2GVIA

Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords conserved hypothetical protein
total genus 51
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3320.10 Mainly Alpha Orthogonal Bundle pa2218 like fold pa2218 like domain 2gviA01
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gviA03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2gviA02
1OFUA 5FUYA 1TVKA 5LXTB 3HKCB 5C8YA 4I55A 3WGNA 4DRXA 5BMVA 3WGJA 1FFXA 2B8TA 4U39A 4YJ3B 4DXDA 1W4RA 5MN6A 1FAQA 1PTQA 3HKDA 1TBOA 4X1YB 5GONB 1JFFA 2UZ3A 2Q1YA 5CA0A 2VAWA 4IIJB 4O2AA 4O2BB 3N2GA 4TUYB 2VAPA 2BTOA 5FNVB 5FUVA 5JH7B 4TV9B 3RYCA 4KWEA 1W5FA 3JARB 4O4JA 3HKBB 4U3JA 5IJ0A 3RYIA 1XA6A 2RHHA 4O4IA 2ELIA 3WGMA 4B46A 2E73A 4WBNB 5MN4A 3N2KA 4YJ2A 4I50B 5CB4A 3UT5A 5CA1A 5IYZB 1TVKB 1SA0A 4ZI7B 4I4TA 5EZYA 5LA6A 4DRXB 2ORVA 1TUBB 5C8YB 3BJIA 4O4HB 5EYPB 3JAKB 4EB6B 4ZHQA 3UGIA 4X1IB 2R6R1 4IHJB 3UFFA 3JAWA 1Y8FA 2J9RA 3CXLA 3HKDB 5GONA 4X1YA 1W5BA 4I55B 4IIJA 4O2AB 5BMVB 2VXYA 4TV8B 1TBNA 1FFXB 3VO8A 5FUXA 3UGDA 3HKEB 3VOBA 3CB2A 3JATB 5IJ9B 3RYIB 4UXJA 5LYJB 3N2KB 5CB4B 5LP6C 3UEYA 5KMGB 2ENNA 4ZI7A 4ZOLA 1FSZA 4X20B 3RYFB 4TUYA 5FNVA 5JH7A 5JCOC 3UGLA 2GVIA 4TV9A 5LP6B 3JARA 5IJ0B 4X1IA 4IHJA 4M8IA 1KBFA 1R79A 1RQ7A 4YJ2B 2QQEA 3JASB 4B45A 4O4LA 2Q1XA 4I4TB 3E2IA 5EZYB 3JALA 5LA6B 1TUBA 5JQGB 5LOVB 2QQ0A 5EYPA 3JAKA 2ROWA 4UXIA 4ZHQB 1W5AA 3HKEA 2J87A 2JA1A 5IJ9A 3KY9A 1Z5VA 2FNFX 5LYJA 3UEJA 4X1KA 5KMGA 4ZOLB 4TV8A 2ENZA 2VAMA 4HNAA 4LNUA 1KBEA 5EIBC 4F6RA 5ITZA 5J2TA 3JATA 4WBNA 2DB6A 5J2UB 5JVDB 3JASA 4O4LB 1RQ2A 4L9MA 3HKCA 4X20A 3RYFA 3JALB 2QPOA 5JQGA 3RYHA 2RHOA 1W59A 5EIBD 4YJ3A 2ORWA 1RFHA 5LP6A 2BTQB 3E22A 5JCOA 5FUWA 1Z5WA 5KX5A 4FFBB 4LNUB 2YUUA 4X1KB 5LXTA 5CA0B 5LOVA 3N2GB 3WGLA 3VOAA 3RYCB 4F6RB 1W581 4O4JB 5ITZB 5J2TB 4FKDA 2RHJA 4O4IB 3WGKA 5MN5A 5J2UA 2R751 2WVJA 1JFFB 1W5EA 4E6EA 1RLUA 5CA1B 5IYZA 1SA0B 4O2BA 4UXHA 4HNAB 1XBTA 3RYHB 2VRWB 4O4HA 4EB6A 1FARA 5JVDA 1PTRA 3C8LA 3HKBA 4U3JB 3E22B 3JAWB 5KX5B 4B6DA 2RHLA 4FFBA 1XX6A 4I50A 3UT5B
chains in the Genus database with same CATH superfamily
