4MPIA

Crystal structure of the chitin-binding module (cbm18) of a chitinase-like protein from hevea brasiliensis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
MEQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Class I chitinase
publication title Comparative study of two GH19 chitinase-like proteins from Hevea brasiliensis, one exhibiting a novel carbohydrate-binding domain.
pubmed doi rcsb
source organism Hevea brasiliensis subsp. brasiliensis
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 4mpiA00
1ULMA 4AMLA 1WGCA 2X3TA 1P9ZA 2CWGA 1ULKA 2LB7A 1WKXA 2X52A 1K7TA 4WP4A 1ULNA 9WGAA 2UVOA 7WGAA 1Q9BA 1WGTA 1UHAA 1HEVA 1K7UA 1P9GA 1K7VA 4MPIA 2WGCA 2DKVA
chains in the Genus database with same CATH superfamily
2Y0MA 3SGQI 2JZMA 2SGEI 1AN1I 1PTRA 3B4VC 3OVOA 3SEKC 1PCEA 1WTJA 2X3TA 2CWGA 5EX3A 2WVJA 3UGDA 1FAQA 3R5AA 2N52A 2X52A 1Y1CA 4WP4A 5FUYA 1SGRI 1Z7KB 3QAHA 2QQCA 1UHAA 1X4SA 1LR9A 3BJIA 2LEOA 2SGPI 4UXJA 1H0ZA 1HEVA 2CWFA 1MJBA 3KY9A 4A24A 1U5KA 1CSOI 2SGQI 1IY6A 2V53A 1HPTA 2OZUA 3FSYA 1BUSA 2OD1A 4JCVE 2B0UC 2ERWA 1KBEA 2V1CA 5E3RA 5FUWA 2DKVA 3RU0A 3VDUA 3TOBA 3GOXA 2L7XA 3OXLA 2QQ0A 3QTLD 1V1IA 1HJAI 1OMUA 2QPOA 3TO9A 2A20A 3OXFA 1ULKA 5FUVA 1NXUA 1UVGA 2XRCA 5CCLA 2LB7A 1FYBA 1TURA 1WKXA 3HH2C 1CT0I 3OXGA 1ULNA 5J8CA 2ENNA 1TOTA 4E1RA 2UVOA 1CHOI 2NU2I 2ROWA 2K9HA 1YU6C 1OMTA 2GKTI 3R5BA 3TJQA 2ENZA 5EX0A 2OU2A 1BMOA 1TUSA 3R5DA 1W3SA 3TO6A 3UOEA 1MJAA 2KMPA 1OYVI 1SGYI 2WGCA 4E1PA 2KMRA 1S20A 1PPFI 2F3CI 2JA1A 1R79A 2ODDA 1CE3A 1CT2I 1UUCA 1YTPA 2PQ8A 4AMLA 5CCMA 1TIHA 1MJ9A 3SGBI 1WGCA 1XX6A 5HI7A 1KBFA 1LR8A 5DAEA 5E3PA 2KMOA 1P9ZA 1OVOA 3UFFA 2JXDA 4GI3C 2QQDA 2ORWA 1CT4I 2DIPA 4B6DA 1UVFA 4FKDA 1TGSI 2OVOA 5HQ8A 2JYYA 1K7TA 2B8TA 2L8EA 3MEKA 2KCXA 1M8CA 2V1CC 9WGAA 3VDPA 7WGAA 2ELIA 3E2IA 1N13A 1WGTA 4L9MA 2NU3I 1TBNA 1RFHA 1DS3I 2CJSC 1PTQA 4SGBI 2GIVA 4DNCA 2RC4A 2P6AC 1P9GA 2W0TA 1SGEI 2GVIA 2YUUA 3FSXA 4HGUA 2WCYA 1SGDI 2KMQA 5JHWC 2SGDI 2SGFI 1W4RA 4UXIA 1R0RI 1X74A 1XBTA 1V1HA 2GKRI 2GKVA 1PJUA 1XA6A 2BUSA 2JW6A 2LUYA 2QQEA 3QWPA 3UEYA 2CWHA 1ULMA 3OL0A 1TBQR 2N1AB 1VDDA 5J8FA 1FY7A 1LR7A 3TO7A 5FUXA 1Y1BA 3R5CA 2J87A 1M8BA 1SGQI 2N71A 2N17A 3TOAA 1TBOA 2ORVA 3VE5A 3FC3A 1CGII 3CXLA 1SGNI 1TBRR 2DB6A 2YQPA 3UGIA 1SGPI 1IY5A 1MT1A 3D00A 2M5XA 4UXHA 2ARPF 1Q9BA 1HDLA 1NUBA 2NU4I 3PDNA 5E3QA 3UEJA 1CGJI 1FARA 1Y8FA 3E59A 1Z2IA 1K7UA 2NU1I 2UZ3A 1IW4A 2J9RA 2E73A 2E5RA 1K7VA 2RIJA 4OVOA 4MPIA 2VRWB 3UGLA 1KMAA 2FNFX 2NU0I 1DS2I
chains in the Genus database with same CATH topology
1ULMA 4AMLA 1WGCA 2X3TA 1P9ZA 2CWGA 1ULKA 2LB7A 1WKXA 2X52A 1K7TA 4WP4A 1ULNA 9WGAA 2UVOA 7WGAA 1Q9BA 1WGTA 1UHAA 1HEVA 1K7UA 1P9GA 1K7VA 4MPIA 2WGCA 2DKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULM A;  4AML A;  1WGC A;  2X3T A;  1P9Z A;  2CWG A;  1ULK A;  2LB7 A;  1WKX A;  2X52 A;  1K7T A;  4WP4 A;  1ULN A;  9WGA A;  2UVO A;  7WGA A;  1Q9B A;  1WGT A;  1UHA A;  1HEV A;  1K7U A;  1P9G A;  1K7V A;  4MPI A;  2WGC A;  2DKV A; 
