4MPIA

Crystal structure of the chitin-binding module (cbm18) of a chitinase-like protein from hevea brasiliensis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
MEQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class I chitinase
publication title Comparative study of two GH19 chitinase-like proteins from Hevea brasiliensis, one exhibiting a novel carbohydrate-binding domain.
pubmed doi rcsb
source organism Hevea brasiliensis subsp. brasiliensis
molecule tags Sugar binding protein
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 4mpiA00
1K7UA 4MPIA 7WGAA 1ULNA 1UHAA 2WGCA 1Q9BA 1P9ZA 2LB7A 1WGCA 2UVOA 2X3TA 2X52A 9WGAA 1P9GA 4AMLA 2CWGA 1WKXA 1HEVA 1WGTA 1K7VA 1K7TA 2DKVA 1ULMA 1ULKA 4WP4A
chains in the Genus database with same CATH superfamily
4MPIA 3VE5A 1MJBA 1TBNA 1CGII 3OVOA 1WTJA 1LR7A 2GKTI 2SGQI 2ROWA 4A24A 3GOXA 2B8TA 1TGSI 1P9ZA 2QQ0A 2GIVA 3KY9A 2QQEA 2OD1A 2F3CI 1Y8FA 2ENZA 1HJAI 1V1IA 1PJUA 1V1HA 1MJAA 2DIPA 5FUXA 3UEYA 2A20A 2JYYA 2CWGA 2SGEI 2N52A 2ODDA 3BJIA 1X4SA 2K9HA 3R5BA 1SGYI 1PTRA 3MEKA 5FUVA 3CXLA 2RC4A 2DKVA 1Y1BA 1ULMA 3UEJA 1RFHA 1KMAA 4HGUA 2SGFI 2KMRA 4SGBI 4WP4A 3TJQA 2CWFA 1TUSA 3TO9A 2V1CA 3TOBA 5HQ8A 2CJSC 2OVOA 1Z2IA 2KMQA 2OU2A 2JA1A 7WGAA 1N13A 3OL0A 1BUSA 1UHAA 3OXFA 3QWPA 2WGCA 1IY5A 1DS3I 1Z7KB 1PPFI 2ERWA 2XRCA 3TO7A 1CE3A 1LR8A 1CT4I 1KBFA 1TIHA 2L8EA 2N71A 2UVOA 1SGEI 2X3TA 3UGLA 2CWHA 4E1PA 2Y0MA 1XX6A 1TBRR 3UOEA 3VDPA 3VDUA 1P9GA 2ARPF 3UGDA 4AMLA 4E1RA 5J8FA 2DB6A 5JHWC 1WKXA 1PTQA 2RIJA 4GI3C 1HEVA 1UUCA 2JZMA 4UXIA 1K7TA 1CSOI 1CHOI 4UXJA 2VRWB 1FAQA 2GKVA 1HPTA 3TOAA 2BUSA 1CT0I 1NUBA 2V1CC 3TO6A 3RU0A 1U5KA 4OVOA 1DS2I 1TURA 2W0TA 3OXGA 3SEKC 2L7XA 1LR9A 3UFFA 3PDNA 5HI7A 3FC3A 1M8CA 3QTLD 2NU1I 4JCVE 2ENNA 2GVIA 2P6AC 4L9MA 5CCMA 2QQCA 1AN1I 1SGNI 1YU6C 1WGCA 2LB7A 2LUYA 5FUWA 1TBOA 4DNCA 5E3PA 1FARA 1XBTA 1OMTA 2QQDA 2YUUA 1R0RI 1FYBA 4B6DA 3R5CA 1OMUA 1VDDA 5DAEA 1W4RA 1SGRI 2N1AB 2NU2I 1WGTA 1HDLA 1X74A 2KCXA 1XA6A 2ORVA 3UGIA 5E3QA 1BMOA 