2OU2A 1OFUA 3M4SA 1SGEI 2JXDA 3WGNA 1KQSF 5BMVA 2HP0B 3C9UA 4U39A 4DXDA 1TBQR 1FAQA 1HEVA 5GONB 1GO0A 2P6AC 4X1YB 3SGBI 2AMTA 3F6MA 3VI6A 3S0YA 1JFFA 1W2BF 1TOTA 3NVKE 1H47A 2VAWA 4O2BB 1U5KA 3S0HA 4TUYB 5FNVB 4ZHYB 5FUVA 3HWUA 1Q81H 1W5FA 2RHHA 4O4IA 4YJ2A 3F0DA 3F0GA 3OONA 1K73H 3EORA 2L8EA 4G4YA 1VQNF 1WKXA 2UVOA 1XRGA 2IG8A 3CG6A 4O4HB 5EYPB 5A2QM 4OVOA 3UGIA 3N4YA 4PWTA 5HY1A 5EX3A 1M1KH 3G71F 2WGCA 2OZUA 3S03A 1YJWF 2JYYA 4IIJA 5BMVB 4TV8B 1BUSA 2HP0A 1CT4I 2YYEA 5HWEA 5IJ9B 3RYIB 3CCJF 4UXJA 1IV1A 2Z1FA 1U3LA 2H6LA 5CB4B 5LP6C 3CC4F 2DYYA 4X20B 3LWQC 1KNKA 2ZOVA 4TUYA 5FNVA 3R0PA 5JCOC 3UGLA 3I56F 1W57A 1ZWZA 4X1IA 3R5CA 2HX0A 4IHJA 3OXLA 4YJ2B 3K2XA 1AN1I 4C8EA 1PJUA 2N1AB 4B45A 1VQPF 1CT0I 2G9IA 3JALA 1V1HA 2QQ0A 5GANK 5EYPA 1M8BA 3HH2C 1CGII 2JA1A 3S02A 3S0WA 3KY9A 1Z5VA 2FNFX 1X25A 1COMA 1PPFI 1CE3A 1TIHA 1UVGA 2I6DA 3ESJA 4TV8A 4ZOLB 3WPXA 5G4VC 1VQOF 2RC4A 1VQ9F 2PQ8A 5ITZA 1DS3I 1N13A 2ZAUA 3CYPB 3P10A 5E3RA 2GKRI 5J2UB 3OVOA 3WXMB 3C9RA 2OZBA 4X20A 3CMAF 1N8RH 3OBYA 1YJ9F 3IEWA 3J80M 2RIJA 1VQVA 1Q8RA 2ZF8A 3QHDA 5EIBD 2OTLF 2ORWA 1CN7A 5G4UC 5FUWA 4BVQA 1VQKF 3DC2A 1WGTA 4LNUB 3VYSC 4X1KB 3Q8HA 2BTUA 4HGUA 1VQ6F 3SGQI 1ONIA 1UHAA 2FGYA 1MT1A 1W581 3NK7A 4BT5A 2ODDA 2WVJA 2ZVYA 1RLUA 1S20A 2KMRA 4UXHA 5GIOC 4EI8A 1Q9BA 3MBMA 2KMQA 2CWFA 3DDNA 5B8FA 1PTRA 3C8LA 4U3JB 2SGQI 4G4ZA 3C9SA 1PCEA 2RHLA 4FFBA 3ON1A 3TO9A 4I50A 1GZ0A 2QQDA 5LXTB 1KMAA 1SGPI 3E59A 2HS3A 2OTMA 2B8TA 1NMUB 4RHAA 2NU3I 5DAEA 4G4VA 3J81M 3TD3A 3V3TA 2P6YA 2PMPA 2V1CA 2UZ3A 2Q1YA 3ZO8A 1JY8A 3O85A 3JVHA 2BTOA 5JH7B 4TV9B 2DT4A 4KWEA 3OXGA 3JARB 3QTLD 3UOEA 2A20A 3WGMA 4BT4A 3FSYA 2VGMA 3CC2F 4WBNB 2KMPA 3N2KA 1ULMA 3IMPA 2WCYA 1VK3A 3HTNA 3U0OA 5GIPC 3BJIA 3NK6A 3FD5A 1LR7A 3WJRA 4ZHQA 3MQWA 3UFFA 3V7EA 1VQ5F 5GONA 4X1YA 2UYKA 1RLGA 4NWOB 1W5BA 1X74A 2LUYA 4C8GA 1GX1A 3CCQF 1M8CA 2B0UC 2DIPA 1H7MA 3E1YA 2X3TA 2K1SA 2L26A 2QA4F 2K9HA 5LYJB 2ENNA 3MCQA 3G6EF 5JH7A 4G88A 1YJNF 4TV9A 3TD4A 2IQQA 1VQMF 3JARA 4TZZA 2ARPF 1LR9A 5HXZA 2KGWA 1RQ7A 2QQEA 3L7QA 1Q7YH 5JQGB 2KMOA 3CCRF 3CCVF 5IT9M 2QTPA 5DCVA 1R0RI 3PAFA 3F0FA 1W55A 4A24A 4ZHQB 1VQLF 1R1MA 3NMUC 2J87A 5IJ9A 3I55F 4XCQA 1IY5A 1KD1H 1CSOI 3VMFB 2NU2I 3K12A 1CHOI 1KBEA 1U3PA 3RA5A 4F6RA 1J7HA 3B4VC 1CLIA 2HRUA 5E3QA 3VCZA 1KC8H 4L9MA 3HKCA 1SDSA 2NU1I 