2L7XA

Crimean congo hemorrhagic fever gn zinc finger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
RELKPQTCTICETTPVNAIDAEMHDLNCSYNICPYCASRLTSDGLARHVTQCPKRKEKVEETELYLNLERIPWVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structural characterization of the crimean-congo hemorrhagic Fever virus gn tail provides insight into virus assembly.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Viral protein
total genus 21
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.150 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2l7xA00
2L7XA 2K9HA
chains in the Genus database with same CATH superfamily
2WGCA 1WGCA 2N17A 1K7TA 2V1CC 2ERWA 3SEKC 1FAQA 2ORWA 1PTRA 2OU2A 5FUXA 2RIJA 3GOXA 1PJUA 5EX3A 2CWGA 1UUCA 2UVOA 5HQ8A 1X74A 2NU1I 1TIHA 2KMRA 1FARA 1TBRR 1TBOA 2X3TA 3UEYA 5CCMA 1HDLA 3TOAA 2ENZA 2Y0MA 2DIPA 2LB7A 3QAHA 3VDPA 2GKTI 1HPTA 1DS3I 1CGJI 2XRCA 1LR9A 2ELIA 1IY5A 1CGII 1FYBA 1HEVA 2UZ3A 1WKXA 2E73A 2ARPF 2CWHA 2SGFI 4L9MA 1Y8FA 3TOBA 2NU2I 2JYYA 1BUSA 1UHAA 1K7VA 1LR7A 3B4VC 9WGAA 2DB6A 2QQ0A 3BJIA 1CE3A 1N13A 1OVOA 1TGSI 2DKVA 3MEKA 2GVIA 4E1PA 1KMAA 1VDDA 2NU3I 3R5AA 2ORVA 2CJSC 2SGQI 5CCLA 2LUYA 1UVGA 3OXLA 1DS2I 2N52A 1CT2I 7WGAA 3OVOA 5J8CA 1W3SA 2FNFX 3TO7A 3VE5A 2QQEA 4UXHA 1Y1BA 1PTQA 4WP4A 2NU0I 2YUUA 2JA1A 3SGQI 2OD1A 2KMOA 1OYVI 2ENNA 3QWPA 5FUWA 3UGIA 1ULMA 1M8BA 2ODDA 2OVOA 1X4SA 2GIVA 4DNCA 1CHOI 1P9ZA 2JXDA 2M5XA 4HGUA 1PPFI 3UGDA 1SGPI 3UGLA 2YQPA 2VRWB 5J8FA 4UXIA 2QQDA 1TUSA 2J9RA 2N1AB 2SGDI 1ULNA 2WVJA 5EX0A 3HH2C 2V1CA 1R79A 3OL0A 4GI3C 1AN1I 1BMOA 2F3CI 2N71A 5JHWC 1WTJA 1S20A 1YU6C 2V53A 1R0RI 3TJQA 4E1RA 3R5CA 1PCEA 3CXLA 1V1IA 1XA6A 1V1HA 1SGNI 1MT1A 2WCYA 4JCVE 3KY9A 4MPIA 1Y1CA 2OZUA 1TOTA 2KCXA 1UVFA 1LR8A 1MJAA 3E59A 1MJ9A 3TO6A 4UXJA 1TBQR 1XX6A 3OXGA 1K7UA 1IW4A 3TO9A 3SGBI 4FKDA 1SGYI 1NUBA 1U5KA 1CSOI 1Z7KB 2BUSA 2KMQA 3R5BA 3VDUA 3E2IA 5HI7A 1M8CA 1HJAI 2A20A 3QTLD 1IY6A 2JZMA 2J87A 1KBEA 1TBNA 3D00A 5E3RA 3UEJA 1ULKA 1MJBA 2KMPA 2B8TA 2QQCA 1XBTA 2RC4A 2PQ8A 3UFFA 3RU0A 1KBFA 1SGEI 1RFHA 2B0UC 1WGTA 2GKRI 2K9HA 2L7XA 1SGRI 3PDNA 4OVOA 4B6DA 2SGPI 2CWFA 1H0ZA 3FSXA 1SGDI 5E3QA 2GKVA 1P9GA 1OMUA 2JW6A 2SGEI 1OMTA 2LEOA 2X52A 1NXUA 1Z2IA 2QPOA 5FUVA 3UOEA 5E3PA 1Q9BA 1FY7A 3R5DA 3FSYA 5DAEA 3OXFA 1YTPA 4AMLA 2L8EA 4SGBI 4A24A 1CT0I 2E5RA 1SGQI 1TURA 3FC3A 1W4RA 1CT4I 2NU4I 5FUYA 2P6AC 2ROWA 2W0TA
