2L7XA

Crimean congo hemorrhagic fever gn zinc finger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
RELKPQTCTICETTPVNAIDAEMHDLNCSYNICPYCASRLTSDGLARHVTQCPKRKEKVEETELYLNLERIPWVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein
publication title Structural characterization of the crimean-congo hemorrhagic Fever virus gn tail provides insight into virus assembly.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.150 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2l7xA00
2K9HA 2L7XA
chains in the Genus database with same CATH superfamily
1X4SA 1OMUA 1CHOI 3VE5A 2XRCA 4WP4A 5DAEA 2B0UC 1CGII 1UVGA 1Y1BA 2F3CI 2K9HA 2LB7A 3UFFA 2KMPA 3QAHA 2ELIA 2GKVA 2JXDA 4MPIA 1CT0I 2NU0I 1KBEA 2OU2A 2CWHA 1OVOA 3R5CA 2JA1A 1SGNI 2BUSA 1MJAA 4E1PA 2ORVA 5CCLA 4L9MA 2QPOA 5J8CA 2P6AC 3TO6A 1K7TA 2RIJA 3R5DA 1R79A 1PJUA 1OYVI 7WGAA 3FSYA 3UGLA 2SGDI 3D00A 2X52A 1CT2I 1XX6A 1BMOA 2N1AB 1LR7A 1R0RI 2LUYA 5FUYA 2NU4I 2KMRA 2M5XA 2V1CA 1KMAA 2V53A 4HGUA 2QQDA 4A24A 2OVOA 1HJAI 3E59A 1CT4I 5FUWA 4E1RA 2V1CC 2A20A 3TOBA 1UHAA 3OXFA 3RU0A 3TJQA 1PPFI 1WGTA 2N17A 1TBQR 4GI3C 3E2IA 1YTPA 3R5BA 9WGAA 3TOAA 1N13A 2SGEI 1CSOI 1PTQA 2FNFX 2JW6A 1IY6A 1H0ZA 3HH2C 1TURA 5FUXA 1WGCA 1LR8A 1XA6A 1KBFA 2WGCA 2DIPA 2N71A 3OXGA 5HI7A 2ENNA 2KCXA 5E3PA 3SGQI 2E5RA 1DS2I 2JYYA 1S20A 2W0TA 2L8EA 2ROWA 3OL0A 3TO7A 2N52A 2UVOA 2Y0MA 2SGFI 3OVOA 2ODDA 3VDUA 2NU3I 3VDPA 5J8FA 2GKRI 2SGQI 1M8CA 2CJSC 1AN1I 1FY7A 1HEVA 4B6DA 2DB6A 1IW4A 3KY9A 1X74A 2YQPA 3FSXA 1TUSA 1XBTA 1TBOA 1Z2IA 1W4RA 1ULNA 3UOEA 3R5AA 3QTLD 1V1IA 2X3TA 1FAQA 5EX3A 1ULMA 2E73A 1SGYI 4UXJA 3SGBI 3TO9A 1PCEA 1SGPI 1K7VA 1MT1A 1UUCA 1P9ZA 1HDLA 1SGEI 1Z7KB 4DNCA 1OMTA 1SGQI 1MJ9A 1VDDA 3OXLA 1Y8FA 2QQCA 1UVFA 1YU6C 1ULKA 2ERWA 1RFHA 5E3RA 4SGBI 1TBNA 3PDNA 2GKTI 5E3QA 4AMLA 2WCYA 3UEJA 1CE3A 5EX0A 1TIHA 1DS3I 3SEKC 2B8TA 2CWGA 1FARA 1P9GA 1WTJA 1CGJI 2DKVA 2NU2I 2RC4A 3B4VC 3UEYA 2UZ3A 2ARPF 4UXIA 2LEOA 5FUVA 4OVOA 2QQ0A 2PQ8A 1SGDI 2J9RA 3BJIA 1Y1CA 2KMOA 1K7UA 2L7XA 2GIVA 3QWPA 2OD1A 1IY5A 2NU1I 1SGRI 4JCVE 2CWFA 3CXLA 1U5KA 2QQEA 1BUSA 1Q9BA 1TGSI 2YUUA 2WVJA 2SGPI 1TOTA 4UXHA 1W3SA 4FKDA 2ENZA 1LR9A 1NXUA 1FYBA 1HPTA 1NUBA 2ORWA 2JZMA 2KMQA 3MEKA 2VRWB 2GVIA 1WKXA 1TBRR 2J87A 3UGIA 2OZUA 1M8BA 3UGDA 5JHWC 3GOXA 3FC3A 1V1HA 5CCMA 5HQ8A 1PTRA 1MJBA
