2GVIA

Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 51
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3320.10 Mainly Alpha Orthogonal Bundle pa2218 like fold pa2218 like domain 2gviA01
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gviA03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2gviA02
5IYZB 1OFUA 4X20B 5EZYA 4ZI7B 1RQ2A 5JVDA 4UXHA 3HKCA 3JARB 5CA0A 2ROWA 1XX6A 3HKEB 4I4TB 2DB6A 3RYHB 2J87A 5KX5B 2QPOA 4X1YA 5LA6B 2RHLA 4O4HB 3CXLA 4I55B 4ZOLA 5EIBC 3N2KA 1JFFA 3UGDA 1W59A 5EIBD 5GONB 4WBNA 4O4LB 2VAWA 2B8TA 1TUBB 4F6RB 5LYJB 3HKDB 3RYIB 1PTQA 5MN5A 5FUVA 1W5EA 4YJ3B 4DRXA 2UZ3A 4FFBA 1XA6A 4EB6B 4IIJA 5LOVB 5IJ0A 1PTRA 3JAKB 4O4JB 4O2BB 3WGJA 4B45A 5LP6B 4U3JA 4TV9A 1FAQA 4DXDA 5LXTA 2JA1A 4O4IA 1W5BA 5FUWA 5ITZB 5JQGB 4IHJB 2BTOA 1FFXB 2RHHA 5KMGA 3RYCA 5FNVB 1TVKA 3VOAA 2ENZA 3E22B 5J2UB 5C8YB 5JCOC 1FSZA 4I50B 3HKBB 4ZHQA 5BMVA 2Q1YA 3RYFB 5CA1B 3UFFA 1SA0B 3JASB 4YJ2A 1TBNA 3JAWB 4B46A 5EYPA 4LNUB 4X1IB 5CB4A 4O2AA 5IJ9B 3N2GA 3RYHA 1W5FA 3JALA 1XBTA 5EZYB 1W581 3JATA 5JH7A 5JVDB 3HKCB 5CA0B 4KWEA 2ELIA 5J2TA 4TV8A 4X1YB 4M8IA 3UT5A 2R751 1Y8FA 4ZOLB 5JCOA 1JFFB 4WBNB 4X1KA 1RQ7A 3BJIA 1RLUA 2ORWA 2WVJA 3WGNA 4TUYA 3UEYA 4E6EA 4DRXB 5IYZA 4HNAB 4IIJB 4X20A 4ZI7A 3WGKA 5IJ0B 2R6R1 5FUXA 4B6DA 5FUYA 2YUUA 3JARA 4TV9B 4U3JB 3HKEA 5LP6C 1KBEA 4I4TA 1W5AA 5LXTB 5KX5A 1KBFA 5LA6A 4FKDA 4O4IB 4O4HA 4I55A 5KMGB 3RYCB 5MN6A 5MN4A 5GONA 1W4RA 1FARA 4O4LA 3UGLA 2Q1XA 1TUBA 4F6RA 4ZHQB 5BMVB 5LYJA 3HKDA 4L9MA 3CB2A 4YJ2B 3RYIA 3N2KB 2QQEA 5EYPB 5CB4B 4O2AB 4U39A 4YJ3A 3N2GB 5LOVA 1R79A 4EB6A 3JALB 2E73A 3C8LA 2VAMA 3JAKA 4O2BA 4O4JA 5LP6A 3WGLA 3JATB 5JH7B 2J9RA 3VO8A 1RFHA 3E2IA 1Z5WA 2VXYA 2BTQB 4FFBB 5ITZA 5JQGA 3UEJA 2RHOA 1FFXA 4IHJA 4TV8B 3WGMA 2FNFX 5FNVA 5J2TB 3KY9A 4UXJA 3UT5B 2ORVA 4UXIA 3E22A 3UGIA 4X1KB 5C8YA 4I50A 2VRWB 3HKBA 3VOBA 5J2UA 2QQ0A 2GVIA 4HNAA 3RYFA 5CA1A 2RHJA 3JASA 1SA0A 1TVKB 3JAWA 5IJ9A 4LNUA 4X1IA 4TUYB 1TBOA 2VAPA 1Z5VA 2ENNA
chains in the Genus database with same CATH superfamily
2N52A 2B33A 2VGMA 2KMOA 1RQ2A 2QQDA 2B0UC 1X25A 3FBAA 1CLIA 4NQ3A 3JARB 5B8FA 1XX6A 4I4TB 1K9MH 3U0OA 5GAPK 1MT1A 2NU2I 2QPOA 1LR9A 5EB0A 2LUYA 2L7XA 3VYUC 1SGEI 2QQCA 2RIJA 2VAWA 3D01A 4O4LB 2JXDA 3NK6A 1TBRR 1IV1A 3KIZA 3LWRC 1LR7A 2CJSC 3HKDB 5FUVA 3FFMA 2F9ZC 5LOVB 4IIJA 1R1MA 1DBFA 4B45A 5LP6B 2YYEA 3R0PA 4U3JA 4DXDA 2UYNB 2CVLA 3HJWC 5HXZA 3HTNA 5FUWA 5KMGA 1FFXB 5FNVB 1VDDA 1QD9A 2KMPA 1TVKA 1V1IA 2GKTI 3VOAA 3E22B 4ZK7A 1N8RH 3SGBI 2CZWA 1UUCA 2DT4A 5CA1B 3UFFA 3JAWB 1YIJF 2AIFA 5EYPA 3F0GA 5CB4A 5EX3A 1W5FA 3JALA 1Z2IA 5EZYB 2GIVA 1HEVA 3QHDA 3I56F 1U3LA 3LWPC 1FYBA 3RE3A 2ELIA 1DS3I 1M8BA 2K1SA 4TV8A 3CPWF 2LBXA 1HDLA 1NMUB 2R751 1IPAA 1N13A 2UYJA 1Q7YH 1NJIH 1VQLF 1XHOA 4X1KA 1VQNF 1RLUA 2V53A 1U40A 1VQPF 3CPQA 2HP0A 3CCJF 2WVJA 3WGNA 3VMFB 1U5KA 3ZP7A 1X7PA 3S0WA 1OMUA 4BVQA 5J8CA 2NU0I 4A24A 3TD4A 1KMAA 2R6R1 3JCMM 4SGBI 3M1XA 3JARA 2N17A 2K9HA 1NQ3A 4TV9B 4I4TA 1T0AA 5LXTB 2UVOA 5HY0A 3OL0A 1PPFI 1FARA 3IEQA 3B4VC 4O4LA 3QUWA 5IT9M 3VYSC 1UHAA 5BMVB 2DIPA 4G4ZA 3V3TA 3HKDA 1SGNI 2SGFI 1V1HA 3CB2A 4YJ2B 2QQEA 4EI9A 1WKXA 5LOVA 1PF5A 3R5DA 4E1RA 2RC4A 1KQSF 1H7MA 5LP6A 1VQ5F 2SGPI 3V4DA 3OONA 2LB7A 2UYNA 2GKRI 