chains in the Genus database with same CATH topology
2N17A 2V1CC 2ERWA 3SEKC 1FAQA 2ORWA 1PTRA 5FUXA 3GOXA 1PJUA 5EX3A 1UUCA 5HQ8A 1X74A 2NU1I 1TIHA 2KMRA 1FARA 1TBRR 1TBOA 3UEYA 5CCMA 1HDLA 2ENZA 2DIPA 3VDPA 2GKTI 1HPTA 1DS3I 1CGJI 2XRCA 1LR9A 2ELIA 1IY5A 1CGII 1FYBA 2UZ3A 2E73A 2ARPF 2SGFI 4L9MA 2NU2I 2JYYA 1BUSA 3B4VC 1LR7A 1CE3A 2DB6A 2QQ0A 3BJIA 1N13A 1OVOA 1TGSI 3MEKA 1KMAA 2GVIA 4E1PA 1VDDA 2NU3I 2ORVA 2CJSC 2SGQI 5CCLA 2LUYA 1UVGA 3OXLA 1DS2I 2N52A 1CT2I 3OVOA 1W3SA 2FNFX 3VE5A 2QQEA 4UXHA 1Y1BA 1PTQA 2NU0I 2YUUA 2JA1A 3SGQI 2OD1A 2KMOA 1OYVI 2ENNA 3QWPA 5FUWA 3UGIA 2OVOA 1M8BA 2ODDA 1X4SA 1CHOI 2JXDA 2M5XA 4HGUA 1PPFI 3UGDA 1SGPI 3UGLA 2YQPA 2VRWB 4UXIA 2QQDA 1TUSA 2J9RA 2N1AB 2SGDI 2WVJA 5EX0A 3HH2C 2V1CA 1R79A 3OL0A 4GI3C 1AN1I 1BMOA 2F3CI 2N71A 5JHWC 1YU6C 3TJQA 2V53A 1R0RI 4E1RA 1PCEA 3CXLA 1V1IA 1XA6A 1V1HA 1CT4I 1SGNI 1MT1A 2WCYA 4JCVE 3KY9A 1Y1CA 1TOTA 2KCXA 1UVFA 1LR8A 3E59A 4UXJA 1TBQR 1XX6A 3OXGA 1IW4A 3SGBI 4FKDA 1SGYI 1NUBA 1U5KA 1CSOI 2BUSA 1Z7KB 2KMQA 3VDUA 3E2IA 5HI7A 1M8CA 1HJAI 2A20A 3QTLD 1IY6A 2JZMA 2J87A 1KBEA 1TBNA 3D00A 3UEJA 2KMPA 3UFFA 2B8TA 2QQCA 1XBTA 1KBFA 3RU0A 1SGEI 1RFHA 2B0UC 2GKRI 2L7XA 2K9HA 3PDNA 1SGRI 4OVOA 4B6DA 2SGPI 1H0ZA 1SGDI 2GKVA 2JW6A 1OMUA 2SGEI 1OMTA 2LEOA 2QPOA 5FUVA 5DAEA 3OXFA 1YTPA 2L8EA 4SGBI 4A24A 1CT0I 2E5RA 1SGQI 1TURA 3FC3A 1W4RA 1Y8FA 2NU4I 5FUYA 2P6AC 2ROWA 2W0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7X A;  2K9H A; 
#chains in the Genus database with same CATH topology
 2WGC A;  1WGC A;  2N17 A;  1K7T A;  2V1C C;  2ERW A;  3SEK C;  1FAQ A;  2ORW A;  1PTR A;  2OU2 A;  5FUX A;  2RIJ A;  3GOX A;  1PJU A;  5EX3 A;  2CWG A;  1UUC A;  2UVO A;  5HQ8 A;  1X74 A;  2NU1 I;  1TIH A;  2KMR A;  1FAR A;  1TBR R;  1TBO A;  2X3T A;  3UEY A;  5CCM A;  1HDL A;  3TOA A;  2ENZ A;  2Y0M A;  2DIP A;  2LB7 A;  3QAH A;  3VDP A;  2GKT I;  1HPT A;  1DS3 I;  1CGJ I;  2XRC A;  1LR9 A;  