2L7XA

Crimean congo hemorrhagic fever gn zinc finger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
RELKPQTCTICETTPVNAIDAEMHDLNCSYNICPYCASRLTSDGLARHVTQCPKRKEKVEETELYLNLERIPWVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structural characterization of the crimean-congo hemorrhagic Fever virus gn tail provides insight into virus assembly.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Viral protein
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.150 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2l7xA00
2L7XA 2K9HA
chains in the Genus database with same CATH superfamily
4DNCA 2L8EA 2RC4A 1V1IA 3FSYA 1FY7A 1OMTA 1Q9BA 2ORVA 2N52A 3E2IA 2LEOA 1TURA 3R5AA 1CSOI 4FKDA 5E3RA 9WGAA 2NU3I 2ARPF 2ELIA 2JYYA 1DS2I 5CCMA 1LR7A 3UOEA 1HDLA 2BUSA 2M5XA 2XRCA 1W4RA 1ULKA 1WTJA 2ORWA 3UFFA 1SGRI 3QWPA 1ULMA 1U5KA 4E1RA 3E59A 2W0TA 1SGEI 2CJSC 3R5CA 1SGYI 1W3SA 1Y1BA 2QPOA 2WVJA 2SGQI 1FAQA 1SGNI 2KMOA 4A24A 1HPTA 3PDNA 3TO7A 3HH2C 2OZUA 2QQCA 2N1AB 2PQ8A 2NU1I 1Y8FA 4MPIA 1UVGA 1M8BA 3UEJA 5DAEA 1DS3I 1TBRR 1KBEA 1NXUA 3TOAA 4E1PA 1CGJI 1BMOA 1V1HA 5E3PA 1P9ZA 2ENNA 2N17A 1SGDI 3OXGA 5J8FA 1OYVI 2GVIA 3D00A 2ODDA 2UZ3A 2N71A 3QTLD 1Z2IA 5FUVA 2K9HA 2SGDI 1CT0I 3SGQI 1XX6A 5CCLA 1BUSA 1PCEA 1HJAI 1PJUA 2V1CC 1X74A 2GKTI 3MEKA 5FUWA 5HI7A 5HQ8A 1S20A 2E5RA 3UEYA 1R0RI 4B6DA 2KMRA 2P6AC 1K7UA 1WGCA 3TOBA 1IY6A 2GKRI 2FNFX 2KCXA 1M8CA 1IY5A 3TO6A 1CHOI 1LR9A 1TGSI 2E73A 2Y0MA 2GIVA 2OD1A 3GOXA 1VDDA 2F3CI 1TUSA 1HEVA 1PPFI 1TIHA 2RIJA 1RFHA 2SGFI 3TJQA 1Z7KB 2V53A 3OXLA 3R5BA 2X3TA 3FSXA 4AMLA 4JCVE 3OL0A 3OVOA 3VE5A 1CE3A 1K7TA 1ULNA 4OVOA 5EX3A 2LUYA 2WGCA 2YUUA 2YQPA 3B4VC 2CWFA 1MJ9A 1UVFA 1NUBA 4UXHA 2DB6A 2JZMA 1SGQI 1TBOA 3UGDA 3BJIA 1IW4A 1MJBA 1WGTA 2CWHA 2OVOA 2LB7A 2DIPA 2QQEA 5JHWC 1TBQR 2X52A 1YTPA 4UXIA 1CT2I 2OU2A 3R5DA 3VDUA 2QQDA 1UUCA 2ERWA 1CT4I 4HGUA 1KBFA 2SGEI 1OMUA 1OVOA 2JW6A 1LR8A 2L7XA 2UVOA 1MJAA 3KY9A 4L9MA 2NU4I 5E3QA 1WKXA 2KMQA 3QAHA 1MT1A 1SGPI 3OXFA 1Y1CA 1H0ZA 1YU6C 2QQ0A 2B0UC 2ROWA 2JXDA 2KMPA 2SGPI 2WCYA 1XA6A 3FC3A 2V1CA 1X4SA 5FUYA 1KMAA 2CWGA 1FARA 1N13A 5J8CA 1PTQA 2A20A 2B8TA 2GKVA 2NU0I 3UGLA 7WGAA 1FYBA 4UXJA 5EX0A 3RU0A 1PTRA 3UGIA 3SEKC 1TOTA 4WP4A 1R79A 2J9RA 1CGII 1UHAA 1XBTA 3CXLA 4SGBI 2VRWB 2JA1A 1K7VA 3VDPA 1TBNA 2NU2I 1P9GA 4GI3C 1AN1I 5FUXA 2DKVA 2J87A 3TO9A 3SGBI 2ENZA