chains in the Genus database with same CATH topology
1X4SA 1OMUA 1CHOI 3VE5A 2XRCA 5DAEA 2B0UC 1CGII 1UVGA 1Y1BA 2F3CI 2K9HA 3UFFA 2KMPA 2ELIA 2GKVA 2JXDA 1CT0I 2NU0I 1KBEA 1OVOA 2JA1A 1SGNI 2BUSA 4E1PA 2ORVA 5CCLA 4L9MA 2QPOA 2P6AC 1R79A 1PJUA 1OYVI 3UGLA 2SGDI 3D00A 1CT2I 1XX6A 1BMOA 2N1AB 1LR7A 1R0RI 2LUYA 5FUYA 2NU4I 2KMRA 2M5XA 2V1CA 1KMAA 2V53A 4HGUA 2QQDA 4A24A 2OVOA 1HJAI 3E59A 1CT4I 5FUWA 4E1RA 2V1CC 2A20A 3RU0A 3OXFA 3TJQA 1PPFI 2N17A 1TBQR 4GI3C 3E2IA 1YTPA 1N13A 2SGEI 1CSOI 1PTQA 2FNFX 2JW6A 1IY6A 1H0ZA 3HH2C 1TURA 5FUXA 1KBFA 1LR8A 1XA6A 2DIPA 2N71A 3OXGA 5HI7A 2ENNA 2KCXA 3SGQI 2E5RA 1DS2I 2JYYA 2W0TA 2L8EA 2ROWA 3OL0A 2N52A 2SGFI 3OVOA 2ODDA 3VDUA 2NU3I 3VDPA 2GKRI 2SGQI 2CJSC 1M8CA 1AN1I 4B6DA 2DB6A 1IW4A 3KY9A 1X74A 2YQPA 1TUSA 1XBTA 1TBOA 1W4RA 3QTLD 1V1IA 1FAQA 5EX3A 2E73A 1SGYI 4UXJA 3SGBI 1PCEA 1SGPI 1MT1A 1UUCA 1HDLA 1SGEI 1Z7KB 1OMTA 1SGQI 1VDDA 3OXLA 1Y8FA 2QQCA 1UVFA 1YU6C 2ERWA 1RFHA 4SGBI 1TBNA 3PDNA 2GKTI 2WCYA 3UEJA 1CE3A 5EX0A 1TIHA 1DS3I 3SEKC 2B8TA 1FARA 1CGJI 2NU2I 3B4VC 3UEYA 2UZ3A 2ARPF 4UXIA 2LEOA 5FUVA 4OVOA 2QQ0A 1SGDI 2J9RA 3BJIA 1Y1CA 2KMOA 3QWPA 2L7XA 2OD1A 1IY5A 2NU1I 1SGRI 4JCVE 3CXLA 1U5KA 2QQEA 1BUSA 1TGSI 2YUUA 2WVJA 2SGPI 1TOTA 4UXHA 1W3SA 4FKDA 2ENZA 1LR9A 1FYBA 1HPTA 1NUBA 2ORWA 2JZMA 2KMQA 3MEKA 2VRWB 2GVIA 3UGIA 2J87A 5JHWC 3UGDA 3GOXA 1M8BA 3FC3A 1V1HA 5CCMA 5HQ8A 1PTRA 1TBRR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9H A;  2L7X A; 
#chains in the Genus database with same CATH topology
 1X4S A;  1OMU A;  1CHO I;  3VE5 A;  2XRC A;  4WP4 A;  5DAE A;  2B0U C;  1CGI I;  1UVG A;  1Y1B A;  2F3C I;  2K9H A;  2LB7 A;  3UFF A;  2KMP A;  3QAH A;  2ELI A;  2GKV A;  2JXD A;  4MPI A;  1CT0 I;  2NU0 I;  1KBE A;  2OU2 A;  2CWH A;  1OVO A;  3R5C A;  2JA1 A;  1SGN I;  2BUS A;  1MJA A;  4E1P A;  2ORV A;  5CCL A;  4L9M A;  2QPO A;  5J8C A;  2P6A C;  3TO6 A;  1K7T A;  2RIJ A;  3R5D A;  1R79 A;  1PJU A;  1OYV I;  7WGA A;  3FSY