A 1V1IA 4FKDA 3FSXA 1SGQI 4UXIA 3TOBA 1KMAA 3FC3A 3VDPA 5JHWC 2DKVA 2M5XA 1OMUA 3OL0A 2KMRA 5FUXA 3D00A 1WGCA 1YU6C 2JZMA 1IY5A 2ENNA 1MJBA 2ORVA 1K7TA 2KMQA 2SGDI 1X4SA 4MPIA 1P9GA 2UVOA 2LEOA 2L8EA 3GOXA 1CHOI 2ODDA 2L7XA 2V1CC 1XX6A 1R79A 4JCVE 1WKXA 3UOEA 2ELIA 2Y0MA 1CT0I 1TBOA 1RFHA 1UUCA 1PJUA 2F3CI 1FARA 2GKVA 3QAHA 1SGRI 2JYYA 5EX3A 3SGQI 1OMTA 2XRCA 1PCEA 4DNCA 2BUSA 2JXDA 1K7UA 2N52A 1CE3A 2SGQI 5J8FA 1Z7KB 2PQ8A 1V1HA 2FNFX 2JW6A 1CGII 1UVGA 1UVFA 2DB6A 1CSOI 2CJSC 2P6AC 1ULNA 2SGEI 2V1CA 1XA6A 2YUUA 5DAEA 2A20A 1Y1CA 1IY6A 4L9MA 1OVOA 2B8TA 1TUSA 3SEKC 1NXUA 5E3QA 2N71A 2SGPI 3OVOA 5FUWA 2QQ0A 1Y8FA 1PTQA
chains in the Genus database with same CATH topology
1PPFI 3QTLD 2NU0I 2ROWA 1TURA 1SGYI 1OYVI 2NU2I 1SGDI 3E2IA 5CCLA 5HQ8A 1TIHA 1M8BA 2ORWA 1TOTA 3E59A 3BJIA 5FUVA 1CT4I 2GKTI 2ENZA 2DIPA 2GKRI 3B4VC 1LR9A 4A24A 3OXLA 4UXHA 1N13A 1TBNA 3UGDA 1LR7A 4E1RA 4E1PA 2W0TA 4OVOA 3VE5A 3VDUA 2KCXA 3UGIA 1NUBA 3QWPA 1DS3I 5HI7A 4HGUA 2NU1I 2ARPF 2OD1A 3HH2C 2ERWA 1TBQR 3UEYA 2QQEA 1Y1BA 2B0UC 1W3SA 1SGEI 2WCYA 3MEKA 1HDLA 2J87A 2KMOA 2LUYA 1M8CA 3UFFA 1YTPA 1KBEA 3KY9A 4GI3C 1IW4A 3SGBI 1H0ZA 2E5RA 2QQDA 1TGSI 1FYBA 2NU3I 2QQCA 1BUSA 1TBRR 1DS2I 1HJAI 3PDNA 1X74A 3UEJA 1CT2I 2J9RA 1XBTA 2JA1A 2GVIA 2K9HA 1KBFA 4SGBI 1R0RI 1PTRA 5FUYA 3RU0A 2N1AB 1BMOA 1HPTA 2N17A 1FAQA 2VRWB 1VDDA 3OXFA 1SGNI 2E73A 3TJQA 5EX0A 3OXGA 2NU4I 2OVOA 3CXLA 4UXJA 2UZ3A 2V53A 1MT1A 1LR8A 1U5KA 2QPOA 4B6DA 3UGLA 5CCMA 1SGPI 2KMPA 2SGFI 1CGJI 2WVJA 1AN1I 1W4RA 2YQPA 1V1IA 4FKDA 1SGQI 4UXIA 1KMAA 3FC3A 3VDPA 5JHWC 2M5XA 1OMUA 3OL0A 2KMRA 5FUXA 3D00A 1YU6C 2JZMA 1IY5A 2ENNA 2ORVA 2KMQA 2SGDI 1X4SA 2LEOA 2L8EA 3GOXA 1CHOI 2ODDA 2L7XA 2V1CC 1XX6A 1R79A 4JCVE 2ELIA 1CT0I 1TBOA 1RFHA 1UUCA 1PJUA 2F3CI 1FARA 2GKVA 1SGRI 2JYYA 5EX3A 3SGQI 1OMTA 2XRCA 1PCEA 2BUSA 2JXDA 1CE3A 2N52A 2SGQI 1Z7KB 1V1HA 2FNFX 2JW6A 1CGII 1UVGA 1UVFA 2DB6A 1CSOI 2CJSC 2P6AC 2SGEI 2V1CA 2YUUA 1XA6A 5DAEA 2A20A 1Y1CA 1IY6A 4L9MA 1OVOA 2B8TA 1TUSA 3SEKC 5FUWA 2N71A 2SGPI 3OVOA 2QQ0A 1Y8FA 1PTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENN A;  2ROW A;  1FAQ A;  2ORV A;  2J87 A;  2VRW B;  3E2I A;  3UFF A;  2E73 A;  1KBE A;  3KY9 A;  2ORW A;  1XX6 A;  1R79 A;  3CXL A;  4UXJ A;  3BJI A;  2UZ3 A;  2ELI A;  5FUV A;  4B6D A;  1TBO A;  1RFH A;  2ENZ A;  2QPO A;  1FAR A;  3UGL A;  2WVJ A;  1W4R A;  4UXH A;  1TBN A;  4FKD A;  4UXI A;  3UGD A;  3UEJ A;  2FNF X;  2DB6 A;  2J9R A;  3UGI A;  1XBT A;  2JA1 A;  2GVI A;  1XA6 A;  2YUU A;  1KBF A;  4L9M A;  5FUX A;  2B8T A;  1PTR A;  5FUW A;  5FUY A;  3UEY A;  2QQE A;  2QQ0 A;  1Y8F A;  1PTQ A; 