2ELI A;  1IY5 A;  1CGI I;  1FYB A;  1HEV A;  2UZ3 A;  1WKX A;  2E73 A;  2ARP F;  2CWH A;  2SGF I;  4L9M A;  1Y8F A;  3TOB A;  2NU2 I;  2JYY A;  1BUS A;  1UHA A;  1K7V A;  1LR7 A;  3B4V C;  9WGA A;  2DB6 A;  2QQ0 A;  3BJI A;  1CE3 A;  1N13 A;  1OVO A;  1TGS I;  2DKV A;  3MEK A;  2GVI A;  4E1P A;  1KMA A;  1VDD A;  2NU3 I;  3R5A A;  2ORV A;  2CJS C;  2SGQ I;  5CCL A;  2LUY A;  1UVG A;  3OXL A;  1DS2 I;  2N52 A;  1CT2 I;  7WGA A;  3OVO A;  5J8C A;  1W3S A;  2FNF X;  3TO7 A;  3VE5 A;  2QQE A;  4UXH A;  1Y1B A;  1PTQ A;  4WP4 A;  2NU0 I;  2YUU A;  2JA1 A;  3SGQ I;  2OD1 A;  2KMO A;  1OYV I;  2ENN A;  3QWP A;  5FUW A;  3UGI A;  1ULM A;  1M8B A;  2ODD A;  2OVO A;  1X4S A;  2GIV A;  4DNC A;  1CHO I;  1P9Z A;  2JXD A;  2M5X A;  4HGU A;  1PPF I;  3UGD A;  1SGP I;  3UGL A;  2YQP A;  2VRW B;  5J8F A;  4UXI A;  2QQD A;  1TUS A;  2J9R A;  2N1A B;  2SGD I;  1ULN A;  2WVJ A;  5EX0 A;  3HH2 C;  2V1C A;  1R79 A;  3OL0 A;  4GI3 C;  1AN1 I;  1BMO A;  2F3C I;  2N71 A;  5JHW C;  1WTJ A;  1S20 A;  1YU6 C;  2V53 A;  1R0R I;  3TJQ A;  4E1R A;  3R5C A;  1PCE A;  3CXL A;  1V1I A;  1XA6 A;  1V1H A;  1SGN I;  1MT1 A;  2WCY A;  4JCV E;  3KY9 A;  4MPI A;  1Y1C A;  2OZU A;  1TOT A;  2KCX A;  1UVF A;  1LR8 A;  1MJA A;  3E59 A;  1MJ9 A;  3TO6 A;  4UXJ A;  1TBQ R;  1XX6 A;  3OXG A;  1K7U A;  1IW4 A;  3TO9 A;  3SGB I;  4FKD A;  1SGY I;  1NUB A;  1U5K A;  1CSO I;  1Z7K B;  2BUS A;  2KMQ A;  3R5B A;  3VDU A;  3E2I A;  5HI7 A;  1M8C A;  1HJA I;  2A20 A;  3QTL D;  1IY6 A;  2JZM A;  2J87 A;  1KBE A;  1TBN A;  3D00 A;  5E3R A;  3UEJ A;  1ULK A;  1MJB A;  2KMP A;  2B8T A;  2QQC A;  1XBT A;  2RC4 A;  2PQ8 A;  3UFF A;  3RU0 A;  1KBF A;  1SGE I;  1RFH A;  2B0U C;  1WGT A;  2GKR I;  2K9H A;  2L7X A;  1SGR I;  3PDN A;  4OVO A;  4B6D A;  2SGP I;  2CWF A;  1H0Z A;  3FSX A;  1SGD I;  5E3Q A;  2GKV A;  1P9G A;  1OMU A;  2JW6 A;  2SGE I;  1OMT A;  2LEO A;  2X52 A;  1NXU A;  1Z2I A;  2QPO A;  5FUV A;  3UOE A;  5E3P A;  1Q9B A;  1FY7 A;  3R5D A;  3FSY A;  5DAE A;  3OXF A;  1YTP A;  4AML A;  2L8E A;  4SGB I;  4A24 A;  1CT0 I;  2E5R A;  1SGQ I;  1TUR A;  3FC3 A;  1W4R A;  1CT4 I;  2NU4 I;  5FUY A;  2P6A C;  2ROW A;  2W0T A; 
