2GVIA

Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
b'MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
molecule tags Oxidoreductase
source organism Thermoplasma acidophilum
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
total genus 51
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3320.10 Mainly Alpha Orthogonal Bundle pa2218 like fold pa2218 like domain 2gviA01
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gviA03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2gviA02
4ZI7B 3JAKB 4F6RB 5LOVB 1TUBA 4UXHA 4X20A 1XX6A 3RYIA 1TVKB 3JATA 4X1IB 4YJ2A 5CB4B 4HNAB 4LNUA 5CA0A 5EZYA 3UGIA 4TV9A 1FSZA 5LYJB 1SA0A 2B8TA 5CA1A 3CB2A 2J9RA 3HKDA 5JQGA 1W59A 4TUYA 1FFXA 3WGMA 5EYPB 3JALA 5LXTB 4F6RA 4O2AB 5LOVA 4U39A 2JA1A 1TUBB 1Z5WA 3HKCB 4X20B 3RYIB 5ITZB 3WGLA 3JARB 4IHJB 5J2UA 2DB6A 4I50A 2ORVA 4DXDA 1RLUA 3BJIA 4I55B 3JAWB 1SA0B 3RYFA 1FAQA 5MN4A 4DRXB 4TV8B 2QPOA 2Q1YA 4O4JA 5FNVB 5IYZA 3VOBA 4I4TB 5LXTA 5IJ0A 4KWEA 3HKCA 5LP6A 4B45A 2VAMA 3UEYA 4UXJA 4UXIA 4O4IB 5EIBC 5KX5A 3RYCB 2RHLA 2QQEA 5J2TA 4EB6B 1W4RA 2ENZA 4I55A 3RYFB 3WGNA 4L9MA 5BMVB 5GONB 3HKEA 4O4HA 4HNAA 4O4JB 5IYZB 4O2BA 5C8YA 3UEJA 4I4TA 2BTQB 5IJ0B 4X1KB 5JVDB 5FUXA 3JASB 3UT5B 4E6EA 1TBNA 3VO8A 5EIBD 3UGLA 5LA6A 5FUVA 2ROWA 1RQ2A 5EYPA 1RFHA 5KX5B 1JFFB 1W5AA 4O4LA 3RYCA 3WGJA 3RYHA 2R751 5J2TB 1W581 5ITZA 3HKBB 1W5FA 4ZHQB 1KBEA 3HKEB 4TV9B 3N2GB 4ZOLA 4O2BB 5C8YB 2RHJA 1Z5VA 4X1KA 5JH7A 5JVDA 4FKDA 1FARA 1W5EA 5FNVA 5LA6B 5KMGB 3N2KA 1XBTA 1JFFA 4O4LB 3KY9A 2UZ3A 2Q1XA 4YJ3B 5LP6B 2WVJA 2YUUA 3VOAA 2ELIA 2FNFX 2ENNA 1KBFA 3N2GA 4U3JB 2GVIA 4B6DA 5FUYA 1W5BA 4ZOLB 4ZI7A 4EB6A 5BMVA 5MN5A 3UFFA 3JAKA 3C8LA 2RHOA 4M8IA 5GONA 5JCOA 3E2IA 4O4HB 3E22B 5JCOC 5KMGA 3N2KB 2RHHA 4X1IA 2E73A 2ORWA 4YJ2B 5MN6A 2VAPA 5CB4A 3JASA 4LNUB 3UT5A 5CA0B 1RQ7A 5IJ9A 4WBNA 1PTQA 3UGDA 1OFUA 4U3JA 4X1YA 3RYHB 5CA1B 1TBOA 3HKDB 5JQGB 4TUYB 1FFXB 2QQ0A 2BTOA 1PTRA 3HKBA 3JALB 4O2AA 4ZHQA 4FFBB 4B46A 4IIJA 4O4IA 5EZYB 3E22A 5LP6C 3JARA 2J87A 1R79A 4IHJA 5JH7B 5J2UB 5FUWA 4I50B 1XA6A 5IJ9B 4WBNB 2VXYA 3CXLA 3JAWA 1Y8FA 1TVKA 3JATB 4X1YB 4DRXA 3WGKA 4TV8A 2VAWA 4YJ3A 2R6R1 2VRWB 4FFBA 5LYJA 4IIJB
chains in the Genus database with same CATH superfamily
1PJUA 1Y1CA 1YU6C 2G9IA 2MQEA 2B33A 1K9MH 3MCQA 5FLXM 5LOVB 1YJNF 3VDUA 3CCRF 3S0WA 2LUYA 3E59A 4G4ZA 4HNAB 4LNUA 5CA0A 2M5XA 2ZAUA 1QU9A 4ZHVA 2UYJA 1FSZA 1W40A 5LYJB 2IG8A 2V1CC 5CA1A 1SGQI 2J9RA 2W8BC 4TUYA 2XRCA 4O2AB 4EI9A 2L26A 1TUBB 4A24A 5EO3A 1W3EX 4IHJB 1HDLA 1MJBA 2DB6A 2SGFI 1JD1A 3CCJF 1K7UA 1FYBA 3KJKA 1RLUA 4G4XA 1SA0B 5MN4A 3KJJA 1K73H 1NUBA 3R5AA 5FNVB 3TD3A 3C9SA 1YIJF 1S72F 1ULMA 4NUTA 3JAMM 1KNJA 3HKCA 1X4SA 3OW2F 2KTVA 3DDNA 3UEYA 1CE3A 5EIBC 3RYCB 2JXDA 1M1KH 1WKXA 1QAHA 3AGKA 3V4DA 1H48A 1W4RA 5IYZB 3RYFB 2DT4A 5GONB 4GI3C 1YI2F 2LBXA 5C8YA 3UEJA 3IKFA 2KMRA 5JVDB 2A20A 1DBFA 4LCKA 5FUXA 1Y1BA 4E6EA 7WGAA 1TBNA 3P0ZA 3I55F 3UGLA 5GIPC 2ROWA 5EYPA 2ZVYA 3ELCA 1W581 5HXZA 5ITZA 2OU2A 4ERHA 4ZHQB 3JCMM 3V7QA 1JY8A 3HKEB 3BYQA 1Z2IA 1DS3I 2RHJA 4C4WC 5HY0A 1X74A 4FKDA 5LA6B 5A2QM 5KMGB 3N2KA 2NU0I 4O4LB 5J8CA 2HP0B 1VQ9F 2CHTA 1HPTA 3LDTA 5EB1B 3CMEF 4U3JB 4B6DA 5CCMA 4M8IA 4O4HB 1TUSA 3E22B 1R1MA 3I56F 3WJPA 1DT9A 2VAPA 5CB4A 2V1CA 3CMAF 