3VO8A 1RFHA 3E2IA 1GZ0A 2M5XA 3CC7F 2VGNA 5G4VC 3UEJA 1T0KB 1FFXA 2FNFX 5FNVA 4UXJA 3UT5B 3V7EA 2OZBA 1AN1I 3E22A 3UGIA 1W41A 1U3PA 2VRWB 1KC8H 5CA1A 1TVKB 3JAWA 2OU2A 2YXZA 2VAPA 2ENNA 1H47A 5IYZB 5EZYA 1QU9A 3CCEF 3J80M 4DNCA 5EX0A 2CWGA 4UXHA 3UOEA 2ROWA 3HKEB 2OD1A 3CD6F 2J87A 5KX5B 3G71F 2ZVYA 2RHLA 2ZODA 2CSLA 4I55B 4BT7A 2HVYD 2ZOVA 5EIBC 3C9RA 3UGDA 1W59A 1YQNA 2QI2A 5EIBD 3VTIC 3CCQF 3I55F 4G4VA 1COMA 2IQQA 1VQOF 2SGDI 3GOXA 3O85A 4C8EA 4C8IA 1NUBA 2IG8A 4G4WA 4G88A 3P0ZA 5HP7A 1XA6A 3R5BA 3I3FA 3P4EA 3QTYA 3ZOPA 3PDNA 3S03A 3JAKB 4O2BB 3WGJA 3S0YA 3NVKE 3R5AA 2AIZP 4TV9A 2E5RA 5LXTA 2X3TA 1W42A 3CYQA 1W5BA 1QAHA 2Z1UA 2BTOA 2RHHA 2MQEA 3B6NA 3WXMB 2V1CC 3R5CA 3F0DA 4BVRA 3C9TA 3TO6A 5J2UB 5C8YB 1FSZA 4AMLA 5BMVA 3RA5A 5JHWC 1SA0B 4YJ2A 3HH2C 1KD1H 3KE1A 1YGYA 4LNUB 1BMOA 4X1IB 1S20A 2JNBA 1VQMF 3TO7A 3V7QA 4WP4A 1VQ7F 5G4UC 1ULNA 2KTVA 5JVDB 3CMEF 5A2QM 5HY4A 1CT2I 2WCYA 5EO3A 2NMUA 4X1YB 3UT5A 5JCOA 1Y8FA 3D54A 3NVIB 1SGYI 1IW4A 3F0EA 3BJIA 1SGDI 1YTPA 3K0TA 2W8BC 1KNJA 1OYVI 1TBQR 3F6MA 1TURA 3OXLA 2OHWA 5IYZA 1DT9A 2HS3A 4R40B 2GLZA 5HWEA 5J8FA 2YUUA 3CCVF 2SGQI 3IR9A 1K73H 3HKEA 2QEXF 3EORA 1UFYA 5KX5A 3M4SA 4FKDA 4O4IB 4I55A 3N4YA 2SGEI 5MN6A 3TOAA 1RLGA 2FC3A 3UGLA 2CWFA 2Q1XA 3AGKA 4BW0B 2ODDA 2I6RA 4ZHQB 3I7TA 1VQKF 1M8CA 3TD3A 4L9MA 3IKFA 1VK3A 2Y0MA 3IEWA 2KMRA 3D00A 1M1KH 1TUSA 3VI6A 1MJ9A 3JAKA 3GTZA 4O2BA 4EI8A 3RA6A 5FLXM 1Q81H 3JATB 1JN1A 5JH7B 3WJRA 3ON1A 2X52A 3MCAB 3DDNA 5EAZA 5J2UA 3WJQA 1Q8RA 5C8YA 4NWOB 2PQ8A 5DAEA 3G6EF 4HNAA 1SA0A 3PLAC 3SGQI 3PAFA 4LNUA 4TUYB 4X1IA 1OVOA 2Z1TA 2KTUA 1Z5VA 5FJ4C 3IMPA 1NXUA 2CHSA 4X20B 4ZI7B 2RB9A 5JVDA 1CK2A 3E1YA 3L7QA 4B5CA 1OAPA 1H0ZA 5HP8A 1FY7A 4X1YA 1VQ9F 1SGQI 3SIVA 4ZHVA 1FNKA 3LFOA 1QVGF 2BTUA 3C9UA 5GIOC 5GONB 3MBMA 2I6DA 4PWTA 1XBIA 3WJPA 4X3LA 4BT5A 3RYIB 3LMEA 2DYYA 3JAMM 1PTQA 1W5EA 3LYBA 4YJ3B 1CGII 2KMQA 2FGYA 3VYTC 5GIPC 2ARPF 3VDPA 1PTRA 1PXWA 4O4JB 2AMTA 1Q86H 2YQPA 1S72F 3CYPB 1PCEA 9WGAA 1JJ2F 1Q82H 4O4IA 4LCKA 1UVGA 1UI9A 2UYPA 5E3QA 4IHJB 1JD1A 5GANK 1CSOI 1CN7A 1VQ4F 3TO9A 4ZHQA 3FPIA 3RYFB 3FD6A 3K14A 5HXUA 1TBNA 3GYQA 5EB1B 4B46A 5IJ9B 3RYHA 3VIUA 1XBTA 2N1AB 3CXCF 3G4SF 2A20A 2BO1A 1Q9BA 3JATA 5JH7A 3CCMF 4BY9D 3WPXA 3HKCB 1PJUA 5CA0B 4KWEA 4NUTA 3CMAF 1IV2A 1K7UA 2BUSA 5CCLA 3JVHA 2GZLA 1P9GA 4ZOLB 1JFFB 1VQVA 1WGCA 1RQ7A 4WBNB 2JZMA 1Y1CA 5DCVA 3VCZA 4BVSA 4E1PA 5CCMA 4TUYA 4JCVE 1CGJI 1GX1A 1XV2A 2P6AC 4DRXB 3HWUA 1YHQF 4HNAB 4X20A 4ZI7A 5IJ0B 3WGKA 5FUXA 4BT3A 5FUYA 3CC2F 4MPIA 3LWOC 2JYYA 2NU4I 2ZAUA 1KBEA 3ELCA 5LP6C 3CCLF 1K8AH 5E3PA 3GHZA 1KBFA 2KCXA 3TOBA 2HS0A 4BVTA 3RYCB 2QTPA 1SGRI 4ZHWA 5EWRA 5GONA 1W4RA 1SDSA 1IV3A 2XRCA 5E3RA 2OVOA 3RU0A 1CT0I 1U43A 3RYIA 4EI7A 2OTJF 1HJAI 3ZO8A 4O2AB 3SIUA 4YJ3A 3N2GB 1R79A 1Y1BA 1LR8A 4O4JA 4RQOA 3S02A 3WGLA 1W3SA 4OVOA 2Z1FA 4BT4A 1X74A 1WGTA 2H6LA 2PMPA 2VXYA 2Z1EA 2BTQB 4RHAA 1YJ9F 1W57A 2ZF8A 3N4ZA 4IHJA 1ODEA 2ALEA 2L26A 3S06A 3WGMA 5J2TB 3KY9A 1YU6C 4C4WC 1UVFA 1X4SA 2ORVA 4UXIA 1VHAA 1M90H 2QQ0A 3J7AR 3NMUC 3RYFA 2RHJA 2NU1I 1VQ6F 5HQ8A 5IJ9A 3E20B 2LCAA 4X3MA 1TBOA 2LEOA 2HP3A 2HRUA 4G4XA 1OFUA 1VH8A 1ONIA 1YJWF 3SEKC 3BYQA 2Z01A 2P6YA 3HKCA 5CA0A 3OW2F 2DB6A 1CT4I 3RYHB 1RA4A 2HQSC 5LA6B 4O4HB 3CXLA 3MQWA 