1KBEA 1R79A 2WVJA 3FSYA 2SGPI 5E3RA 2ELIA 1MT1A 1IW4A 1W3SA 2M5XA 1UVGA 2E73A 2KMPA 1K7UA 2OZUA 2B0UC 5J8CA 2JW6A 3E59A 2SGDI 3QAHA 1ULNA 2NU4I 1IY6A 5EX0A 2NU3I 1Y1CA 2N17A 1CT2I 3B4VC 2YQPA 1SGDI 1Q9BA 1OVOA 2GKRI 1H0ZA 1TBQR 1FY7A 3SGBI 9WGAA 2X52A 3OXLA 3R5AA 1SGPI 2E5RA 2UZ3A 4UXHA 3SGQI 1UVFA 1YTPA 2KMOA 2QPOA 3D00A 1CGJI 3FSXA 3R5DA 5EX3A 1OYVI 2J9RA 2NU0I 2FNFX 1M8BA 2JXDA 2ORWA 3HH2C 5FUYA 2LEOA 2J87A 1MJ9A 4FKDA 1K7VA 1NXUA 2WCYA 1TOTA 5CCLA 2V53A 1ULKA 1PCEA 3E2IA 1S20A 1SGQI 2PQ8A
chains in the Genus database with same CATH topology
1K7UA 4MPIA 7WGAA 1ULNA 1UHAA 2WGCA 1Q9BA 1P9ZA 2LB7A 1WGCA 2UVOA 2X3TA 2X52A 9WGAA 1P9GA 4AMLA 2CWGA 1WKXA 1HEVA 1WGTA 1K7VA 1K7TA 2DKVA 1ULMA 1ULKA 4WP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7U A;  4MPI A;  7WGA A;  1ULN A;  1UHA A;  2WGC A;  1Q9B A;  1P9Z A;  2LB7 A;  1WGC A;  2UVO A;  2X3T A;  2X52 A;  9WGA A;  1P9G A;  4AML A;  2CWG A;  1WKX A;  1HEV A;  1WGT A;  1K7V A;  1K7T A;  2DKV A;  1ULM A;  1ULK A;  4WP4 A; 
#chains in the Genus database with same CATH topology
 4MPI A;  3VE5 A;  1MJB A;  1TBN A;  1CGI I;  3OVO A;  1WTJ A;  1LR7 A;  2GKT I;  2SGQ I;  2ROW A;  4A24 A;  3GOX A;  2B8T A;  1TGS I;  1P9Z A;  2QQ0 A;  2GIV A;  3KY9 A;  2QQE A;  2OD1 A;  2F3C I;  1Y8F A;  2ENZ A;  1HJA I;  1V1I A;  1PJU A;  1V1H A;  1MJA A;  2DIP A;  5FUX A;  3UEY A;  2A20 A;  2JYY A;  2CWG A;  2SGE I;  2N52 A;  2ODD A;  3BJI A;  1X4S A;  2K9H A;  3R5B A;  1SGY I;  1PTR A;  3MEK A;  5FUV A;  3CXL A;  2RC4 A;  2DKV A;  1Y1B A;  1ULM A;  3UEJ A;  1RFH A;  1KMA A;  4HGU A;  2SGF I;  2KMR A;  4SGB I;  4WP4 A;  3TJQ A;  2CWF A;  1TUS A;  3TO9 A;  2V1C A;  3TOB A;  5HQ8 A;  2CJS C;  2OVO A;  1Z2I A;  2KMQ A;  2OU2 A;  2JA1 A;  7WGA A;  1N13 A;  3OL0 A;  1BUS A;  1UHA A;  3OXF A;  3QWP A;  2WGC A;  1IY5 A;  1DS3 I;  1Z7K B;  1PPF I;  2ERW A;  2XRC A;  3TO7 A;  1CE3 A;  1LR8 A;  1CT4 I;  1KBF A;  1TIH A;  2L8E A;  2N71 A;  2UVO A;  1SGE I;  2X3T A;  3UGL A;  2CWH A;  4E1P A;  