chains in the Genus database with same CATH topology
2L8EA 1V1IA 1OMTA 2ORVA 2N52A 3E2IA 2LEOA 1TURA 4FKDA 1CSOI 2NU3I 2ARPF 2ELIA 2JYYA 1DS2I 5CCMA 1LR7A 1HDLA 2BUSA 2M5XA 2XRCA 1W4RA 2ORWA 3UFFA 4E1RA 1SGRI 3QWPA 1U5KA 3E59A 2W0TA 1SGEI 2CJSC 1SGYI 1W3SA 1Y1BA 2QPOA 2WVJA 2SGQI 1FAQA 1SGNI 2KMOA 4A24A 1HPTA 3PDNA 3HH2C 2QQCA 2N1AB 2NU1I 1Y8FA 1UVGA 1M8BA 3UEJA 5DAEA 1DS3I 1TBRR 1KBEA 4E1PA 1CGJI 1BMOA 1V1HA 2ENNA 2N17A 1SGDI 3OXGA 1OYVI 2GVIA 3D00A 2ODDA 2UZ3A 2N71A 3QTLD 5FUVA 2K9HA 2SGDI 1CT0I 3SGQI 1XX6A 1BUSA 1PCEA 1HJAI 1PJUA 2V1CC 1X74A 2GKTI 3MEKA 5FUWA 5HI7A 5HQ8A 2E5RA 3UEYA 1R0RI 4B6DA 2KMRA 2P6AC 1IY6A 2GKRI 2FNFX 2KCXA 1M8CA 1IY5A 1CHOI 1LR9A 1TGSI 2E73A 2OD1A 3GOXA 1VDDA 2F3CI 1TUSA 1PPFI 1TIHA 1RFHA 2SGFI 3TJQA 1Z7KB 2V53A 3OXLA 5CCLA 4JCVE 3OL0A 3OVOA 1CE3A 4OVOA 5EX3A 2LUYA 2YUUA 2YQPA 3B4VC 1UVFA 1NUBA 4UXHA 2DB6A 2JZMA 1SGQI 1TBOA 3UGDA 3BJIA 1IW4A 2OVOA 2DIPA 2QQEA 5JHWC 1TBQR 1YTPA 4UXIA 1CT2I 3VDUA 2QQDA 1UUCA 2ERWA 1CT4I 4HGUA 1KBFA 2SGEI 1OMUA 1OVOA 2JW6A 1LR8A 2L7XA 4L9MA 3KY9A 3VE5A 2NU4I 2KMQA 1MT1A 1SGPI 3OXFA 1Y1CA 1H0ZA 1YU6C 2QQ0A 2B0UC 2ROWA 2JXDA 2KMPA 2SGPI 2WCYA 1XA6A 3FC3A 2V1CA 1X4SA 5FUYA 1KMAA 1FARA 1N13A 1PTQA 2A20A 2B8TA 2GKVA 2NU0I 3UGLA 1FYBA 4UXJA 5EX0A 3RU0A 1PTRA 3UGIA 3SEKC 1TOTA 1R79A 2J9RA 1CGII 1XBTA 3CXLA 4SGBI 2VRWB 2JA1A 3VDPA 1TBNA 2NU2I 4GI3C 5FUXA 1AN1I 2J87A 3SGBI 2ENZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7X A;  2K9H A; 
#chains in the Genus database with same CATH topology
 4DNC A;  2L8E A;  2RC4 A;  1V1I A;  3FSY A;  1FY7 A;  1OMT A;  1Q9B A;  2ORV A;  2N52 A;  3E2I A;  2LEO A;  1TUR A;  3R5A A;  1CSO I;  4FKD A;  5E3R A;  9WGA A;  2NU3 I;  2ARP F;  2ELI A;  2JYY A;  1DS2 I;  5CCM A;  1LR7 A;  3UOE A;  1HDL A;  2BUS A;  2M5X A;  2XRC A;  1W4R A;  1ULK A;  1WTJ A;  2ORW A;  3UFF A;  1SGR I;  3QWP A;  1ULM A;  1U5K A;  4E1R A;  3E59 A;  2W0T A;  1SGE I;  2CJS C;  3R5C A;  