4ZOLA 1K7TA 3N2KA 1CHOI 1JFFA 4WBNA 2GKVA 1IY5A 2B8TA 1TUBB 4C82A 3ZP4A 4F6RB 5HY2A 3LDTA 1CE3A 4G4YA 7WGAA 3NK7A 2LBWA 5LYJB 3FSYA 2OTMA 5MN5A 3MCQA 3HAXD 1X7OA 1OMTA 4DRXA 1YJNF 2UZ3A 4FFBA 4EB6B 4B62A 5IJ0A 1SGPI 3K12A 1GO0A 1XRGA 2HS4A 3LWQC 1FAQA 2V9YA 2ZVZA 2JA1A 1W55A 5ITZB 5JQGB 3KHNA 3RYCA 2G9IA 2ENZA 1W2BF 3FC3A 1ZWZA 3WPWA 4I50B 5JCOC 3HKBB 2QA4F 1P9ZA 2NU3I 2Q1YA 2UYKA 3JASB 3CCRF 2OZUA 1WTJA 4O2AA 1J7HA 3N2GA 1H48A 3TD5A 2EWCA 2HRYA 3M84A 2H8CA 1TOTA 4ZHYB 1YITF 3CG6A 3QTLD 1W581 3IKEA 3P10A 1HPTA 3J81M 2LBTA 1BUSA 1JY8A 3QAHA 1IY6A 3T80A 1K7VA 2IAFA 5J2TA 1W40A 2V1CA 3OXGA 4M8IA 4XCQA 3FD5A 2ERWA 2N71A 1IV4A 2HX0A 5AVMA 2ORWA 3TJQA 1X52A 3KJJA 3UEYA 4E6EA 3CCUF 1TGSI 1KNKA 2JW6A 2W0TA 3ERNA 3KJKA 2CW4A 4IIJB 5GINC 4B6DA 3E59A 4U3JB 1MJAA 2L8EA 2CHTA 1W5AA 1E7KA 3S0HA 4HGUA 1FNJA 3FSXA 5LA6A 4O4HA 1TIHA 3VDUA 3Q8HA 5KMGB 4BT2A 4C81A 5MN4A 1YI2F 1VQ8F 3DC2A 3MDOA 2PHNA 4TZZA 2CWJA 1TUBA 1R0RI 3QWPA 2H8EA 4F6RA 5HI7A 1MJBA 4GI3C 3C9SA 2CWHA 5LYJA 3N2KB 1SZQA 5EYPB 3OVOA 5CB4B 4U39A 3CCSF 4EB6A 3JALB 2E73A 4C8GA 2N48A 3C8LA 2VAMA 2DKVA 4ERHA 4BT6A 2J9RA 2KG4A 1ULKA 1Z5WA 3VE5A 2F3CI 4FFBB 1ULMA 5ITZA 5JQGA 3OBWA 2RHOA 3LWVC 3ESJA 4TV8B 5HY1A 2UZHA 3OXFA 1Z7KB 1QVFF 4X1KB 3VOBA 1GO1A 4I50A 3HKBA 1DS2I 2GVIA 1W3EX 3F0FA 3K2XA 3JASA 2HP0B 3CC4F 3MEKA 2KGWA 3OBYA 2OTLF 2WALA 2WGCA
chains in the Genus database with same CATH topology
2N52A 2KMOA 1RQ2A 2QQDA 2B0UC 3JARB 1XX6A 4I4TB 1MT1A 2NU2I 2QPOA 1LR9A 2LUYA 2L7XA 1SGEI 2QQCA 4O4LB 2VAWA 2JXDA 1TBRR 1LR7A 2CJSC 3HKDB 5FUVA 5LOVB 4IIJA 4B45A 5LP6B 4U3JA 4DXDA 5FUWA 5KMGA 1FFXB 5FNVB 1VDDA 1TVKA 2KMPA 1V1IA 2GKTI 3VOAA 3E22B 3SGBI 1UUCA 5CA1B 3UFFA 3JAWB 5EYPA 5CB4A 5EX3A 1W5FA 3JALA 5EZYB 1FYBA 2ELIA 1DS3I 1M8BA 4TV8A 1HDLA 2R751 1N13A 4X1KA 1RLUA 2V53A 2WVJA 3WGNA 1U5KA 1OMUA 2NU0I 4A24A 1KMAA 2R6R1 4SGBI 3JARA 2N17A 2K9HA 4TV9B 4I4TA 5LXTB 3OL0A 1PPFI 1FARA 3B4VC 4O4LA 5BMVB 2DIPA 3HKDA 1SGNI 2SGFI 1V1HA 3CB2A 4YJ2B 2QQEA 5LOVA 4E1RA 5LP6A 2SGPI 2GKRI 3VO8A 1RFHA 3E2IA 2M5XA 3UEJA 1FFXA 2FNFX 5FNVA 4UXJA 3UT5B 1AN1I 3E22A 3UGIA 2VRWB 5CA1A 1TVKB 3JAWA 2VAPA 2ENNA 5IYZB 5EZYA 5EX0A 4UXHA 2ROWA 3HKEB 2OD1A 2J87A 5KX5B 2RHLA 4I55B 5EIBC 3UGDA 1W59A 5EIBD 2SGDI 3GOXA 1NUBA 1XA6A 3PDNA 3JAKB 4O2BB 3WGJA 4TV9A 2E5RA 5LXTA 1W5BA 2BTOA 2RHHA 2V1CC 5J2UB 5C8YB 1FSZA 5BMVA 5JHWC 1SA0B 4YJ2A 3HH2C 4LNUB 1BMOA 4X1IB 5JVDB 1CT2I 2WCYA 4X1YB 3UT5A 5JCOA 1Y8FA 1SGYI 1IW4A 3BJIA 1SGDI 1YTPA 1OYVI 1TBQR 1TURA 3OXLA 5IYZA 2YUUA 2SGQI 3HKEA 5KX5A 4FKDA 4O4IB 4I55A 2SGEI 5MN6A 3UGLA 2Q1XA 2ODDA 4ZHQB 1M8CA 4L9MA 2KMRA 3D00A 1TUSA 3JAKA 4O2BA 3JATB 5JH7B 5J2UA 5C8YA 5DAEA 4HNAA 1SA0A 3SGQI 4LNUA 4TUYB 4X1IA 1OVOA 1Z5VA 4X20B 4ZI7B 5JVDA 1H0ZA 4X1YA 1SGQI 5GONB 3RYIB 1PTQA 1W5EA 4YJ3B 1CGII 2KMQA 2ARPF 3VDPA 1PTRA 4O4JB 2YQPA 1PCEA 4O4IA 1UVGA 4IHJB 1CSOI 4ZHQA 3RYFB 1TBNA 4B46A 5IJ9B 3RYHA 1XBTA 2N1AB 2A20A 3JATA 5JH7A 3HKCB 1PJUA 5CA0B 4KWEA 2BUSA 5CCLA 4ZOLB 1JFFB 4WBNB 1RQ7A 2JZMA 1Y1CA 4E1PA 5CCMA 4TUYA 4JCVE 1CGJI 2P6AC 4DRXB 4HNAB 4X20A 4ZI7A 5IJ0B 3WGKA 5FUXA 5FUYA 2JYYA 2NU4I 5LP6C 1KBEA 1KBFA 2KCXA 3RYCB 1SGRI 5GONA 1W4RA 2XRCA 2OVOA 3RU0A 1CT0I 3RYIA 1HJAI 4O2AB 4YJ3A 3N2GB 1R79A 1Y1BA 1LR8A 4O4JA 3WGLA 1W3SA 4OVOA 