3CYQA 2WCYA 3MCAB 5IJ9A 2I6DA 3OXGA 3GOXA 3UGDA 5CA1B 1M8CA 2NU2I 5J8FA 1UFYA 2JZMA 2VGMA 3HKBA 4O2AA 3FPIA 2HRYA 5HP8A 4BT6A 3E20B 1WTJA 3KHNA 5LP6C 2J87A 2Z01A 5JH7B 4I50B 1OYVI 3FC3A 1VQPF 3CCVF 1CSOI 3OXLA 3G6EF 3WGKA 2HRUA 2SGEI 1FNKA 1Z7KB 2K1SA 1IPAA 5EB0A 3ZO8A 3PLAC 2OTJF 3TJQA 3N4ZA 2R6R1 2VRWB 1CGJI 3E1YA 4FFBA 2FGYA 1FY7A 5LYJA 4C8IA 4ZI7B 1VQ5F 2IAFA 3QHDA 5EX3A 3B6NA 1COMA 2UZHA 3FBAA 2Z1EA 1CT2I 1W41A 2UYKA 3GHZA 1W57A 2SGQI 1TVKB 4BT4A 3LWQC 4E1RA 1QVGF 2ERWA 2VGNA 1Q8RA 2B8TA 1H7MA 2KMQA 1VQLF 2KG4A 5JQGA 2N48A 5EYPB 3JALA 3ON1A 2HS3A 5LOVA 5GINC 3V3TA 4BVRA 1Z5WA 2OZBA 5DCVA 1TURA 3HH2C 5B8FA 5ITZB 1K8AH 3JARB 1VQ7F 5HP7A 3HJWC 5G4UC 1V1IA 1TOTA 4OVOA 1ONIA 3VIUA 2OVOA 1U3LA 4DXDA 2OTLF 3RYFA 2N52A 3IEWA 3F6MA 1CK2A 3DC2A 1SZQA 4TV8B 1X7PA 1VK3A 3M4SA 5LXTA 1PCEA 2CSLA 1P9GA 2RC4A 1N13A 2H6LA 2OHWA 2Z1TA 1N8RH 3P10A 1VQVA 3CCEF 3D54A 3VYTC 1WGTA 2AIZP 1KC8H 3QUWA 5HY2A 5KX5A 1SGEI 4BT5A 3CD6F 3NVKE 1UI9A 2CVLA 3K2XA 3WGNA 3C9RA 3HKEA 3NK7A 4HNAA 4G4VA 4O4JB 3FSYA 1OAPA 4O2BA 1SGNI 3RE3A 4BVSA 2QI2A 1YQNA 4BVTA 5HQ8A 2EWCA 2QEXF 1V1HA 3JASB 3I3FA 5EWRA 3VYSC 4RHAA 1RQ2A 4O4LA 3ZOPA 3WGJA 1MJAA 3VMFB 2PHNA 1ULKA 2F3CI 1CGII 3K14A 1HJAI 2WGCA 1PF5A 3TD4A 3D01A 3CYPB 3CCLF 5JVDA 3HAXD 3OL0A 3OBYA 1MT1A 3WXMB 1W5EA 2CWJA 5FNVA 1VQ8F 1P9ZA 1VDDA 2AMTA 3HTNA 2L8EA 2Q1XA 4YJ3B 5LP6B 3VTIC 4JCVE 2WVJA 1XBIA 3VOAA 3CC4F 2ENNA 1Q7YH 3N2GA 5G4VC 2GVIA 2E5RA 3J7AR 4EB6A 3CG6A 5BMVA 5MN5A 3JAKA 2KGWA 5GONA 2LBTA 4G4WA 2IQQA 3MDOA 3N2KB 1IV3A 4X1IA 2E73A 9WGAA 2HP0A 2UYNB 5MN6A 4X3LA 1TGSI 3OVOA 3UT5A 4C82A 3LWOC 3CCMF 2ZODA 2ARPF 1OFUA 1X52A 4U3JA 3RYHB 3HKDB 3CCUF 2LCAA 3JALB 1PTRA 3LWPC 4FFBB 4B46A 3OXFA 1NMUB 3GTZA 2BTUA 4NQ3A 2YQPA 3JARA 4BT3A 5HY1A 3R5CA 2N17A 3S02A 4BT2A 1UHAA 3CXLA 3JAWA 4MPIA 2CWHA 3N4YA 2VAWA 4TV8A 3P4EA 1U3PA 3RU0A 1NXUA 3SIUA 1YJWF 1Q86H 1W42A 5HXUA 4F6RB 1FNJA 1CLIA 2BO1A 4UXHA 3M1XA 1XX6A 4X20A 2RIJA 3JATA 1RA4A 4TZZA 1R0RI 2GKRI 5CB4B 3FD5A 2ALEA 3EORA 2I6RA 3NVIB 3UGIA 1YHQF 1K7VA 3ERNA 1TBQR 2H8EA 1U43A 1PPFI 4PWTA 1FFXA 1IV1A 1TIHA 5LXTB 4R40B 3J80M 1UVFA 2JA1A 2UVOA 3IMPA 3HWUA 3LWRC 1CN7A 4BW0B 3RYIB 3CPQA 3J81M 2JNBA 3GYQA 1KQSF 1U40A 3RA5A 5J2UA 2NU4I 3C9TA 4I50A 2V9YA 2ORVA 1X25A 1GZ0A 1QD9A 4I55B 1SDSA 2Y0MA 2QPOA 2Q1YA 2DKVA 4O4JA 5IYZA 4I4TB 5DAEA 5IJ0A 4KWEA 3TO6A 1VQNF 2GKTI 5LP6A 4G4YA 1CT4I 4B45A 2FC3A 2YXZA 3WPWA 3L7QA 4UXIA 2CWFA 2RHLA 2GKVA 2ZOVA 2QQEA 3M84A 4EI8A 4EB6B 1CHOI 5BMVB 2ENZA 4L9MA 2HS4A 2Z1UA 2BTQB 2KCXA 3QTYA 2L7XA 2UYNA 3UT5B 1SGRI 1W3SA 3VO8A 1XV2A 1W2BF 3IKEA 2NU1I 2AIFA 3TO9A 1RFHA 2LB7A 4G88A 1DS2I 1JFFB 3VI6A 5KX5B 3RYHA 5J2TB 2KMPA 3F0DA 3OONA 3SIVA 1W5FA 3CC2F 2DYYA 1KMAA 3N2GB 3R5DA 4O2BB 4ZOLA 1BMOA 2KMOA 1Z5VA 2UYPA 4X1KA 1S20A 3LYBA 2QA4F 1VHAA 5HWEA 3F0FA 5IT9M 1YJ9F 2CZWA 2UZ3A 1YTPA 3G71F 4C81A 4C8EA 2SGPI 2F9ZC 2HVYD 3QWPA 2FNFX 1KBFA 2GZLA 1T0KB 1W5BA 5FUYA 5CCLA 3MBMA 3UFFA 2HP3A 2RHOA 5JCOA 1VQ4F 3E2IA 1XRGA 2X52A 2RHHA 1JN1A 1AN1I 2ORWA 3IEQA 3SGBI 3JASA 4LNUB 5CA0B 1QVFF 3T80A 3D00A 1M90H 2ZF8A 1PTQA 5FJ4C 3WJRA 4BT7A 1SGDI 1TBOA 2N71A 3CXCF 4TUYB 1FFXB 1MJ9A 2BTOA 2GIVA 2CJSC 4O4IA 1ZWZA 5EZYB 3CCSF 5E3RA 1ULNA 3SGQI 4IHJA 3S0HA 3Q8HA 5J2UB 1SGPI 1XA6A 3ZP4A 3CPWF 2B0UC 4WBNB 2JW6A 3JATB 1GO0A 4X1YB 