A;  3UGL A;  2SGD I;  3D00 A;  2X52 A;  1CT2 I;  1XX6 A;  1BMO A;  2N1A B;  1LR7 A;  1R0R I;  2LUY A;  5FUY A;  2NU4 I;  2KMR A;  2M5X A;  2V1C A;  1KMA A;  2V53 A;  4HGU A;  2QQD A;  4A24 A;  2OVO A;  1HJA I;  3E59 A;  1CT4 I;  5FUW A;  4E1R A;  2V1C C;  2A20 A;  3TOB A;  1UHA A;  3OXF A;  3RU0 A;  3TJQ A;  1PPF I;  1WGT A;  2N17 A;  1TBQ R;  4GI3 C;  3E2I A;  1YTP A;  3R5B A;  9WGA A;  3TOA A;  1N13 A;  2SGE I;  1CSO I;  1PTQ A;  2FNF X;  2JW6 A;  1IY6 A;  1H0Z A;  3HH2 C;  1TUR A;  5FUX A;  1WGC A;  1LR8 A;  1XA6 A;  1KBF A;  2WGC A;  2DIP A;  2N71 A;  3OXG A;  5HI7 A;  2ENN A;  2KCX A;  5E3P A;  3SGQ I;  2E5R A;  1DS2 I;  2JYY A;  1S20 A;  2W0T A;  2L8E A;  2ROW A;  3OL0 A;  3TO7 A;  2N52 A;  2UVO A;  2Y0M A;  2SGF I;  3OVO A;  2ODD A;  3VDU A;  2NU3 I;  3VDP A;  5J8F A;  2GKR I;  2SGQ I;  1M8C A;  2CJS C;  1AN1 I;  1FY7 A;  1HEV A;  4B6D A;  2DB6 A;  1IW4 A;  3KY9 A;  1X74 A;  2YQP A;  3FSX A;  1TUS A;  1XBT A;  1TBO A;  1Z2I A;  1W4R A;  1ULN A;  3UOE A;  3R5A A;  3QTL D;  1V1I A;  2X3T A;  1FAQ A;  5EX3 A;  1ULM A;  2E73 A;  1SGY I;  4UXJ A;  3SGB I;  3TO9 A;  1PCE A;  1SGP I;  1K7V A;  1MT1 A;  1UUC A;  1P9Z A;  1HDL A;  1SGE I;  1Z7K B;  4DNC A;  1OMT A;  1SGQ I;  1MJ9 A;  1VDD A;  3OXL A;  1Y8F A;  2QQC A;  1UVF A;  1YU6 C;  1ULK A;  2ERW A;  1RFH A;  5E3R A;  4SGB I;  1TBN A;  3PDN A;  2GKT I;  5E3Q A;  4AML A;  2WCY A;  3UEJ A;  1CE3 A;  5EX0 A;  1TIH A;  1DS3 I;  3SEK C;  2B8T A;  2CWG A;  1FAR A;  1P9G A;  1WTJ A;  1CGJ I;  2DKV A;  2NU2 I;  2RC4 A;  3B4V C;  3UEY A;  2UZ3 A;  2ARP F;  4UXI A;  2LEO A;  5FUV A;  4OVO A;  2QQ0 A;  2PQ8 A;  1SGD I;  2J9R A;  3BJI A;  1Y1C A;  2KMO A;  1K7U A;  2L7X A;  2GIV A;  3QWP A;  2OD1 A;  1IY5 A;  2NU1 I;  1SGR I;  4JCV E;  2CWF A;  3CXL A;  1U5K A;  2QQE A;  1BUS A;  1Q9B A;  1TGS I;  2YUU A;  2WVJ A;  2SGP I;  1TOT A;  4UXH A;  1W3S A;  4FKD A;  2ENZ A;  1LR9 A;  1NXU A;  1FYB A;  1HPT A;  1NUB A;  2ORW A;  2JZM A;  2KMQ A;  3MEK A;  2VRW B;  2GVI A;  1WKX A;  1TBR R;  2J87 A;  3UGI A;  2OZU A;  1M8B A;  3UGD A;  5JHW C;  3GOX A;  3FC3 A;  1V1H A;  5CCM A;  5HQ8 A;  1PTR A;  1MJB A; 