1X74A 2VXYA 2BTQB 4IHJA 5J2TB 3WGMA 3KY9A 1YU6C 1UVFA 1X4SA 2ORVA 4UXIA 2QQ0A 3RYFA 2RHJA 2NU1I 5HQ8A 5IJ9A 1TBOA 2LEOA 1OFUA 3SEKC 3HKCA 5CA0A 2DB6A 1CT4I 3RYHB 5LA6B 4O4HB 3CXLA 4ZOLA 3N2KA 1CHOI 1JFFA 4WBNA 2GKVA 1IY5A 2B8TA 1TUBB 4F6RB 1CE3A 5LYJB 5MN5A 1OMTA 4DRXA 2UZ3A 4FFBA 4EB6B 5IJ0A 1SGPI 1FAQA 2JA1A 5ITZB 5JQGB 3RYCA 2ENZA 3FC3A 5JCOC 4I50B 3HKBB 2NU3I 2Q1YA 3JASB 4O2AA 3N2GA 1TOTA 3QTLD 1W581 1HPTA 1BUSA 1IY6A 5J2TA 2V1CA 3OXGA 4M8IA 2ERWA 2N71A 2ORWA 3TJQA 4E6EA 3UEYA 1TGSI 2JW6A 2W0TA 4IIJB 4B6DA 3E59A 4U3JB 2L8EA 1W5AA 4HGUA 5LA6A 4O4HA 1TIHA 3VDUA 5KMGB 5MN4A 1TUBA 1R0RI 3QWPA 4F6RA 5HI7A 4GI3C 5LYJA 3N2KB 5EYPB 3OVOA 5CB4B 4U39A 4EB6A 3JALB 2E73A 3C8LA 2VAMA 2J9RA 1Z5WA 3VE5A 2F3CI 4FFBB 5ITZA 5JQGA 2RHOA 4TV8B 3OXFA 1Z7KB 4X1KB 3VOBA 4I50A 3HKBA 1DS2I 2GVIA 3JASA 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYZ B;  1OFU A;  4X20 B;  5EZY A;  4ZI7 B;  1RQ2 A;  5JVD A;  4UXH A;  3HKC A;  3JAR B;  5CA0 A;  2ROW A;  1XX6 A;  3HKE B;  4I4T B;  2DB6 A;  3RYH B;  2J87 A;  5KX5 B;  2QPO A;  4X1Y A;  5LA6 B;  2RHL A;  4O4H B;  3CXL A;  4I55 B;  4ZOL A;  5EIB C;  3N2K A;  1JFF A;  3UGD A;  1W59 A;  5EIB D;  5GON B;  4WBN A;  4O4L B;  2VAW A;  2B8T A;  1TUB B;  4F6R B;  5LYJ B;  3HKD B;  3RYI B;  1PTQ A;  5MN5 A;  5FUV A;  1W5E A;  4YJ3 B;  4DRX A;  2UZ3 A;  4FFB A;  1XA6 A;  4EB6 B;  4IIJ A;  5LOV B;  5IJ0 A;  1PTR A;  3JAK B;  4O4J B;  4O2B B;  3WGJ A;  4B45 A;  5LP6 B;  4U3J A;  4TV9 A;  1FAQ A;  4DXD A;  5LXT A;  2JA1 A;  4O4I A;  1W5B A;  5FUW A;  5ITZ B;  5JQG B;  4IHJ B;  2BTO A;  1FFX B;  2RHH A;  5KMG A;  3RYC A;  5FNV B;  1TVK A;  3VOA A;  2ENZ A;  3E22 B;  5J2U B;  5C8Y B;  5JCO C;  1FSZ A;  4I50 B;  3HKB B;  4ZHQ A;  5BMV A;  2Q1Y A;  3RYF B;  5CA1 B;  3UFF A;  1SA0 B;  3JAS B;  4YJ2 A;  1TBN A;  3JAW B;  4B46 A;  5EYP A;  4LNU B;  4X1I B;  5CB4 A;  4O2A A;  5IJ9 B;  3N2G A;  3RYH A;  1W5F A;  3JAL A;  1XBT A;  5EZY B;  1W58 1;  3JAT A;  5JH7 A;  5JVD B;  3HKC B;  5CA0 B;  4KWE A;  2ELI A;  5J2T A;  4TV8 A;  4X1Y B;  4M8I A;  3UT5 A;  2R75 1;  1Y8F A;  4ZOL B;  5JCO A;  1JFF B;  4WBN B;  4X1K A;  1RQ7 A;  3BJI A;  1RLU A;  2ORW A;  2WVJ A;  3WGN A;  4TUY A;  3UEY A;  4E6E A;  4DRX B;  5IYZ A;  4HNA B;  4IIJ B;  4X20 A;  4ZI7 A;  3WGK A;  5IJ0 B;  2R6R 1;  5FUX A;  4B6D A;  5FUY A;  2YUU A;  3JAR A;  4TV9 B;  4U3J B;  3HKE A;  5LP6 C;  1KBE A;  4I4T A;  1W5A A;  5LXT B;  5KX5 A;  1KBF A;  5LA6 A;  4FKD A;  4O4I B;  4O4H A;  4I55 A;  5KMG B;  3RYC B;  5MN6 A;  5MN4 A;  5GON A;  1W4R A;  1FAR A;  4O4L A;  3UGL A;  2Q1X A;  1TUB A;  4F6R A;  4ZHQ B;  5BMV B;  5LYJ A;  3HKD A;  4L9M A;  3CB2 A;  4YJ2 B;  3RYI A;  3N2K B;  2QQE A;  5EYP B;  5CB4 B;  4O2A B;  4U39 A;  4YJ3 A;  3N2G B;  5LOV A;  1R79 A;  4EB6 A;  3JAL B;  2E73 A;  3C8L A;  2VAM A;  3JAK A;  4O2B A;  4O4J A;  5LP6 A;  3WGL A;  3JAT B;  5JH7 B;  2J9R A;  3VO8 A;  1RFH A;  3E2I A;  1Z5W A;  2VXY A;  2BTQ B;  4FFB B;  5ITZ A;  5JQG A;  3UEJ A;  2RHO A;  1FFX A;  4IHJ A;  4TV8 B;  3WGM A;  2FNF X;  5FNV A;  5J2T B;  3KY9 A;  4UXJ A;  3UT5 B;  2ORV A;  4UXI A;  3E22 A;  3UGI A;  4X1K B;  5C8Y A;  4I50 A;  2VRW B;  3HKB A;  3VOB A;  5J2U A;  2QQ0 A;  2GVI A;  4HNA A;  3RYF A;  5CA1 A;  2RHJ A;  3JAS A;  1SA0 A;  1TVK B;  3JAW A;  5IJ9 A;  4LNU A;  4X1I A;  4TUY B;  1TBO A;  2VAP A;  1Z5V A;  2ENN A; 