1GX1A 3PDNA 4ZK7A 4YJ3A 3R0PA 1VQKF 3CCQF 1E7KA 4IIJB 1KD1H 1U5KA 3ESJA 2PQ8A 1H47A 1SGYI 4B5CA 3I7TA 2QTPA 3JAKB 1LR9A 3C9UA 2OZUA 2P6AC 1TUBA 4NWOB 4RQOA 2N1AB 1ODEA 3RYIA 2HS0A 1RLGA 4X1IB 3IR9A 4YJ2A 4DNCA 5EZYA 3LWVC 1VQOF 4TV9A 3CC7F 1GO1A 5AVMA 1SA0A 3MQWA 4SGBI 5HI7A 1Q82H 2ODDA 3CB2A 3HKDA 2YYEA 3KE1A 1IY5A 1W59A 3WGMA 4ZHWA 1J7HA 2K9HA 4F6RA 2GLZA 1XHOA 4U39A 5JHWC 3HKCB 5E3PA 2HX0A 1NQ3A 4X20B 1OMUA 1JJ2F 3WGLA 4AMLA 1YITF 1YGYA 2JYYA 4B62A 3BJIA 3JAWB 1FAQA 4DRXB 1OVOA 3VOBA 2BUSA 1T0AA 3VCZA 2CHSA 1BUSA 2VAMA 4UXJA 1VQ6F 1IY6A 3F0GA 4C8GA 3OBWA 5J2TA 5GIOC 2QQDA 3LMEA 4I55A 3ZP7A 2ZVZA 2NU3I 3FSXA 2HQSC 3LFOA 4O4HA 3VYUC 3V7EA 4I4TA 1UUCA 5IJ0B 5GAPK 4X1KB 3TOBA 2SGDI 1IV4A 1X7OA 5EIBD 5LA6A 1VQMF 5FUVA 5HY4A 1W5AA 3RYCA 3S06A 1WGCA 2R751 1LR8A 3VDPA 2NMUA 5E3QA 3UOEA 3HKBB 3S03A 5GANK 3SEKC 1KBEA 3QTLD 4TV9B 5C8YB 1PXWA 4BY9D 3K0TA 5JH7A 2KTUA 2OD1A 1FARA 1CT0I 1KNKA 3WJQA 1XBTA 3TD5A 1JFFA 3KY9A 1Q9BA 3G4SF 2RB9A 3R5BA 2CWGA 4ZHYB 2YUUA 2LBWA 3S0YA 1Q81H 2ELIA 1IW4A 1TBRR 2H8CA 4ZOLB 4ZI7A 2PMPA 4BVQA 3C8LA 3WPXA 1LR7A 1W55A 3TO7A 1VH8A 5JCOC 5KMGA 1HEVA 2WALA 2P6YA 4YJ2B 3TOAA 1RQ7A 3FD6A 2DIPA 4WBNA 4E1PA 3QAHA 1IV2A 5EAZA 1UVGA 4X1YA 3B4VC 3NK6A 3MEKA 5JQGB 2QQ0A 4XCQA 2W0TA 4ZHQA 3RA6A 4EI7A 4IIJA 3PAFA 3E22A 2QQCA 2X3TA 2CW4A 2Z1FA 3VE5A 1M8BA 1R79A 3FFMA 3U0OA 5FUWA 3O85A 4X3MA 3K12A 5IJ9B 5EX0A 2VXYA 3KIZA 1Y8FA 1TVKA 2OTMA 2V53A 1H0ZA 4DRXA 3JVHA 3NMUC 1K7TA 1NJIH 4WP4A 4HGUA 1OMTA 2LEOA 3F0EA 4O4IB
chains in the Genus database with same CATH topology
1PJUA 1Y1CA 1YU6C 5LOVB 3VDUA 2LUYA 3E59A 4HNAB 4LNUA 5CA0A 2M5XA 1FSZA 5LYJB 2V1CC 5CA1A 1SGQI 2J9RA 4TUYA 2XRCA 4O2AB 1TUBB 4A24A 4IHJB 1HDLA 2DB6A 2SGFI 1FYBA 1RLUA 1SA0B 5MN4A 1NUBA 5FNVB 3HKCA 1X4SA 3UEYA 1CE3A 4O4IB 5EIBC 3RYCB 2JXDA 1W4RA 3RYFB 5GONB 4GI3C 5C8YA 3UEJA 2KMRA 5JVDB 2A20A 5FUXA 1Y1BA 4E6EA 1TBNA 3UGLA 2ROWA 5EYPA 1W581 5ITZA 4ZHQB 3HKEB 1OMTA 1DS3I 2RHJA 1X74A 4FKDA 5LA6B 5KMGB 3N2KA 2NU0I 4O4LB 1HPTA 4U3JB 4B6DA 5CCMA 4M8IA 4O4HB 1TUSA 3E22B 2VAPA 5CB4A 2V1CA 2WCYA 5IJ9A 3OXGA 3GOXA 3UGDA 5CA1B 1M8CA 2NU2I 3HKBA 2JZMA 4O2AA 5LP6C 2J87A 5JH7B 4I50B 1OYVI 3FC3A 1CSOI 3OXLA 3WGKA 2SGEI 1Z7KB 3TJQA 2R6R1 2VRWB 1CGJI 4FFBA 5LYJA 4ZI7B 5EX3A 1CT2I 2SGQI 1TVKB 4E1RA 2ERWA 2B8TA 2KMQA 5JQGA 5EYPB 3JALA 5LOVA 1Z5WA 1TURA 3HH2C 5ITZB 3JARB 1V1IA 1TOTA 4OVOA 2OVOA 4DXDA 3RYFA 2N52A 4TV8B 5LXTA 1PCEA 1N13A 5KX5A 1SGEI 3WGNA 3HKEA 4HNAA 4O4JB 5IYZB 4O2BA 1SGNI 5HQ8A 1V1HA 3JASB 1RQ2A 4O4LA 3WGJA 2F3CI 1CGII 1HJAI 5JVDA 3OL0A 1MT1A 1W5EA 5FNVA 1VDDA 2L8EA 2Q1XA 4YJ3B 5LP6B 4JCVE 2WVJA 3VOAA 2ENNA 3N2GA 2GVIA 2E5RA 4EB6A 5BMVA 5MN5A 3JAKA 5GONA 3N2KB 4X1IA 2E73A 5MN6A 3UT5A 1TGSI 3OVOA 4U3JA 2ARPF 1OFUA 3RYHB 3HKDB 3JALB 1PTRA 4FFBB 4B46A 3OXFA 2YQPA 3JARA 2N17A 3CXLA 3JAWA 4TV8A 2VAWA 3RU0A 4F6RB 4UXHA 4X20A 1XX6A 3JATA 1R0RI 2GKRI 5CB4B 3UGIA 1TBQR 1PPFI 1FFXA 1TIHA 5LXTB 1UVFA 2JA1A 3RYIB 5J2UA 2NU4I 4I50A 2ORVA 4I55B 2QPOA 2Q1YA 4O4JA 5IYZA 4I4TB 5DAEA 5IJ0A 4KWEA 2GKTI 5LP6A 1CT4I 4B45A 4UXIA 2RHLA 2GKVA 2QQEA 4EB6B 1CHOI 5BMVB 2ENZA 4L9MA 2BTQB 2KCXA 2L7XA 3UT5B 1SGRI 1W3SA 3VO8A 2NU1I 1RFHA 5KX5B 1DS2I 1JFFB 3RYHA 5J2TB 2KMPA 1W5FA 1KMAA 3N2GB 4ZOLA 4O2BB 1BMOA 2KMOA 1Z5VA 4X1KA 2UZ3A 1YTPA 2SGPI 