#chains in the Genus database with same CATH topology
 1PPF I;  3QTL D;  2NU0 I;  2ROW A;  3R5D A;  1HEV A;  1TUR A;  1SGY I;  1OYV I;  2NU2 I;  1SGD I;  3E2I A;  5CCL A;  5HQ8 A;  1TIH A;  1M8B A;  2ORW A;  1TOT A;  3E59 A;  1Z2I A;  3BJI A;  1ULK A;  5FUV A;  1CT4 I;  2GKT I;  2ENZ A;  1MJ9 A;  2DIP A;  2GKR I;  2OZU A;  3B4V C;  1LR9 A;  7WGA A;  4A24 A;  3OXL A;  4UXH A;  1UHA A;  1N13 A;  1TBN A;  3UGD A;  1LR7 A;  4E1R A;  4E1P A;  2W0T A;  4OVO A;  3VE5 A;  2RC4 A;  3VDU A;  2KCX A;  1ULM A;  3UGI A;  1NUB A;  3QWP A;  1DS3 I;  5HI7 A;  4HGU A;  2NU1 I;  2CWF A;  1MJA A;  2ARP F;  2OD1 A;  3FSY A;  2ERW A;  3HH2 C;  3TO6 A;  1P9Z A;  1TBQ R;  2OU2 A;  3UEY A;  2QQE A;  1Y1B A;  1FY7 A;  2B0U C;  1W3S A;  1SGE I;  2WCY A;  3MEK A;  1HDL A;  2J87 A;  2KMO A;  2LUY A;  1M8C A;  3UFF A;  5E3R A;  1YTP A;  1KBE A;  3KY9 A;  4GI3 C;  1IW4 A;  3SGB I;  2X3T A;  1H0Z A;  1Q9B A;  2E5R A;  2QQD A;  1TGS I;  5E3P A;  2NU3 I;  2GIV A;  1WGT A;  2QQC A;  3TOA A;  1BUS A;  3R5B A;  1FYB A;  2X52 A;  3R5C A;  1TBR R;  1DS2 I;  1HJA I;  3PDN A;  1X74 A;  3UEJ A;  1CT2 I;  9WGA A;  2J9R A;  3TO9 A;  1XBT A;  2CWH A;  2GVI A;  2JA1 A;  2K9H A;  2WGC A;  3R5A A;  5J8C A;  1KBF A;  4SGB I;  1WTJ A;  1R0R I;  2CWG A;  1PTR A;  5FUY A;  3RU0 A;  2N1A B;  1BMO A;  1HPT A;  2N17 A;  1FAQ A;  2VRW B;  1VDD A;  3OXF A;  3TO7 A;  1SGN I;  2E73 A;  3TJQ A;  5EX0 A;  2LB7 A;  2RIJ A;  2NU4 I;  2OVO A;  3CXL A;  3OXG A;  4UXJ A;  2UZ3 A;  1S20 A;  4AML A;  2V53 A;  1MT1 A;  1LR8 A;  1U5K A;  2QPO A;  4B6D A;  3UGL A;  5CCM A;  1SGP I;  2KMP A;  2SGF I;  1CGJ I;  2WVJ A;  1AN1 I;  1W4R A;  1K7V A;  2YQP A;  4WP4 A;  1V1I A;  4FKD A;  3FSX A;  1SGQ I;  4UXI A;  3TOB A;  1KMA A;  3FC3 A;  3VDP A;  5JHW C;  2DKV A;  2M5X A;  1OMU A;  3OL0 A;  2KMR A;  5FUX A;  3D00 A;  1WGC A;  1YU6 C;  2JZM A;  1IY5 A;  2ENN A;  1MJB A;  2ORV A;  1K7T A;  2KMQ A;  2SGD I;  1X4S A;  4MPI A;  1P9G A;  2UVO A;  2LEO A;  2L8E A;  3GOX A;  1CHO I;  2ODD A;  2L7X A;  2V1C C;  1XX6 A;  1R79 A;  4JCV E;  1WKX A;  3UOE A;  2ELI A;  2Y0M A;  1CT0 I;  1TBO A;  1RFH A;  1UUC A;  1PJU A;  2F3C I;  1FAR A;  2GKV A;  3QAH A;  1SGR I;  2JYY A;  5EX3 A;  3SGQ I;  1OMT A;  2XRC A;  1PCE A;  4DNC A;  2BUS A;  2JXD A;  1K7U A;  2N52 A;  1CE3 A;  2SGQ I;  5J8F A;  1Z7K B;  2PQ8 A;  1V1H A;  2FNF X;  2JW6 A;  1CGI I;  1UVG A;  1UVF A;  2DB6 A;  1CSO I;  2CJS C;  2P6A C;  1ULN A;  2SGE I;  2V1C A;  1XA6 A;  2YUU A;  5DAE A;  2A20 A;  1Y1C A;  1IY6 A;  4L9M A;  1OVO A;  2B8T A;  1TUS A;  3SEK C;  1NXU A;  5E3Q A;  2N71 A;  2SGP I;  3OVO A;  5FUW A;  2QQ0 A;  1Y8F A;  1PTQ A; 