#chains in the Genus database with same CATH topology
 2N52 A;  2B33 A;  2VGM A;  2KMO A;  1RQ2 A;  2QQD A;  2B0U C;  1X25 A;  3FBA A;  1CLI A;  4NQ3 A;  3JAR B;  5B8F A;  1XX6 A;  4I4T B;  1K9M H;  3U0O A;  5GAP K;  1MT1 A;  2NU2 I;  2QPO A;  1LR9 A;  5EB0 A;  2LUY A;  2L7X A;  3VYU C;  1SGE I;  2QQC A;  2RIJ A;  2VAW A;  3D01 A;  4O4L B;  2JXD A;  3NK6 A;  1TBR R;  1IV1 A;  3KIZ A;  3LWR C;  1LR7 A;  2CJS C;  3HKD B;  5FUV A;  3FFM A;  2F9Z C;  5LOV B;  4IIJ A;  1R1M A;  1DBF A;  4B45 A;  5LP6 B;  2YYE A;  3R0P A;  4U3J A;  4DXD A;  2UYN B;  2CVL A;  3HJW C;  5HXZ A;  3HTN A;  5FUW A;  5KMG A;  1FFX B;  5FNV B;  1VDD A;  1QD9 A;  2KMP A;  1TVK A;  1V1I A;  2GKT I;  3VOA A;  3E22 B;  4ZK7 A;  1N8R H;  3SGB I;  2CZW A;  1UUC A;  2DT4 A;  5CA1 B;  3UFF A;  3JAW B;  1YIJ F;  2AIF A;  5EYP A;  3F0G A;  5CB4 A;  5EX3 A;  1W5F A;  3JAL A;  1Z2I A;  5EZY B;  2GIV A;  1HEV A;  3QHD A;  3I56 F;  1U3L A;  3LWP C;  1FYB A;  3RE3 A;  2ELI A;  1DS3 I;  1M8B A;  2K1S A;  4TV8 A;  3CPW F;  2LBX A;  1HDL A;  1NMU B;  2R75 1;  1IPA A;  1N13 A;  2UYJ A;  1Q7Y H;  1NJI H;  1VQL F;  1XHO A;  4X1K A;  1VQN F;  1RLU A;  2V53 A;  1U40 A;  1VQP F;  3CPQ A;  2HP0 A;  3CCJ F;  2WVJ A;  3WGN A;  3VMF B;  1U5K A;  3ZP7 A;  1X7P A;  3S0W A;  1OMU A;  4BVQ A;  5J8C A;  2NU0 I;  4A24 A;  3TD4 A;  1KMA A;  2R6R 1;  3JCM M;  4SGB I;  3M1X A;  3JAR A;  2N17 A;  2K9H A;  1NQ3 A;  4TV9 B;  4I4T A;  1T0A A;  5LXT B;  2UVO A;  5HY0 A;  3OL0 A;  1PPF I;  1FAR A;  3IEQ A;  3B4V C;  4O4L A;  3QUW A;  5IT9 M;  3VYS C;  1UHA A;  5BMV B;  2DIP A;  4G4Z A;  3V3T A;  3HKD A;  1SGN I;  2SGF I;  1V1H A;  3CB2 A;  4YJ2 B;  2QQE A;  4EI9 A;  1WKX A;  5LOV A;  1PF5 A;  3R5D A;  4E1R A;  2RC4 A;  1KQS F;  1H7M A;  5LP6 A;  1VQ5 F;  2SGP I;  3V4D A;  3OON A;  2LB7 A;  2UYN A;  2GKR I;  3VO8 A;  1RFH A;  3E2I A;  1GZ0 A;  2M5X A;  3CC7 F;  2VGN A;  5G4V C;  3UEJ A;  1T0K B;  1FFX A;  2FNF X;  5FNV A;  4UXJ A;  3UT5 B;  3V7E A;  2OZB A;  1AN1 I;  3E22 A;  3UGI A;  1W41 A;  1U3P A;  2VRW B;  1KC8 H;  5CA1 A;  1TVK B;  3JAW A;  2OU2 A;  2YXZ A;  2VAP A;  2ENN A;  1H47 A;  5IYZ B;  5EZY A;  1QU9 A;  3CCE F;  3J80 M;  4DNC A;  5EX0 A;  2CWG A;  4UXH A;  3UOE A;  2ROW A;  3HKE B;  2OD1 A;  3CD6 F;  2J87 A;  5KX5 B;  3G71 F;  2ZVY A;  2RHL A;  2ZOD A;  2CSL A;  4I55 B;  4BT7 A;  2HVY D;  2ZOV A;  5EIB C;  3C9R A;  3UGD A;  1W59 A;  1YQN A;  2QI2 A;  5EIB D;  3VTI C;  3CCQ F;  3I55 F;  4G4V A;  1COM A;  2IQQ A;  1VQO F;  2SGD I;  3GOX A;  3O85 A;  4C8E A;  4C8I A;  1NUB A;  2IG8 A;  4G4W A;  4G88 A;  3P0Z A;  5HP7 A;  1XA6 A;  3R5B A;  3I3F A;  3P4E A;  3QTY A;  3ZOP A;  3PDN A;  3S03 A;  3JAK B;  4O2B B;  3WGJ A;  3S0Y A;  3NVK E;  3R5A A;  2AIZ P;  4TV9 A;  2E5R A;  5LXT A;  2X3T A;  1W42 A;  3CYQ A;  1W5B A;  1QAH A;  2Z1U A;  2BTO A;  2RHH A;  2MQE A;  3B6N A;  3WXM B;  2V1C C;  3R5C A;  3F0D A;  4BVR A;  3C9T A;  3TO6 A;  5J2U B;  5C8Y B;  1FSZ A;  4AML A;  5BMV A;  3RA5 A;  5JHW C;  1SA0 B;  4YJ2 A;  3HH2 C;  1KD1 H;  3KE1 A;  1YGY A;  4LNU B;  1BMO A;  4X1I B;  1S20 A;  2JNB A;  1VQM F;  