#chains in the Genus database with same CATH homology
 2N17 A;  2V1C C;  2ERW A;  3SEK C;  1FAQ A;  2ORW A;  1PTR A;  5FUX A;  3GOX A;  1PJU A;  5EX3 A;  1UUC A;  5HQ8 A;  1X74 A;  2NU1 I;  1TIH A;  2KMR A;  1FAR A;  1TBR R;  1TBO A;  3UEY A;  5CCM A;  1HDL A;  2ENZ A;  2DIP A;  3VDP A;  2GKT I;  1HPT A;  1DS3 I;  1CGJ I;  2XRC A;  1LR9 A;  2ELI A;  1IY5 A;  1CGI I;  1FYB A;  2UZ3 A;  2E73 A;  2ARP F;  2SGF I;  4L9M A;  2NU2 I;  2JYY A;  1BUS A;  3B4V C;  1LR7 A;  1CE3 A;  2DB6 A;  2QQ0 A;  3BJI A;  1N13 A;  1OVO A;  1TGS I;  3MEK A;  1KMA A;  2GVI A;  4E1P A;  1VDD A;  2NU3 I;  2ORV A;  2CJS C;  2SGQ I;  5CCL A;  2LUY A;  1UVG A;  3OXL A;  1DS2 I;  2N52 A;  1CT2 I;  3OVO A;  1W3S A;  2FNF X;  3VE5 A;  2QQE A;  4UXH A;  1Y1B A;  1PTQ A;  2NU0 I;  2YUU A;  2JA1 A;  3SGQ I;  2OD1 A;  2KMO A;  1OYV I;  2ENN A;  3QWP A;  5FUW A;  3UGI A;  2OVO A;  1M8B A;  2ODD A;  1X4S A;  1CHO I;  2JXD A;  2M5X A;  4HGU A;  1PPF I;  3UGD A;  1SGP I;  3UGL A;  2YQP A;  2VRW B;  4UXI A;  2QQD A;  1TUS A;  2J9R A;  2N1A B;  2SGD I;  2WVJ A;  5EX0 A;  3HH2 C;  2V1C A;  1R79 A;  3OL0 A;  4GI3 C;  1AN1 I;  1BMO A;  2F3C I;  2N71 A;  5JHW C;  1YU6 C;  3TJQ A;  2V53 A;  1R0R I;  4E1R A;  1PCE A;  3CXL A;  1V1I A;  1XA6 A;  1V1H A;  1CT4 I;  1SGN I;  1MT1 A;  2WCY A;  4JCV E;  3KY9 A;  1Y1C A;  1TOT A;  2KCX A;  1UVF A;  1LR8 A;  3E59 A;  4UXJ A;  1TBQ R;  1XX6 A;  3OXG A;  1IW4 A;  3SGB I;  4FKD A;  1SGY I;  1NUB A;  1U5K A;  1CSO I;  2BUS A;  1Z7K B;  2KMQ A;  3VDU A;  3E2I A;  5HI7 A;  1M8C A;  1HJA I;  2A20 A;  3QTL D;  1IY6 A;  2JZM A;  2J87 A;  1KBE A;  1TBN A;  3D00 A;  3UEJ A;  2KMP A;  3UFF A;  2B8T A;  2QQC A;  1XBT A;  1KBF A;  3RU0 A;  1SGE I;  1RFH A;  2B0U C;  2GKR I;  2L7X A;  2K9H A;  3PDN A;  1SGR I;  4OVO A;  4B6D A;  2SGP I;  1H0Z A;  1SGD I;  2GKV A;  2JW6 A;  1OMU A;  2SGE I;  1OMT A;  2LEO A;  2QPO A;  5FUV A;  5DAE A;  3OXF A;  1YTP A;  2L8E A;  4SGB I;  4A24 A;  1CT0 I;  2E5R A;  1SGQ I;  1TUR A;  3FC3 A;  1W4R A;  1Y8F A;  2NU4 I;  5FUY A;  2P6A C;  2ROW A;  2W0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...