3QWPA 2FNFX 1KBFA 1W5BA 5FUYA 5CCLA 3UFFA 2RHOA 5JCOA 3E2IA 2RHHA 1AN1I 2ORWA 3SGBI 3JASA 4LNUB 5CA0B 3D00A 1PTQA 1SGDI 1TBOA 2N71A 4TUYB 1FFXB 2BTOA 2CJSC 4O4IA 5EZYB 3SGQI 4IHJA 5J2UB 1SGPI 1XA6A 2B0UC 4WBNB 2JW6A 3JATB 4X1YB 3PDNA 4YJ3A 4IIJB 1U5KA 1SGYI 3JAKB 1LR9A 2P6AC 1TUBA 2N1AB 3RYIA 4X1IB 4YJ2A 4TV9A 1SA0A 4SGBI 5HI7A 2ODDA 3CB2A 3HKDA 1IY5A 1W59A 3WGMA 2K9HA 4F6RA 4U39A 5JHWC 3HKCB 4X20B 1OMUA 3WGLA 2JYYA 3BJIA 3JAWB 1FAQA 4DRXB 1OVOA 3VOBA 2BUSA 1BUSA 2VAMA 4UXJA 1IY6A 5J2TA 2QQDA 4I55A 2NU3I 4O4HA 4I4TA 1UUCA 5IJ0B 4X1KB 2SGDI 5EIBD 5LA6A 5FUVA 1W5AA 3RYCA 2R751 1LR8A 3VDPA 3HKBB 3SEKC 1KBEA 3QTLD 5C8YB 5JH7A 2OD1A 1FARA 1CT0I 1XBTA 1JFFA 3KY9A 2YUUA 2ELIA 1IW4A 1TBRR 4ZOLB 4ZI7A 3C8LA 1LR7A 5JCOC 5KMGA 4YJ2B 1RQ7A 2DIPA 4WBNA 4E1PA 1UVGA 4X1YA 3B4VC 3MEKA 5JQGB 2QQ0A 2W0TA 4ZHQA 4IIJA 3E22A 2QQCA 3VE5A 1M8BA 1R79A 5FUWA 5IJ9B 5EX0A 2VXYA 1Y8FA 1TVKA 2V53A 1H0ZA 4DRXA 4HGUA 4TV9B 2LEOA 5EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI7 B;  3JAK B;  4F6R B;  5LOV B;  1TUB A;  4UXH A;  4X20 A;  1XX6 A;  3RYI A;  1TVK B;  3JAT A;  4X1I B;  4YJ2 A;  5CB4 B;  4HNA B;  4LNU A;  5CA0 A;  5EZY A;  3UGI A;  4TV9 A;  1FSZ A;  5LYJ B;  1SA0 A;  2B8T A;  5CA1 A;  3CB2 A;  2J9R A;  3HKD A;  5JQG A;  1W59 A;  4TUY A;  1FFX A;  3WGM A;  5EYP B;  3JAL A;  5LXT B;  4F6R A;  4O2A B;  5LOV A;  4U39 A;  2JA1 A;  1TUB B;  1Z5W A;  3HKC B;  4X20 B;  3RYI B;  5ITZ B;  3WGL A;  3JAR B;  4IHJ B;  5J2U A;  2DB6 A;  4I50 A;  2ORV A;  4DXD A;  1RLU A;  3BJI A;  4I55 B;  3JAW B;  1SA0 B;  3RYF A;  1FAQ A;  5MN4 A;  4DRX B;  4TV8 B;  2QPO A;  2Q1Y A;  4O4J A;  5FNV B;  5IYZ A;  3VOB A;  4I4T B;  5LXT A;  5IJ0 A;  4KWE A;  3HKC A;  5LP6 A;  4B45 A;  2VAM A;  3UEY A;  4UXJ A;  4UXI A;  4O4I B;  5EIB C;  5KX5 A;  3RYC B;  2RHL A;  2QQE A;  5J2T A;  4EB6 B;  1W4R A;  2ENZ A;  4I55 A;  3RYF B;  3WGN A;  4L9M A;  5BMV B;  5GON B;  3HKE A;  4O4H A;  4HNA A;  4O4J B;  5IYZ B;  4O2B A;  5C8Y A;  3UEJ A;  4I4T A;  2BTQ B;  5IJ0 B;  4X1K B;  5JVD B;  5FUX A;  3JAS B;  3UT5 B;  4E6E A;  1TBN A;  3VO8 A;  5EIB D;  3UGL A;  5LA6 A;  5FUV A;  2ROW A;  1RQ2 A;  5EYP A;  1RFH A;  5KX5 B;  1JFF B;  1W5A A;  4O4L A;  3RYC A;  3WGJ A;  3RYH A;  2R75 1;  5J2T B;  1W58 1;  5ITZ A;  3HKB B;  1W5F A;  4ZHQ B;  1KBE A;  3HKE B;  4TV9 B;  3N2G B;  4ZOL A;  4O2B B;  5C8Y B;  2RHJ A;  1Z5V A;  4X1K A;  5JH7 A;  5JVD A;  4FKD A;  1FAR A;  1W5E A;  5FNV A;  5LA6 B;  5KMG B;  3N2K A;  1XBT A;  1JFF A;  4O4L B;  3KY9 A;  2UZ3 A;  2Q1X A;  4YJ3 B;  5LP6 B;  2WVJ A;  2YUU A;  3VOA A;  2ELI A;  2FNF X;  2ENN A;  1KBF A;  3N2G A;  4U3J B;  2GVI A;  4B6D A;  5FUY A;  1W5B A;  4ZOL B;  4ZI7 A;  4EB6 A;  5BMV A;  5MN5 A;  3UFF A;  3JAK A;  3C8L A;  2RHO A;  4M8I A;  5GON A;  5JCO A;  3E2I A;  4O4H B;  3E22 B;  5JCO C;  5KMG A;  3N2K B;  2RHH A;  4X1I A;  2E73 A;  2ORW A;  4YJ2 B;  5MN6 A;  2VAP A;  5CB4 A;  3JAS A;  4LNU B;  3UT5 A;  5CA0 B;  1RQ7 A;  5IJ9 A;  4WBN A;  1PTQ A;  3UGD A;  1OFU A;  4U3J A;  4X1Y A;  3RYH B;  5CA1 B;  1TBO A;  3HKD B;  5JQG B;  4TUY B;  1FFX B;  2QQ0 A;  2BTO A;  1PTR A;  3HKB A;  3JAL B;  4O2A A;  4ZHQ A;  4FFB B;  4B46 A;  4IIJ A;  4O4I A;  5EZY B;  3E22 A;  5LP6 C;  3JAR A;  2J87 A;  1R79 A;  4IHJ A;  5JH7 B;  5J2U B;  5FUW A;  4I50 B;  1XA6 A;  5IJ9 B;  4WBN B;  2VXY A;  3CXL A;  3JAW A;  1Y8F A;  1TVK A;  3JAT B;  4X1Y B;  4DRX A;  3WGK A;  4TV8 A;  2VAW A;  4YJ3 A;  2R6R 1;  2VRW B;  4FFB A;  5LYJ A;  4IIJ B; 