2Y0M A;  1XX6 A;  1TBR R;  3UOE A;  3VDP A;  3VDU A;  1P9G A;  2ARP F;  3UGD A;  4AML A;  4E1R A;  5J8F A;  2DB6 A;  5JHW C;  1WKX A;  1PTQ A;  2RIJ A;  4GI3 C;  1HEV A;  1UUC A;  2JZM A;  4UXI A;  1K7T A;  1CSO I;  1CHO I;  4UXJ A;  2VRW B;  1FAQ A;  2GKV A;  1HPT A;  3TOA A;  2BUS A;  1CT0 I;  1NUB A;  2V1C C;  3TO6 A;  3RU0 A;  1U5K A;  4OVO A;  1DS2 I;  1TUR A;  2W0T A;  3OXG A;  3SEK C;  2L7X A;  1LR9 A;  3UFF A;  3PDN A;  5HI7 A;  3FC3 A;  1M8C A;  3QTL D;  2NU1 I;  4JCV E;  2ENN A;  2GVI A;  2P6A C;  4L9M A;  5CCM A;  2QQC A;  1AN1 I;  1SGN I;  1YU6 C;  1WGC A;  2LB7 A;  2LUY A;  5FUW A;  1TBO A;  4DNC A;  5E3P A;  1FAR A;  1XBT A;  1OMT A;  2QQD A;  2YUU A;  1R0R I;  1FYB A;  4B6D A;  3R5C A;  1OMU A;  1VDD A;  5DAE A;  1W4R A;  1SGR I;  2N1A B;  2NU2 I;  1WGT A;  1HDL A;  1X74 A;  2KCX A;  1XA6 A;  2ORV A;  3UGI A;  5E3Q A;  1BMO A;  1KBE A;  1R79 A;  2WVJ A;  3FSY A;  2SGP I;  5E3R A;  2ELI A;  1MT1 A;  1IW4 A;  1W3S A;  2M5X A;  1UVG A;  2E73 A;  2KMP A;  1K7U A;  2OZU A;  2B0U C;  5J8C A;  2JW6 A;  3E59 A;  2SGD I;  3QAH A;  1ULN A;  2NU4 I;  1IY6 A;  5EX0 A;  2NU3 I;  1Y1C A;  2N17 A;  1CT2 I;  3B4V C;  2YQP A;  1SGD I;  1Q9B A;  1OVO A;  2GKR I;  1H0Z A;  1TBQ R;  1FY7 A;  3SGB I;  9WGA A;  2X52 A;  3OXL A;  3R5A A;  1SGP I;  2E5R A;  2UZ3 A;  4UXH A;  3SGQ I;  1UVF A;  1YTP A;  2KMO A;  2QPO A;  3D00 A;  1CGJ I;  3FSX A;  3R5D A;  5EX3 A;  1OYV I;  2J9R A;  2NU0 I;  2FNF X;  1M8B A;  2JXD A;  2ORW A;  3HH2 C;  5FUY A;  2LEO A;  2J87 A;  1MJ9 A;  4FKD A;  1K7V A;  1NXU A;  2WCY A;  1TOT A;  5CCL A;  2V53 A;  1ULK A;  1PCE A;  3E2I A;  1S20 A;  1SGQ I;  2PQ8 A; 
#chains in the Genus database with same CATH homology
 1K7U A;  4MPI A;  7WGA A;  1ULN A;  1UHA A;  2WGC A;  1Q9B A;  1P9Z A;  2LB7 A;  1WGC A;  2UVO A;  2X3T A;  2X52 A;  9WGA A;  1P9G A;  4AML A;  2CWG A;  1WKX A;  1HEV A;  1WGT A;  1K7V A;  1K7T A;  2DKV A;  1ULM A;  1ULK A;  4WP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...