3TO7 A;  3V7Q A;  4WP4 A;  1VQ7 F;  5G4U C;  1ULN A;  2KTV A;  5JVD B;  3CME F;  5A2Q M;  5HY4 A;  1CT2 I;  2WCY A;  5EO3 A;  2NMU A;  4X1Y B;  3UT5 A;  5JCO A;  1Y8F A;  3D54 A;  3NVI B;  1SGY I;  1IW4 A;  3F0E A;  3BJI A;  1SGD I;  1YTP A;  3K0T A;  2W8B C;  1KNJ A;  1OYV I;  1TBQ R;  3F6M A;  1TUR A;  3OXL A;  2OHW A;  5IYZ A;  1DT9 A;  2HS3 A;  4R40 B;  2GLZ A;  5HWE A;  5J8F A;  2YUU A;  3CCV F;  2SGQ I;  3IR9 A;  1K73 H;  3HKE A;  2QEX F;  3EOR A;  1UFY A;  5KX5 A;  3M4S A;  4FKD A;  4O4I B;  4I55 A;  3N4Y A;  2SGE I;  5MN6 A;  3TOA A;  1RLG A;  2FC3 A;  3UGL A;  2CWF A;  2Q1X A;  3AGK A;  4BW0 B;  2ODD A;  2I6R A;  4ZHQ B;  3I7T A;  1VQK F;  1M8C A;  3TD3 A;  4L9M A;  3IKF A;  1VK3 A;  2Y0M A;  3IEW A;  2KMR A;  3D00 A;  1M1K H;  1TUS A;  3VI6 A;  1MJ9 A;  3JAK A;  3GTZ A;  4O2B A;  4EI8 A;  3RA6 A;  5FLX M;  1Q81 H;  3JAT B;  1JN1 A;  5JH7 B;  3WJR A;  3ON1 A;  2X52 A;  3MCA B;  3DDN A;  5EAZ A;  5J2U A;  3WJQ A;  1Q8R A;  5C8Y A;  4NWO B;  2PQ8 A;  5DAE A;  3G6E F;  4HNA A;  1SA0 A;  3PLA C;  3SGQ I;  3PAF A;  4LNU A;  4TUY B;  4X1I A;  1OVO A;  2Z1T A;  2KTU A;  1Z5V A;  5FJ4 C;  3IMP A;  1NXU A;  2CHS A;  4X20 B;  4ZI7 B;  2RB9 A;  5JVD A;  1CK2 A;  3E1Y A;  3L7Q A;  4B5C A;  1OAP A;  1H0Z A;  5HP8 A;  1FY7 A;  4X1Y A;  1VQ9 F;  1SGQ I;  3SIV A;  4ZHV A;  1FNK A;  3LFO A;  1QVG F;  2BTU A;  3C9U A;  5GIO C;  5GON B;  3MBM A;  2I6D A;  4PWT A;  1XBI A;  3WJP A;  4X3L A;  4BT5 A;  3RYI B;  3LME A;  2DYY A;  3JAM M;  1PTQ A;  1W5E A;  3LYB A;  4YJ3 B;  1CGI I;  2KMQ A;  2FGY A;  3VYT C;  5GIP C;  2ARP F;  3VDP A;  1PTR A;  1PXW A;  4O4J B;  2AMT A;  1Q86 H;  2YQP A;  1S72 F;  3CYP B;  1PCE A;  9WGA A;  1JJ2 F;  1Q82 H;  4O4I A;  4LCK A;  1UVG A;  1UI9 A;  2UYP A;  5E3Q A;  4IHJ B;  1JD1 A;  5GAN K;  1CSO I;  1CN7 A;  1VQ4 F;  3TO9 A;  4ZHQ A;  3FPI A;  3RYF B;  3FD6 A;  3K14 A;  5HXU A;  1TBN A;  3GYQ A;  5EB1 B;  4B46 A;  5IJ9 B;  3RYH A;  3VIU A;  1XBT A;  2N1A B;  3CXC F;  3G4S F;  2A20 A;  2BO1 A;  1Q9B A;  3JAT A;  5JH7 A;  3CCM F;  4BY9 D;  3WPX A;  3HKC B;  1PJU A;  5CA0 B;  4KWE A;  4NUT A;  3CMA F;  1IV2 A;  1K7U A;  2BUS A;  5CCL A;  3JVH A;  2GZL A;  1P9G A;  4ZOL B;  1JFF B;  1VQV A;  1WGC A;  1RQ7 A;  4WBN B;  2JZM A;  1Y1C A;  5DCV A;  3VCZ A;  4BVS A;  4E1P A;  5CCM A;  4TUY A;  4JCV E;  1CGJ I;  1GX1 A;  1XV2 A;  2P6A C;  4DRX B;  3HWU A;  1YHQ F;  4HNA B;  4X20 A;  4ZI7 A;  5IJ0 B;  3WGK A;  5FUX A;  4BT3 A;  5FUY A;  3CC2 F;  4MPI A;  3LWO C;  2JYY A;  2NU4 I;  2ZAU A;  1KBE A;  3ELC A;  5LP6 C;  3CCL F;  1K8A H;  5E3P A;  3GHZ A;  1KBF A;  2KCX A;  3TOB A;  2HS0 A;  4BVT A;  3RYC B;  2QTP A;  1SGR I;  4ZHW A;  5EWR A;  5GON A;  1W4R A;  1SDS A;  1IV3 A;  2XRC A;  5E3R A;  2OVO A;  3RU0 A;  1CT0 I;  1U43 A;  3RYI A;  4EI7 A;  2OTJ F;  1HJA I;  3ZO8 A;  4O2A B;  3SIU A;  4YJ3 A;  3N2G B;  1R79 A;  1Y1B A;  1LR8 A;  4O4J A;  4RQO A;  3S02 A;  3WGL A;  1W3S A;  4OVO A;  2Z1F A;  4BT4 A;  1X74 A;  1WGT A;  2H6L A;  2PMP A;  2VXY A;  2Z1E A;  2BTQ B;  4RHA A;  1YJ9 F;  1W57 A;  2ZF8 A;  3N4Z A;  4IHJ A;  1ODE A;  2ALE A;  2L26 A;  3S06 A;  3WGM A;  5J2T B;  3KY9 A;  1YU6 C;  4C4W C;  1UVF A;  1X4S A;  2ORV A;  4UXI A;  1VHA A;  1M90 H;  