#chains in the Genus database with same CATH homology
 1X4S A;  1OMU A;  1CHO I;  3VE5 A;  2XRC A;  5DAE A;  2B0U C;  1CGI I;  1UVG A;  1Y1B A;  2F3C I;  2K9H A;  3UFF A;  2KMP A;  2ELI A;  2GKV A;  2JXD A;  1CT0 I;  2NU0 I;  1KBE A;  1OVO A;  2JA1 A;  1SGN I;  2BUS A;  4E1P A;  2ORV A;  5CCL A;  4L9M A;  2QPO A;  2P6A C;  1R79 A;  1PJU A;  1OYV I;  3UGL A;  2SGD I;  3D00 A;  1CT2 I;  1XX6 A;  1BMO A;  2N1A B;  1LR7 A;  1R0R I;  2LUY A;  5FUY A;  2NU4 I;  2KMR A;  2M5X A;  2V1C A;  1KMA A;  2V53 A;  4HGU A;  2QQD A;  4A24 A;  2OVO A;  1HJA I;  3E59 A;  1CT4 I;  5FUW A;  4E1R A;  2V1C C;  2A20 A;  3RU0 A;  3OXF A;  3TJQ A;  1PPF I;  2N17 A;  1TBQ R;  4GI3 C;  3E2I A;  1YTP A;  1N13 A;  2SGE I;  1CSO I;  1PTQ A;  2FNF X;  2JW6 A;  1IY6 A;  1H0Z A;  3HH2 C;  1TUR A;  5FUX A;  1KBF A;  1LR8 A;  1XA6 A;  2DIP A;  2N71 A;  3OXG A;  5HI7 A;  2ENN A;  2KCX A;  3SGQ I;  2E5R A;  1DS2 I;  2JYY A;  2W0T A;  2L8E A;  2ROW A;  3OL0 A;  2N52 A;  2SGF I;  3OVO A;  2ODD A;  3VDU A;  2NU3 I;  3VDP A;  2GKR I;  2SGQ I;  2CJS C;  1M8C A;  1AN1 I;  4B6D A;  2DB6 A;  1IW4 A;  3KY9 A;  1X74 A;  2YQP A;  1TUS A;  1XBT A;  1TBO A;  1W4R A;  3QTL D;  1V1I A;  1FAQ A;  5EX3 A;  2E73 A;  1SGY I;  4UXJ A;  3SGB I;  1PCE A;  1SGP I;  1MT1 A;  1UUC A;  1HDL A;  1SGE I;  1Z7K B;  1OMT A;  1SGQ I;  1VDD A;  3OXL A;  1Y8F A;  2QQC A;  1UVF A;  1YU6 C;  2ERW A;  1RFH A;  4SGB I;  1TBN A;  3PDN A;  2GKT I;  2WCY A;  3UEJ A;  1CE3 A;  5EX0 A;  1TIH A;  1DS3 I;  3SEK C;  2B8T A;  1FAR A;  1CGJ I;  2NU2 I;  3B4V C;  3UEY A;  2UZ3 A;  2ARP F;  4UXI A;  2LEO A;  5FUV A;  4OVO A;  2QQ0 A;  1SGD I;  2J9R A;  3BJI A;  1Y1C A;  2KMO A;  3QWP A;  2L7X A;  2OD1 A;  1IY5 A;  2NU1 I;  1SGR I;  4JCV E;  3CXL A;  1U5K A;  2QQE A;  1BUS A;  1TGS I;  2YUU A;  2WVJ A;  2SGP I;  1TOT A;  4UXH A;  1W3S A;  4FKD A;  2ENZ A;  1LR9 A;  1FYB A;  1HPT A;  1NUB A;  2ORW A;  2JZM A;  2KMQ A;  3MEK A;  2VRW B;  2GVI A;  3UGI A;  2J87 A;  5JHW C;  3UGD A;  3GOX A;  1M8B A;  3FC3 A;  1V1H A;  5CCM A;  5HQ8 A;  1PTR A;  1TBR R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...