#chains in the Genus database with same CATH topology
 1PJU A;  1Y1C A;  1YU6 C;  2G9I A;  2MQE A;  2B33 A;  1K9M H;  3MCQ A;  5FLX M;  5LOV B;  1YJN F;  3VDU A;  3CCR F;  3S0W A;  2LUY A;  3E59 A;  4G4Z A;  4HNA B;  4LNU A;  5CA0 A;  2M5X A;  2ZAU A;  1QU9 A;  4ZHV A;  2UYJ A;  1FSZ A;  1W40 A;  5LYJ B;  2IG8 A;  2V1C C;  5CA1 A;  1SGQ I;  2J9R A;  2W8B C;  4TUY A;  2XRC A;  4O2A B;  4EI9 A;  2L26 A;  1TUB B;  4A24 A;  5EO3 A;  1W3E X;  4IHJ B;  1HDL A;  1MJB A;  2DB6 A;  2SGF I;  1JD1 A;  3CCJ F;  1K7U A;  1FYB A;  3KJK A;  1RLU A;  4G4X A;  1SA0 B;  5MN4 A;  3KJJ A;  1K73 H;  1NUB A;  3R5A A;  5FNV B;  3TD3 A;  3C9S A;  1YIJ F;  1S72 F;  1ULM A;  4NUT A;  3JAM M;  1KNJ A;  3HKC A;  1X4S A;  3OW2 F;  2KTV A;  3DDN A;  3UEY A;  1CE3 A;  5EIB C;  3RYC B;  2JXD A;  1M1K H;  1WKX A;  1QAH A;  3AGK A;  3V4D A;  1H48 A;  1W4R A;  5IYZ B;  3RYF B;  2DT4 A;  5GON B;  4GI3 C;  1YI2 F;  2LBX A;  5C8Y A;  3UEJ A;  3IKF A;  2KMR A;  5JVD B;  2A20 A;  1DBF A;  4LCK A;  5FUX A;  1Y1B A;  4E6E A;  7WGA A;  1TBN A;  3P0Z A;  3I55 F;  3UGL A;  5GIP C;  2ROW A;  5EYP A;  2ZVY A;  3ELC A;  1W58 1;  5HXZ A;  5ITZ A;  2OU2 A;  4ERH A;  4ZHQ B;  3JCM M;  3V7Q A;  1JY8 A;  3HKE B;  3BYQ A;  1Z2I A;  1DS3 I;  2RHJ A;  4C4W C;  5HY0 A;  1X74 A;  4FKD A;  5LA6 B;  5A2Q M;  5KMG B;  3N2K A;  2NU0 I;  4O4L B;  5J8C A;  2HP0 B;  1VQ9 F;  2CHT A;  1HPT A;  3LDT A;  5EB1 B;  3CME F;  4U3J B;  4B6D A;  5CCM A;  4M8I A;  4O4H B;  1TUS A;  3E22 B;  1R1M A;  3I56 F;  3WJP A;  1DT9 A;  2VAP A;  5CB4 A;  2V1C A;  3CMA F;  3CYQ A;  2WCY A;  3MCA B;  5IJ9 A;  2I6D A;  3OXG A;  3GOX A;  3UGD A;  5CA1 B;  1M8C A;  2NU2 I;  5J8F A;  1UFY A;  2JZM A;  2VGM A;  3HKB A;  4O2A A;  3FPI A;  2HRY A;  5HP8 A;  4BT6 A;  3E20 B;  1WTJ A;  3KHN A;  5LP6 C;  2J87 A;  2Z01 A;  5JH7 B;  4I50 B;  1OYV I;  3FC3 A;  1VQP F;  3CCV F;  1CSO I;  3OXL A;  3G6E F;  3WGK A;  2HRU A;  2SGE I;  1FNK A;  1Z7K B;  2K1S A;  1IPA A;  5EB0 A;  3ZO8 A;  3PLA C;  2OTJ F;  3TJQ A;  3N4Z A;  2R6R 1;  2VRW B;  1CGJ I;  3E1Y A;  4FFB A;  2FGY A;  1FY7 A;  5LYJ A;  4C8I A;  4ZI7 B;  1VQ5 F;  2IAF A;  3QHD A;  5EX3 A;  3B6N A;  1COM A;  2UZH A;  3FBA A;  2Z1E A;  1CT2 I;  1W41 A;  2UYK A;  3GHZ A;  1W57 A;  2SGQ I;  1TVK B;  4BT4 A;  3LWQ C;  4E1R A;  1QVG F;  2ERW A;  2VGN A;  1Q8R A;  2B8T A;  1H7M A;  2KMQ A;  1VQL F;  2KG4 A;  5JQG A;  2N48 A;  5EYP B;  3JAL A;  3ON1 A;  2HS3 A;  5LOV A;  5GIN C;  3V3T A;  4BVR A;  1Z5W A;  2OZB A;  5DCV A;  1TUR A;  3HH2 C;  5B8F A;  5ITZ B;  1K8A H;  3JAR B;  1VQ7 F;  5HP7 A;  3HJW C;  5G4U C;  1V1I A;  1TOT A;  4OVO A;  1ONI A;  3VIU A;  2OVO A;  1U3L A;  4DXD A;  2OTL F;  3RYF A;  2N52 A;  3IEW A;  3F6M A;  1CK2 A;  3DC2 A;  1SZQ A;  4TV8 B;  1X7P A;  1VK3 A;  3M4S A;  5LXT A;  1PCE A;  2CSL A;  1P9G A;  2RC4 A;  1N13 A;  2H6L A;  2OHW A;  2Z1T A;  1N8R H;  3P10 A;  1VQV A;  3CCE F;  3D54 A;  3VYT C;  1WGT A;  2AIZ P;  1KC8 H;  3QUW A;  5HY2 A;  5KX5 A;  1SGE I;  4BT5 A;  3CD6 F;  3NVK E;  1UI9 A;  