2QQ0 A;  3J7A R;  3NMU C;  3RYF A;  2RHJ A;  2NU1 I;  1VQ6 F;  5HQ8 A;  5IJ9 A;  3E20 B;  2LCA A;  4X3M A;  1TBO A;  2LEO A;  2HP3 A;  2HRU A;  4G4X A;  1OFU A;  1VH8 A;  1ONI A;  1YJW F;  3SEK C;  3BYQ A;  2Z01 A;  2P6Y A;  3HKC A;  5CA0 A;  3OW2 F;  2DB6 A;  1CT4 I;  3RYH B;  1RA4 A;  2HQS C;  5LA6 B;  4O4H B;  3CXL A;  3MQW A;  4ZOL A;  1K7T A;  3N2K A;  1CHO I;  1JFF A;  4WBN A;  2GKV A;  1IY5 A;  2B8T A;  1TUB B;  4C82 A;  3ZP4 A;  4F6R B;  5HY2 A;  3LDT A;  1CE3 A;  4G4Y A;  7WGA A;  3NK7 A;  2LBW A;  5LYJ B;  3FSY A;  2OTM A;  5MN5 A;  3MCQ A;  3HAX D;  1X7O A;  1OMT A;  4DRX A;  1YJN F;  2UZ3 A;  4FFB A;  4EB6 B;  4B62 A;  5IJ0 A;  1SGP I;  3K12 A;  1GO0 A;  1XRG A;  2HS4 A;  3LWQ C;  1FAQ A;  2V9Y A;  2ZVZ A;  2JA1 A;  1W55 A;  5ITZ B;  5JQG B;  3KHN A;  3RYC A;  2G9I A;  2ENZ A;  1W2B F;  3FC3 A;  1ZWZ A;  3WPW A;  4I50 B;  5JCO C;  3HKB B;  2QA4 F;  1P9Z A;  2NU3 I;  2Q1Y A;  2UYK A;  3JAS B;  3CCR F;  2OZU A;  1WTJ A;  4O2A A;  1J7H A;  3N2G A;  1H48 A;  3TD5 A;  2EWC A;  2HRY A;  3M84 A;  2H8C A;  1TOT A;  4ZHY B;  1YIT F;  3CG6 A;  3QTL D;  1W58 1;  3IKE A;  3P10 A;  1HPT A;  3J81 M;  2LBT A;  1BUS A;  1JY8 A;  3QAH A;  1IY6 A;  3T80 A;  1K7V A;  2IAF A;  5J2T A;  1W40 A;  2V1C A;  3OXG A;  4M8I A;  4XCQ A;  3FD5 A;  2ERW A;  2N71 A;  1IV4 A;  2HX0 A;  5AVM A;  2ORW A;  3TJQ A;  1X52 A;  3KJJ A;  3UEY A;  4E6E A;  3CCU F;  1TGS I;  1KNK A;  2JW6 A;  2W0T A;  3ERN A;  3KJK A;  2CW4 A;  4IIJ B;  5GIN C;  4B6D A;  3E59 A;  4U3J B;  1MJA A;  2L8E A;  2CHT A;  1W5A A;  1E7K A;  3S0H A;  4HGU A;  1FNJ A;  3FSX A;  5LA6 A;  4O4H A;  1TIH A;  3VDU A;  3Q8H A;  5KMG B;  4BT2 A;  4C81 A;  5MN4 A;  1YI2 F;  1VQ8 F;  3DC2 A;  3MDO A;  2PHN A;  4TZZ A;  2CWJ A;  1TUB A;  1R0R I;  3QWP A;  2H8E A;  4F6R A;  5HI7 A;  1MJB A;  4GI3 C;  3C9S A;  2CWH A;  5LYJ A;  3N2K B;  1SZQ A;  5EYP B;  3OVO A;  5CB4 B;  4U39 A;  3CCS F;  4EB6 A;  3JAL B;  2E73 A;  4C8G A;  2N48 A;  3C8L A;  2VAM A;  2DKV A;  4ERH A;  4BT6 A;  2J9R A;  2KG4 A;  1ULK A;  1Z5W A;  3VE5 A;  2F3C I;  4FFB B;  1ULM A;  5ITZ A;  5JQG A;  3OBW A;  2RHO A;  3LWV C;  3ESJ A;  4TV8 B;  5HY1 A;  2UZH A;  3OXF A;  1Z7K B;  1QVF F;  4X1K B;  3VOB A;  1GO1 A;  4I50 A;  3HKB A;  1DS2 I;  2GVI A;  1W3E X;  3F0F A;  3K2X A;  3JAS A;  2HP0 B;  3CC4 F;  3MEK A;  2KGW A;  3OBY A;  2OTL F;  2WAL A;  2WGC A; 
#chains in the Genus database with same CATH homology
 2N52 A;  2KMO A;  1RQ2 A;  2QQD A;  2B0U C;  3JAR B;  1XX6 A;  4I4T B;  1MT1 A;  2NU2 I;  2QPO A;  1LR9 A;  2LUY A;  2L7X A;  1SGE I;  2QQC A;  4O4L B;  2VAW A;  2JXD A;  1TBR R;  1LR7 A;  2CJS C;  3HKD B;  5FUV A;  5LOV B;  4IIJ A;  4B45 A;  5LP6 B;  4U3J A;  4DXD A;  5FUW A;  5KMG A;  1FFX B;  5FNV B;  1VDD A;  1TVK A;  2KMP A;  1V1I A;  2GKT I;  3VOA A;  3E22 B;  3SGB I;  1UUC A;  5CA1 B;  3UFF A;  3JAW B;  5EYP A;  5CB4 A;  5EX3 A;  1W5F A;  3JAL A;  5EZY B;  1FYB A;  2ELI A;  1DS3 I;  1M8B A;  4TV8 A;  1HDL A;  2R75 1;  1N13 A;  4X1K A;  1RLU A;  2V53 A;  2WVJ A;  3WGN A;  1U5K A;  1OMU A;  2NU0 I;  4A24 A;  1KMA A;  2R6R 1;  4SGB I;  3JAR A;  2N17 A;  2K9H A;  4TV9 B;  4I4T A;  5LXT B;  3OL0 A;  1PPF I;  1FAR A;  3B4V C;  4O4L A;  5BMV B;  2DIP A;  