1SGY I;  1W3S A;  1Y1B A;  2QPO A;  2WVJ A;  2SGQ I;  1FAQ A;  1SGN I;  2KMO A;  4A24 A;  1HPT A;  3PDN A;  3TO7 A;  3HH2 C;  2OZU A;  2QQC A;  2N1A B;  2PQ8 A;  2NU1 I;  1Y8F A;  4MPI A;  1UVG A;  1M8B A;  3UEJ A;  5DAE A;  1DS3 I;  1TBR R;  1KBE A;  1NXU A;  3TOA A;  4E1P A;  1CGJ I;  1BMO A;  1V1H A;  5E3P A;  1P9Z A;  2ENN A;  2N17 A;  1SGD I;  3OXG A;  5J8F A;  1OYV I;  2GVI A;  3D00 A;  2ODD A;  2UZ3 A;  2N71 A;  3QTL D;  1Z2I A;  5FUV A;  2K9H A;  2SGD I;  1CT0 I;  3SGQ I;  1XX6 A;  5CCL A;  1BUS A;  1PCE A;  1HJA I;  1PJU A;  2V1C C;  1X74 A;  2GKT I;  3MEK A;  5FUW A;  5HI7 A;  5HQ8 A;  1S20 A;  2E5R A;  3UEY A;  1R0R I;  4B6D A;  2KMR A;  2P6A C;  1K7U A;  1WGC A;  3TOB A;  1IY6 A;  2GKR I;  2FNF X;  2KCX A;  1M8C A;  1IY5 A;  3TO6 A;  1CHO I;  1LR9 A;  1TGS I;  2E73 A;  2Y0M A;  2GIV A;  2OD1 A;  3GOX A;  1VDD A;  2F3C I;  1TUS A;  1HEV A;  1PPF I;  1TIH A;  2RIJ A;  1RFH A;  2SGF I;  3TJQ A;  1Z7K B;  2V53 A;  3OXL A;  3R5B A;  2X3T A;  3FSX A;  4AML A;  4JCV E;  3OL0 A;  3OVO A;  3VE5 A;  1CE3 A;  1K7T A;  1ULN A;  4OVO A;  5EX3 A;  2LUY A;  2WGC A;  2YUU A;  2YQP A;  3B4V C;  2CWF A;  1MJ9 A;  1UVF A;  1NUB A;  4UXH A;  2DB6 A;  2JZM A;  1SGQ I;  1TBO A;  3UGD A;  3BJI A;  1IW4 A;  1MJB A;  1WGT A;  2CWH A;  2OVO A;  2LB7 A;  2DIP A;  2QQE A;  5JHW C;  1TBQ R;  2X52 A;  1YTP A;  4UXI A;  1CT2 I;  2OU2 A;  3R5D A;  3VDU A;  2QQD A;  1UUC A;  2ERW A;  1CT4 I;  4HGU A;  1KBF A;  2SGE I;  1OMU A;  1OVO A;  2JW6 A;  1LR8 A;  2L7X A;  2UVO A;  1MJA A;  3KY9 A;  4L9M A;  2NU4 I;  5E3Q A;  1WKX A;  2KMQ A;  3QAH A;  1MT1 A;  1SGP I;  3OXF A;  1Y1C A;  1H0Z A;  1YU6 C;  2QQ0 A;  2B0U C;  2ROW A;  2JXD A;  2KMP A;  2SGP I;  2WCY A;  1XA6 A;  3FC3 A;  2V1C A;  1X4S A;  5FUY A;  1KMA A;  2CWG A;  1FAR A;  1N13 A;  5J8C A;  1PTQ A;  2A20 A;  2B8T A;  2GKV A;  2NU0 I;  3UGL A;  7WGA A;  1FYB A;  4UXJ A;  5EX0 A;  3RU0 A;  1PTR A;  3UGI A;  3SEK C;  1TOT A;  4WP4 A;  1R79 A;  2J9R A;  1CGI I;  1UHA A;  1XBT A;  3CXL A;  4SGB I;  2VRW B;  2JA1 A;  1K7V A;  3VDP A;  1TBN A;  2NU2 I;  1P9G A;  4GI3 C;  1AN1 I;  5FUX A;  2DKV A;  2J87 A;  3TO9 A;  3SGB I;  2ENZ A; 