#chains in the Genus database with same CATH homology
 1PPF I;  3QTL D;  2NU0 I;  2ROW A;  1TUR A;  1SGY I;  1OYV I;  2NU2 I;  1SGD I;  3E2I A;  5CCL A;  5HQ8 A;  1TIH A;  1M8B A;  2ORW A;  1TOT A;  3E59 A;  3BJI A;  5FUV A;  1CT4 I;  2GKT I;  2ENZ A;  2DIP A;  2GKR I;  3B4V C;  1LR9 A;  4A24 A;  3OXL A;  4UXH A;  1N13 A;  1TBN A;  3UGD A;  1LR7 A;  4E1R A;  4E1P A;  2W0T A;  4OVO A;  3VE5 A;  3VDU A;  2KCX A;  3UGI A;  1NUB A;  3QWP A;  1DS3 I;  5HI7 A;  4HGU A;  2NU1 I;  2ARP F;  2OD1 A;  3HH2 C;  2ERW A;  1TBQ R;  3UEY A;  2QQE A;  1Y1B A;  2B0U C;  1W3S A;  1SGE I;  2WCY A;  3MEK A;  1HDL A;  2J87 A;  2KMO A;  2LUY A;  1M8C A;  3UFF A;  1YTP A;  1KBE A;  3KY9 A;  4GI3 C;  1IW4 A;  3SGB I;  1H0Z A;  2E5R A;  2QQD A;  1TGS I;  1FYB A;  2NU3 I;  2QQC A;  1BUS A;  1TBR R;  1DS2 I;  1HJA I;  3PDN A;  1X74 A;  3UEJ A;  1CT2 I;  2J9R A;  1XBT A;  2JA1 A;  2GVI A;  2K9H A;  1KBF A;  4SGB I;  1R0R I;  1PTR A;  5FUY A;  3RU0 A;  2N1A B;  1BMO A;  1HPT A;  2N17 A;  1FAQ A;  2VRW B;  1VDD A;  3OXF A;  1SGN I;  2E73 A;  3TJQ A;  5EX0 A;  3OXG A;  2NU4 I;  2OVO A;  3CXL A;  4UXJ A;  2UZ3 A;  2V53 A;  1MT1 A;  1LR8 A;  1U5K A;  2QPO A;  4B6D A;  3UGL A;  5CCM A;  1SGP I;  2KMP A;  2SGF I;  1CGJ I;  2WVJ A;  1AN1 I;  1W4R A;  2YQP A;  1V1I A;  4FKD A;  1SGQ I;  4UXI A;  1KMA A;  3FC3 A;  3VDP A;  5JHW C;  2M5X A;  1OMU A;  3OL0 A;  2KMR A;  5FUX A;  3D00 A;  1YU6 C;  2JZM A;  1IY5 A;  2ENN A;  2ORV A;  2KMQ A;  2SGD I;  1X4S A;  2LEO A;  2L8E A;  3GOX A;  1CHO I;  2ODD A;  2L7X A;  2V1C C;  1XX6 A;  1R79 A;  4JCV E;  2ELI A;  1CT0 I;  1TBO A;  1RFH A;  1UUC A;  1PJU A;  2F3C I;  1FAR A;  2GKV A;  1SGR I;  2JYY A;  5EX3 A;  3SGQ I;  1OMT A;  2XRC A;  1PCE A;  2BUS A;  2JXD A;  1CE3 A;  2N52 A;  2SGQ I;  1Z7K B;  1V1H A;  2FNF X;  2JW6 A;  1CGI I;  1UVG A;  1UVF A;  2DB6 A;  1CSO I;  2CJS C;  2P6A C;  2SGE I;  2V1C A;  2YUU A;  1XA6 A;  5DAE A;  2A20 A;  1Y1C A;  1IY6 A;  4L9M A;  1OVO A;  2B8T A;  1TUS A;  3SEK C;  5FUW A;  2N71 A;  2SGP I;  3OVO A;  2QQ0 A;  1Y8F A;  1PTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...