2CVL A;  3K2X A;  3WGN A;  3C9R A;  3HKE A;  3NK7 A;  4HNA A;  4G4V A;  4O4J B;  3FSY A;  1OAP A;  4O2B A;  1SGN I;  3RE3 A;  4BVS A;  2QI2 A;  1YQN A;  4BVT A;  5HQ8 A;  2EWC A;  2QEX F;  1V1H A;  3JAS B;  3I3F A;  5EWR A;  3VYS C;  4RHA A;  1RQ2 A;  4O4L A;  3ZOP A;  3WGJ A;  1MJA A;  3VMF B;  2PHN A;  1ULK A;  2F3C I;  1CGI I;  3K14 A;  1HJA I;  2WGC A;  1PF5 A;  3TD4 A;  3D01 A;  3CYP B;  3CCL F;  5JVD A;  3HAX D;  3OL0 A;  3OBY A;  1MT1 A;  3WXM B;  1W5E A;  2CWJ A;  5FNV A;  1VQ8 F;  1P9Z A;  1VDD A;  2AMT A;  3HTN A;  2L8E A;  2Q1X A;  4YJ3 B;  5LP6 B;  3VTI C;  4JCV E;  2WVJ A;  1XBI A;  3VOA A;  3CC4 F;  2ENN A;  1Q7Y H;  3N2G A;  5G4V C;  2GVI A;  2E5R A;  3J7A R;  4EB6 A;  3CG6 A;  5BMV A;  5MN5 A;  3JAK A;  2KGW A;  5GON A;  2LBT A;  4G4W A;  2IQQ A;  3MDO A;  3N2K B;  1IV3 A;  4X1I A;  2E73 A;  9WGA A;  2HP0 A;  2UYN B;  5MN6 A;  4X3L A;  1TGS I;  3OVO A;  3UT5 A;  4C82 A;  3LWO C;  3CCM F;  2ZOD A;  2ARP F;  1OFU A;  1X52 A;  4U3J A;  3RYH B;  3HKD B;  3CCU F;  2LCA A;  3JAL B;  1PTR A;  3LWP C;  4FFB B;  4B46 A;  3OXF A;  1NMU B;  3GTZ A;  2BTU A;  4NQ3 A;  2YQP A;  3JAR A;  4BT3 A;  5HY1 A;  3R5C A;  2N17 A;  3S02 A;  4BT2 A;  1UHA A;  3CXL A;  3JAW A;  4MPI A;  2CWH A;  3N4Y A;  2VAW A;  4TV8 A;  3P4E A;  1U3P A;  3RU0 A;  1NXU A;  3SIU A;  1YJW F;  1Q86 H;  1W42 A;  5HXU A;  4F6R B;  1FNJ A;  1CLI A;  2BO1 A;  4UXH A;  3M1X A;  1XX6 A;  4X20 A;  2RIJ A;  3JAT A;  1RA4 A;  4TZZ A;  1R0R I;  2GKR I;  5CB4 B;  3FD5 A;  2ALE A;  3EOR A;  2I6R A;  3NVI B;  3UGI A;  1YHQ F;  1K7V A;  3ERN A;  1TBQ R;  2H8E A;  1U43 A;  1PPF I;  4PWT A;  1FFX A;  1IV1 A;  1TIH A;  5LXT B;  4R40 B;  3J80 M;  1UVF A;  2JA1 A;  2UVO A;  3IMP A;  3HWU A;  3LWR C;  1CN7 A;  4BW0 B;  3RYI B;  3CPQ A;  3J81 M;  2JNB A;  3GYQ A;  1KQS F;  1U40 A;  3RA5 A;  5J2U A;  2NU4 I;  3C9T A;  4I50 A;  2V9Y A;  2ORV A;  1X25 A;  1GZ0 A;  1QD9 A;  4I55 B;  1SDS A;  2Y0M A;  2QPO A;  2Q1Y A;  2DKV A;  4O4J A;  5IYZ A;  4I4T B;  5DAE A;  5IJ0 A;  4KWE A;  3TO6 A;  1VQN F;  2GKT I;  5LP6 A;  4G4Y A;  1CT4 I;  4B45 A;  2FC3 A;  2YXZ A;  3WPW A;  3L7Q A;  4UXI A;  2CWF A;  2RHL A;  2GKV A;  2ZOV A;  2QQE A;  3M84 A;  4EI8 A;  4EB6 B;  1CHO I;  5BMV B;  2ENZ A;  4L9M A;  2HS4 A;  2Z1U A;  2BTQ B;  2KCX A;  3QTY A;  2L7X A;  2UYN A;  3UT5 B;  1SGR I;  1W3S A;  3VO8 A;  1XV2 A;  1W2B F;  3IKE A;  2NU1 I;  2AIF A;  3TO9 A;  1RFH A;  2LB7 A;  4G88 A;  1DS2 I;  1JFF B;  3VI6 A;  5KX5 B;  3RYH A;  5J2T B;  2KMP A;  3F0D A;  3OON A;  3SIV A;  1W5F A;  3CC2 F;  2DYY A;  1KMA A;  3N2G B;  3R5D A;  4O2B B;  4ZOL A;  1BMO A;  2KMO A;  1Z5V A;  2UYP A;  4X1K A;  1S20 A;  3LYB A;  2QA4 F;  1VHA A;  5HWE A;  3F0F A;  5IT9 M;  1YJ9 F;  2CZW A;  2UZ3 A;  1YTP A;  3G71 F;  4C81 A;  4C8E A;  2SGP I;  2F9Z C;  2HVY D;  3QWP A;  2FNF X;  1KBF A;  2GZL A;  1T0K B;  1W5B A;  5FUY A;  5CCL A;  3MBM A;  3UFF A;  2HP3 A;  2RHO A;  5JCO A;  1VQ4 F;  3E2I A;  1XRG A;  2X52 A;  2RHH A;  1JN1 A;  1AN1 I;  2ORW A;  3IEQ A;  3SGB I;  3JAS A;  4LNU B;  5CA0 B;  1QVF F;  3T80 A;  3D00 A;  1M90 H;  2ZF8 A;  1PTQ A;  5FJ4 C;  3WJR A;  4BT7 A;  1SGD I;  1TBO A;  2N71 A;  3CXC F;  4TUY B;  1FFX B;  1MJ9 A;  2BTO A;  2GIV A;  2CJS C;  4O4I A;  1ZWZ A;  