#chains in the Genus database with same CATH homology
 2L8E A;  1V1I A;  1OMT A;  2ORV A;  2N52 A;  3E2I A;  2LEO A;  1TUR A;  4FKD A;  1CSO I;  2NU3 I;  2ARP F;  2ELI A;  2JYY A;  1DS2 I;  5CCM A;  1LR7 A;  1HDL A;  2BUS A;  2M5X A;  2XRC A;  1W4R A;  2ORW A;  3UFF A;  4E1R A;  1SGR I;  3QWP A;  1U5K A;  3E59 A;  2W0T A;  1SGE I;  2CJS C;  1SGY I;  1W3S A;  1Y1B A;  2QPO A;  2WVJ A;  2SGQ I;  1FAQ A;  1SGN I;  2KMO A;  4A24 A;  1HPT A;  3PDN A;  3HH2 C;  2QQC A;  2N1A B;  2NU1 I;  1Y8F A;  1UVG A;  1M8B A;  3UEJ A;  5DAE A;  1DS3 I;  1TBR R;  1KBE A;  4E1P A;  1CGJ I;  1BMO A;  1V1H A;  2ENN A;  2N17 A;  1SGD I;  3OXG A;  1OYV I;  2GVI A;  3D00 A;  2ODD A;  2UZ3 A;  2N71 A;  3QTL D;  5FUV A;  2K9H A;  2SGD I;  1CT0 I;  3SGQ I;  1XX6 A;  1BUS A;  1PCE A;  1HJA I;  1PJU A;  2V1C C;  1X74 A;  2GKT I;  3MEK A;  5FUW A;  5HI7 A;  5HQ8 A;  2E5R A;  3UEY A;  1R0R I;  4B6D A;  2KMR A;  2P6A C;  1IY6 A;  2GKR I;  2FNF X;  2KCX A;  1M8C A;  1IY5 A;  1CHO I;  1LR9 A;  1TGS I;  2E73 A;  2OD1 A;  3GOX A;  1VDD A;  2F3C I;  1TUS A;  1PPF I;  1TIH A;  1RFH A;  2SGF I;  3TJQ A;  1Z7K B;  2V53 A;  3OXL A;  5CCL A;  4JCV E;  3OL0 A;  3OVO A;  1CE3 A;  4OVO A;  5EX3 A;  2LUY A;  2YUU A;  2YQP A;  3B4V C;  1UVF A;  1NUB A;  4UXH A;  2DB6 A;  2JZM A;  1SGQ I;  1TBO A;  3UGD A;  3BJI A;  1IW4 A;  2OVO A;  2DIP A;  2QQE A;  5JHW C;  1TBQ R;  1YTP A;  4UXI A;  1CT2 I;  3VDU A;  2QQD A;  1UUC A;  2ERW A;  1CT4 I;  4HGU A;  1KBF A;  2SGE I;  1OMU A;  1OVO A;  2JW6 A;  1LR8 A;  2L7X A;  4L9M A;  3KY9 A;  3VE5 A;  2NU4 I;  2KMQ A;  1MT1 A;  1SGP I;  3OXF A;  1Y1C A;  1H0Z A;  1YU6 C;  2QQ0 A;  2B0U C;  2ROW A;  2JXD A;  2KMP A;  2SGP I;  2WCY A;  1XA6 A;  3FC3 A;  2V1C A;  1X4S A;  5FUY A;  1KMA A;  1FAR A;  1N13 A;  1PTQ A;  2A20 A;  2B8T A;  2GKV A;  2NU0 I;  3UGL A;  1FYB A;  4UXJ A;  5EX0 A;  3RU0 A;  1PTR A;  3UGI A;  3SEK C;  1TOT A;  1R79 A;  2J9R A;  1CGI I;  1XBT A;  3CXL A;  4SGB I;  2VRW B;  2JA1 A;  3VDP A;  1TBN A;  2NU2 I;  4GI3 C;  5FUX A;  1AN1 I;  2J87 A;  3SGB I;  2ENZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...