3HKD A;  1SGN I;  2SGF I;  1V1H A;  3CB2 A;  4YJ2 B;  2QQE A;  5LOV A;  4E1R A;  5LP6 A;  2SGP I;  2GKR I;  3VO8 A;  1RFH A;  3E2I A;  2M5X A;  3UEJ A;  1FFX A;  2FNF X;  5FNV A;  4UXJ A;  3UT5 B;  1AN1 I;  3E22 A;  3UGI A;  2VRW B;  5CA1 A;  1TVK B;  3JAW A;  2VAP A;  2ENN A;  5IYZ B;  5EZY A;  5EX0 A;  4UXH A;  2ROW A;  3HKE B;  2OD1 A;  2J87 A;  5KX5 B;  2RHL A;  4I55 B;  5EIB C;  3UGD A;  1W59 A;  5EIB D;  2SGD I;  3GOX A;  1NUB A;  1XA6 A;  3PDN A;  3JAK B;  4O2B B;  3WGJ A;  4TV9 A;  2E5R A;  5LXT A;  1W5B A;  2BTO A;  2RHH A;  2V1C C;  5J2U B;  5C8Y B;  1FSZ A;  5BMV A;  5JHW C;  1SA0 B;  4YJ2 A;  3HH2 C;  4LNU B;  1BMO A;  4X1I B;  5JVD B;  1CT2 I;  2WCY A;  4X1Y B;  3UT5 A;  5JCO A;  1Y8F A;  1SGY I;  1IW4 A;  3BJI A;  1SGD I;  1YTP A;  1OYV I;  1TBQ R;  1TUR A;  3OXL A;  5IYZ A;  2YUU A;  2SGQ I;  3HKE A;  5KX5 A;  4FKD A;  4O4I B;  4I55 A;  2SGE I;  5MN6 A;  3UGL A;  2Q1X A;  2ODD A;  4ZHQ B;  1M8C A;  4L9M A;  2KMR A;  3D00 A;  1TUS A;  3JAK A;  4O2B A;  3JAT B;  5JH7 B;  5J2U A;  5C8Y A;  5DAE A;  4HNA A;  1SA0 A;  3SGQ I;  4LNU A;  4TUY B;  4X1I A;  1OVO A;  1Z5V A;  4X20 B;  4ZI7 B;  5JVD A;  1H0Z A;  4X1Y A;  1SGQ I;  5GON B;  3RYI B;  1PTQ A;  1W5E A;  4YJ3 B;  1CGI I;  2KMQ A;  2ARP F;  3VDP A;  1PTR A;  4O4J B;  2YQP A;  1PCE A;  4O4I A;  1UVG A;  4IHJ B;  1CSO I;  4ZHQ A;  3RYF B;  1TBN A;  4B46 A;  5IJ9 B;  3RYH A;  1XBT A;  2N1A B;  2A20 A;  3JAT A;  5JH7 A;  3HKC B;  1PJU A;  5CA0 B;  4KWE A;  2BUS A;  5CCL A;  4ZOL B;  1JFF B;  4WBN B;  1RQ7 A;  2JZM A;  1Y1C A;  4E1P A;  5CCM A;  4TUY A;  4JCV E;  1CGJ I;  2P6A C;  4DRX B;  4HNA B;  4X20 A;  4ZI7 A;  5IJ0 B;  3WGK A;  5FUX A;  5FUY A;  2JYY A;  2NU4 I;  5LP6 C;  1KBE A;  1KBF A;  2KCX A;  3RYC B;  1SGR I;  5GON A;  1W4R A;  2XRC A;  2OVO A;  3RU0 A;  1CT0 I;  3RYI A;  1HJA I;  4O2A B;  4YJ3 A;  3N2G B;  1R79 A;  1Y1B A;  1LR8 A;  4O4J A;  3WGL A;  1W3S A;  4OVO A;  1X74 A;  2VXY A;  2BTQ B;  4IHJ A;  5J2T B;  3WGM A;  3KY9 A;  1YU6 C;  1UVF A;  1X4S A;  2ORV A;  4UXI A;  2QQ0 A;  3RYF A;  2RHJ A;  2NU1 I;  5HQ8 A;  5IJ9 A;  1TBO A;  2LEO A;  1OFU A;  3SEK C;  3HKC A;  5CA0 A;  2DB6 A;  1CT4 I;  3RYH B;  5LA6 B;  4O4H B;  3CXL A;  4ZOL A;  3N2K A;  1CHO I;  1JFF A;  4WBN A;  2GKV A;  1IY5 A;  2B8T A;  1TUB B;  4F6R B;  1CE3 A;  5LYJ B;  5MN5 A;  1OMT A;  4DRX A;  2UZ3 A;  4FFB A;  4EB6 B;  5IJ0 A;  1SGP I;  1FAQ A;  2JA1 A;  5ITZ B;  5JQG B;  3RYC A;  2ENZ A;  3FC3 A;  5JCO C;  4I50 B;  3HKB B;  2NU3 I;  2Q1Y A;  3JAS B;  4O2A A;  3N2G A;  1TOT A;  3QTL D;  1W58 1;  1HPT A;  1BUS A;  1IY6 A;  5J2T A;  2V1C A;  3OXG A;  4M8I A;  2ERW A;  2N71 A;  2ORW A;  3TJQ A;  4E6E A;  3UEY A;  1TGS I;  2JW6 A;  2W0T A;  4IIJ B;  4B6D A;  3E59 A;  4U3J B;  2L8E A;  1W5A A;  4HGU A;  5LA6 A;  4O4H A;  1TIH A;  3VDU A;  5KMG B;  5MN4 A;  1TUB A;  1R0R I;  3QWP A;  4F6R A;  5HI7 A;  4GI3 C;  5LYJ A;  3N2K B;  5EYP B;  3OVO A;  5CB4 B;  4U39 A;  4EB6 A;  3JAL B;  2E73 A;  3C8L A;  2VAM A;  2J9R A;  1Z5W A;  3VE5 A;  2F3C I;  4FFB B;  5ITZ A;  5JQG A;  2RHO A;  4TV8 B;  3OXF A;  1Z7K B;  4X1K B;  3VOB A;  4I50 A;  3HKB A;  1DS2 I;  2GVI A;  3JAS A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...