5EZY B;  3CCS F;  5E3R A;  1ULN A;  3SGQ I;  4IHJ A;  3S0H A;  3Q8H A;  5J2U B;  1SGP I;  1XA6 A;  3ZP4 A;  3CPW F;  2B0U C;  4WBN B;  2JW6 A;  3JAT B;  1GO0 A;  4X1Y B;  1GX1 A;  3PDN A;  4ZK7 A;  4YJ3 A;  3R0P A;  1VQK F;  3CCQ F;  1E7K A;  4IIJ B;  1KD1 H;  1U5K A;  3ESJ A;  2PQ8 A;  1H47 A;  1SGY I;  4B5C A;  3I7T A;  2QTP A;  3JAK B;  1LR9 A;  3C9U A;  2OZU A;  2P6A C;  1TUB A;  4NWO B;  4RQO A;  2N1A B;  1ODE A;  3RYI A;  2HS0 A;  1RLG A;  4X1I B;  3IR9 A;  4YJ2 A;  4DNC A;  5EZY A;  3LWV C;  1VQO F;  4TV9 A;  3CC7 F;  1GO1 A;  5AVM A;  1SA0 A;  3MQW A;  4SGB I;  5HI7 A;  1Q82 H;  2ODD A;  3CB2 A;  3HKD A;  2YYE A;  3KE1 A;  1IY5 A;  1W59 A;  3WGM A;  4ZHW A;  1J7H A;  2K9H A;  4F6R A;  2GLZ A;  1XHO A;  4U39 A;  5JHW C;  3HKC B;  5E3P A;  2HX0 A;  1NQ3 A;  4X20 B;  1OMU A;  1JJ2 F;  3WGL A;  4AML A;  1YIT F;  1YGY A;  2JYY A;  4B62 A;  3BJI A;  3JAW B;  1FAQ A;  4DRX B;  1OVO A;  3VOB A;  2BUS A;  1T0A A;  3VCZ A;  2CHS A;  1BUS A;  2VAM A;  4UXJ A;  1VQ6 F;  1IY6 A;  3F0G A;  4C8G A;  3OBW A;  5J2T A;  5GIO C;  2QQD A;  3LME A;  4I55 A;  3ZP7 A;  2ZVZ A;  2NU3 I;  3FSX A;  2HQS C;  3LFO A;  4O4H A;  3VYU C;  3V7E A;  4I4T A;  1UUC A;  5IJ0 B;  5GAP K;  4X1K B;  3TOB A;  2SGD I;  1IV4 A;  1X7O A;  5EIB D;  5LA6 A;  1VQM F;  5FUV A;  5HY4 A;  1W5A A;  3RYC A;  3S06 A;  1WGC A;  2R75 1;  1LR8 A;  3VDP A;  2NMU A;  5E3Q A;  3UOE A;  3HKB B;  3S03 A;  5GAN K;  3SEK C;  1KBE A;  3QTL D;  4TV9 B;  5C8Y B;  1PXW A;  4BY9 D;  3K0T A;  5JH7 A;  2KTU A;  2OD1 A;  1FAR A;  1CT0 I;  1KNK A;  3WJQ A;  1XBT A;  3TD5 A;  1JFF A;  3KY9 A;  1Q9B A;  3G4S F;  2RB9 A;  3R5B A;  2CWG A;  4ZHY B;  2YUU A;  2LBW A;  3S0Y A;  1Q81 H;  2ELI A;  1IW4 A;  1TBR R;  2H8C A;  4ZOL B;  4ZI7 A;  2PMP A;  4BVQ A;  3C8L A;  3WPX A;  1LR7 A;  1W55 A;  3TO7 A;  1VH8 A;  5JCO C;  5KMG A;  1HEV A;  2WAL A;  2P6Y A;  4YJ2 B;  3TOA A;  1RQ7 A;  3FD6 A;  2DIP A;  4WBN A;  4E1P A;  3QAH A;  1IV2 A;  5EAZ A;  1UVG A;  4X1Y A;  3B4V C;  3NK6 A;  3MEK A;  5JQG B;  2QQ0 A;  4XCQ A;  2W0T A;  4ZHQ A;  3RA6 A;  4EI7 A;  4IIJ A;  3PAF A;  3E22 A;  2QQC A;  2X3T A;  2CW4 A;  2Z1F A;  3VE5 A;  1M8B A;  1R79 A;  3FFM A;  3U0O A;  5FUW A;  3O85 A;  4X3M A;  3K12 A;  5IJ9 B;  5EX0 A;  2VXY A;  3KIZ A;  1Y8F A;  1TVK A;  2OTM A;  2V53 A;  1H0Z A;  4DRX A;  3JVH A;  3NMU C;  1K7T A;  1NJI H;  4WP4 A;  4HGU A;  1OMT A;  2LEO A;  3F0E A;  4O4I B; 
#chains in the Genus database with same CATH homology
 1PJU A;  1Y1C A;  1YU6 C;  5LOV B;  3VDU A;  2LUY A;  3E59 A;  4HNA B;  4LNU A;  5CA0 A;  2M5X A;  1FSZ A;  5LYJ B;  2V1C C;  5CA1 A;  1SGQ I;  2J9R A;  4TUY A;  2XRC A;  4O2A B;  1TUB B;  4A24 A;  4IHJ B;  1HDL A;  2DB6 A;  2SGF I;  1FYB A;  1RLU A;  1SA0 B;  5MN4 A;  1NUB A;  5FNV B;  3HKC A;  1X4S A;  3UEY A;  1CE3 A;  4O4I B;  5EIB C;  3RYC B;  2JXD A;  1W4R A;  3RYF B;  5GON B;  4GI3 C;  5C8Y A;  3UEJ A;  2KMR A;  5JVD B;  2A20 A;  5FUX A;  1Y1B A;  4E6E A;  1TBN A;  3UGL A;  2ROW A;  5EYP A;  1W58 1;  5ITZ A;  4ZHQ B;  3HKE B;  1OMT A;  1DS3 I;  2RHJ A;  1X74 A;  4FKD A;  5LA6 B;  5KMG B;  3N2K A;  2NU0 I;  4O4L B;  1HPT A;  4U3J B;  4B6D A;  5CCM A;  4M8I A;  4O4H B;  1TUS A;  3E22 B;  2VAP A;  5CB4 A;  2V1C A;  2WCY A;  5IJ9 