#chains in the Genus database with same CATH topology
 2Y0M A;  3SGQ I;  2JZM A;  2SGE I;  1AN1 I;  1PTR A;  3B4V C;  3OVO A;  3SEK C;  1PCE A;  1WTJ A;  2X3T A;  2CWG A;  5EX3 A;  2WVJ A;  3UGD A;  1FAQ A;  3R5A A;  2N52 A;  2X52 A;  1Y1C A;  4WP4 A;  5FUY A;  1SGR I;  1Z7K B;  3QAH A;  2QQC A;  1UHA A;  1X4S A;  1LR9 A;  3BJI A;  2LEO A;  2SGP I;  4UXJ A;  1H0Z A;  1HEV A;  2CWF A;  1MJB A;  3KY9 A;  4A24 A;  1U5K A;  1CSO I;  2SGQ I;  1IY6 A;  2V53 A;  1HPT A;  2OZU A;  3FSY A;  1BUS A;  2OD1 A;  4JCV E;  2B0U C;  2ERW A;  1KBE A;  2V1C A;  5E3R A;  5FUW A;  2DKV A;  3RU0 A;  3VDU A;  3TOB A;  3GOX A;  2L7X A;  3OXL A;  2QQ0 A;  3QTL D;  1V1I A;  1HJA I;  1OMU A;  2QPO A;  3TO9 A;  2A20 A;  3OXF A;  1ULK A;  5FUV A;  1NXU A;  1UVG A;  2XRC A;  5CCL A;  2LB7 A;  1FYB A;  1TUR A;  1WKX A;  3HH2 C;  1CT0 I;  3OXG A;  1ULN A;  5J8C A;  2ENN A;  1TOT A;  4E1R A;  2UVO A;  1CHO I;  2NU2 I;  2ROW A;  2K9H A;  1YU6 C;  1OMT A;  2GKT I;  3R5B A;  3TJQ A;  2ENZ A;  5EX0 A;  2OU2 A;  1BMO A;  1TUS A;  3R5D A;  1W3S A;  3TO6 A;  3UOE A;  1MJA A;  2KMP A;  1OYV I;  1SGY I;  2WGC A;  4E1P A;  2KMR A;  1S20 A;  1PPF I;  2F3C I;  2JA1 A;  1R79 A;  2ODD A;  1CE3 A;  1CT2 I;  1UUC A;  1YTP A;  2PQ8 A;  4AML A;  5CCM A;  1TIH A;  1MJ9 A;  3SGB I;  1WGC A;  1XX6 A;  5HI7 A;  1KBF A;  1LR8 A;  5DAE A;  5E3P A;  2KMO A;  1P9Z A;  1OVO A;  3UFF A;  2JXD A;  4GI3 C;  2QQD A;  2ORW A;  1CT4 I;  2DIP A;  4B6D A;  1UVF A;  4FKD A;  1TGS I;  2OVO A;  5HQ8 A;  2JYY A;  1K7T A;  2B8T A;  2L8E A;  3MEK A;  2KCX A;  1M8C A;  2V1C C;  9WGA A;  3VDP A;  7WGA A;  2ELI A;  3E2I A;  1N13 A;  1WGT A;  4L9M A;  2NU3 I;  1TBN A;  1RFH A;  1DS3 I;  2CJS C;  1PTQ A;  4SGB I;  2GIV A;  4DNC A;  2RC4 A;  2P6A C;  1P9G A;  2W0T A;  1SGE I;  2GVI A;  2YUU A;  3FSX A;  4HGU A;  2WCY A;  1SGD I;  2KMQ A;  5JHW C;  2SGD I;  2SGF I;  1W4R A;  4UXI A;  1R0R I;  1X74 A;  1XBT A;  1V1H A;  2GKR I;  2GKV A;  1PJU A;  1XA6 A;  2BUS A;  2JW6 A;  2LUY A;  2QQE A;  3QWP A;  3UEY A;  2CWH A;  1ULM A;  3OL0 A;  1TBQ R;  2N1A B;  1VDD A;  5J8F A;  1FY7 A;  1LR7 A;  3TO7 A;  5FUX A;  1Y1B A;  3R5C A;  2J87 A;  1M8B A;  1SGQ I;  2N71 A;  2N17 A;  3TOA A;  1TBO A;  2ORV A;  3VE5 A;  3FC3 A;  1CGI I;  3CXL A;  1SGN I;  1TBR R;  2DB6 A;  2YQP A;  3UGI A;  1SGP I;  1IY5 A;  1MT1 A;  3D00 A;  2M5X A;  4UXH A;  2ARP F;  1Q9B A;  1HDL A;  1NUB A;  2NU4 I;  3PDN A;  5E3Q A;  3UEJ A;  1CGJ I;  1FAR A;  1Y8F A;  3E59 A;  1Z2I A;  1K7U A;  2NU1 I;  2UZ3 A;  1IW4 A;  2J9R A;  2E73 A;  2E5R A;  1K7V A;  2RIJ A;  4OVO A;  4MPI A;  2VRW B;  3UGL A;  1KMA A;  2FNF X;  2NU0 I;  1DS2 I; 
#chains in the Genus database with same CATH homology
 1ULM A;  4AML A;  1WGC A;  2X3T A;  1P9Z A;  2CWG A;  1ULK A;  2LB7 A;  1WKX A;  2X52 A;  1K7T A;  4WP4 A;  1ULN A;  9WGA A;  2UVO A;  7WGA A;  1Q9B A;  1WGT A;  1UHA A;  1HEV A;  1K7U A;  1P9G A;  1K7V A;  4MPI A;  2WGC A;  2DKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...