A;  3OXG A;  3GOX A;  3UGD A;  5CA1 B;  1M8C A;  2NU2 I;  3HKB A;  2JZM A;  4O2A A;  5LP6 C;  2J87 A;  5JH7 B;  4I50 B;  1OYV I;  3FC3 A;  1CSO I;  3OXL A;  3WGK A;  2SGE I;  1Z7K B;  3TJQ A;  2R6R 1;  2VRW B;  1CGJ I;  4FFB A;  5LYJ A;  4ZI7 B;  5EX3 A;  1CT2 I;  2SGQ I;  1TVK B;  4E1R A;  2ERW A;  2B8T A;  2KMQ A;  5JQG A;  5EYP B;  3JAL A;  5LOV A;  1Z5W A;  1TUR A;  3HH2 C;  5ITZ B;  3JAR B;  1V1I A;  1TOT A;  4OVO A;  2OVO A;  4DXD A;  3RYF A;  2N52 A;  4TV8 B;  5LXT A;  1PCE A;  1N13 A;  5KX5 A;  1SGE I;  3WGN A;  3HKE A;  4HNA A;  4O4J B;  5IYZ B;  4O2B A;  1SGN I;  5HQ8 A;  1V1H A;  3JAS B;  1RQ2 A;  4O4L A;  3WGJ A;  2F3C I;  1CGI I;  1HJA I;  5JVD A;  3OL0 A;  1MT1 A;  1W5E A;  5FNV A;  1VDD A;  2L8E A;  2Q1X A;  4YJ3 B;  5LP6 B;  4JCV E;  2WVJ A;  3VOA A;  2ENN A;  3N2G A;  2GVI A;  2E5R A;  4EB6 A;  5BMV A;  5MN5 A;  3JAK A;  5GON A;  3N2K B;  4X1I A;  2E73 A;  5MN6 A;  3UT5 A;  1TGS I;  3OVO A;  4U3J A;  2ARP F;  1OFU A;  3RYH B;  3HKD B;  3JAL B;  1PTR A;  4FFB B;  4B46 A;  3OXF A;  2YQP A;  3JAR A;  2N17 A;  3CXL A;  3JAW A;  4TV8 A;  2VAW A;  3RU0 A;  4F6R B;  4UXH A;  4X20 A;  1XX6 A;  3JAT A;  1R0R I;  2GKR I;  5CB4 B;  3UGI A;  1TBQ R;  1PPF I;  1FFX A;  1TIH A;  5LXT B;  1UVF A;  2JA1 A;  3RYI B;  5J2U A;  2NU4 I;  4I50 A;  2ORV A;  4I55 B;  2QPO A;  2Q1Y A;  4O4J A;  5IYZ A;  4I4T B;  5DAE A;  5IJ0 A;  4KWE A;  2GKT I;  5LP6 A;  1CT4 I;  4B45 A;  4UXI A;  2RHL A;  2GKV A;  2QQE A;  4EB6 B;  1CHO I;  5BMV B;  2ENZ A;  4L9M A;  2BTQ B;  2KCX A;  2L7X A;  3UT5 B;  1SGR I;  1W3S A;  3VO8 A;  2NU1 I;  1RFH A;  5KX5 B;  1DS2 I;  1JFF B;  3RYH A;  5J2T B;  2KMP A;  1W5F A;  1KMA A;  3N2G B;  4ZOL A;  4O2B B;  1BMO A;  2KMO A;  1Z5V A;  4X1K A;  2UZ3 A;  1YTP A;  2SGP I;  3QWP A;  2FNF X;  1KBF A;  1W5B A;  5FUY A;  5CCL A;  3UFF A;  2RHO A;  5JCO A;  3E2I A;  2RHH A;  1AN1 I;  2ORW A;  3SGB I;  3JAS A;  4LNU B;  5CA0 B;  3D00 A;  1PTQ A;  1SGD I;  1TBO A;  2N71 A;  4TUY B;  1FFX B;  2BTO A;  2CJS C;  4O4I A;  5EZY B;  3SGQ I;  4IHJ A;  5J2U B;  1SGP I;  1XA6 A;  2B0U C;  4WBN B;  2JW6 A;  3JAT B;  4X1Y B;  3PDN A;  4YJ3 A;  4IIJ B;  1U5K A;  1SGY I;  3JAK B;  1LR9 A;  2P6A C;  1TUB A;  2N1A B;  3RYI A;  4X1I B;  4YJ2 A;  4TV9 A;  1SA0 A;  4SGB I;  5HI7 A;  2ODD A;  3CB2 A;  3HKD A;  1IY5 A;  1W59 A;  3WGM A;  2K9H A;  4F6R A;  4U39 A;  5JHW C;  3HKC B;  4X20 B;  1OMU A;  3WGL A;  2JYY A;  3BJI A;  3JAW B;  1FAQ A;  4DRX B;  1OVO A;  3VOB A;  2BUS A;  1BUS A;  2VAM A;  4UXJ A;  1IY6 A;  5J2T A;  2QQD A;  4I55 A;  2NU3 I;  4O4H A;  4I4T A;  1UUC A;  5IJ0 B;  4X1K B;  2SGD I;  5EIB D;  5LA6 A;  5FUV A;  1W5A A;  3RYC A;  2R75 1;  1LR8 A;  3VDP A;  3HKB B;  3SEK C;  1KBE A;  3QTL D;  5C8Y B;  5JH7 A;  2OD1 A;  1FAR A;  1CT0 I;  1XBT A;  1JFF A;  3KY9 A;  2YUU A;  2ELI A;  1IW4 A;  1TBR R;  4ZOL B;  4ZI7 A;  3C8L A;  1LR7 A;  5JCO C;  5KMG A;  4YJ2 B;  1RQ7 A;  2DIP A;  4WBN A;  4E1P A;  1UVG A;  4X1Y A;  3B4V C;  3MEK A;  5JQG B;  2QQ0 A;  2W0T A;  4ZHQ A;  4IIJ A;  3E22 A;  2QQC A;  3VE5 A;  1M8B A;  1R79 A;  5FUW A;  5IJ9 B;  5EX0 A;  2VXY A;  1Y8F A;  1TVK A;  2V53 A;  1H0Z A;  4DRX A;  4HGU A;  4TV9 B;  2LEO A;  5EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...