3JALB 1T0KB 2F3CI 5CCMA 1YIJF 1YGYA 3R5AA 1K7VA 2OTJF 7WGAA 1Z5WA 5KX5A 2HP3A 1RA4A 2YUUA 1ULKA 2LEOA 4GI3C 3QTYA 3N2GB 5EX0A 2JZMA 2SGFI 2JNBA 4WP4A 2V9YA 2NU4I 2UYNB 5ITZB 3KHNA 5GINC 1HDLA 4EI9A 1KNJA 3C9TA 2Z1EA 3WGKA 1YTPA 5J2UA 3CPWF 2EWCA 3SIVA 4E6EA 5CA1B 4R40B 1SGYI 3RA6A 3LWVC 4E1PA 1NQ3A 2CHSA 1SGNI 4EB6A 1FARA 3P0ZA 5HY0A 2E5RA 3TOAA 3HKBA 3FD6A 4LNUA 1W3SA 3UT5B 3R5BA 3M84A 5FUYA 1TVKA 3F0EA 3HKCB 5C8YA 4I55A 4DRXA 2JW6A 3ERNA 1FFXA 1NJIH 5EB0A 1YI2F 3ZP4A 1W4RA 1Z2IA 1JJ2F 3IR9A 3HKDA 2GLZA 3HJWC 3GOXA 2Z1TA 3FPIA 3K0TA 5E3PA 4B5CA 4O2AA 4ZK7A 3N2GA 3QAHA 2VAPA 4JCVE 5GAPK 2UYNA 5HI7A 5IJ0A 3VDUA 4U3JA 3VYTC 3CYQA 1VQ7F 3AGKA 2ELIA 4B46A 1OAPA 2E73A 2OD1A 4DNCA 4I50B 2QEXF 2X52A 5CA1A 3PDNA 1NXUA 3OBWA 4ZI7B 4I4TA 5EZYA 1TUBB 5J8CA 4BW0B 2CWGA 4EB6B 5JHWC 3JAKB 1QVFF 1S72F 3CCEF 3MEKA 1Y8FA 3V4DA 3CXLA 3QUWA 1QU9A 1YHQF 4I55B 2WALA 1YQNA 1TBNA 1FFXB 1LR8A 3UGDA 2HQSC 3HKEB 3VYUC 1OYVI 4C81A 1FYBA 3N2KB 2QQCA 4X3LA 3UEYA 1X52A 3KJJA 1CT2I 5KMGB 1FSZA 1CGJI 3RYFB 1DS2I 2GVIA 2LB7A 5LP6B 5IJ0B 4ZHWA 3IEQA 4M8IA 1R79A 3TOBA 1P9ZA 3JASB 3IKFA 4O4LA 1BMOA 2CHTA 3KIZA 2Q1XA 4I4TB 5EZYB 1TUBA 5LOVB 3GTZA 3T80A 2W8BC 3JAKA 2HVYD 3ZP7A 3R5DA 3CD6F 1TUSA 1YU6C 3MDOA 3K14A 2GIVA 2CZWA 2V1CC 5LYJA 2PHNA 1IPAA 1DT9A 4C82A 4BT3A 3CCLF 2ENZA 2VAMA 4HNAA 5CCLA 2ZODA 5EIBC 3D54A 4G4XA 3TO6A 2ZVZA 1PXWA 3LWPC 5J2TA 4C4WC 1MJAA 4RQOA 1FNKA 3RYFA 5JQGA 3VTIC 2UYPA 3RYHA 3E20B 1JD1A 1XBIA 3CCSF 3TO7A 4YJ3A 5LP6A 2BO1A 3E22A 5JCOA 2GKVA 3N4ZA 3NVIB 1IW4A 2Y0MA 5EWRA 3PLAC 3WJPA 3LYBA 5CA0B 1TGSI 1GO1A 5HXUA 5LOVA 3CXCF 1X4SA 2N48A 3GYQA 3VOAA 4F6RB 3RYCB 4O4JB 2Z01A 2CSLA 1QAHA 5AVMA 3RE3A 2KTVA 1JFFB 5IYZA 2CJSC 1SA0B 3LWRC 4O2BA 4HNAB 2ERWA 3B6NA 2VRWB 3FC3A 3JAMM 3ZOPA 5JVDA 3SIUA 1SGRI 1OMTA 1X7PA 3JAWB 4X3MA 1FNJA 5KX5B 2RB9A 1YITF 1V1IA 2ALEA 2V53A 2OHWA 2UZHA 5HY4A 2N17A 2YQPA 4NUTA 3KE1A 2LBTA 2IAFA 3WGJA 1IV2A 1XV2A 4BVSA 4YJ3B 2N71A 5MN6A 4EI7A 1IY6A 3OW2F 1PTQA 4ERHA 1TBOA 1UUCA 2HS4A 1U43A 2HRYA 5CA0A 1U40A 4IIJB 1IV4A 4G4WA 2L7XA 1TURA 1OMUA 3RYCA 4MPIA 1SGDI 3IKEA 4O4JA 2H8CA 3HKBB 3OXFA 1XA6A 2H8EA 3RYIA 1VDDA 9WGAA 4BVRA 5MN4A 1K9MH 4AMLA 3I7TA 2GZLA 3UT5A 4C8IA 1TVKB 1SA0A 5CB4A 1IV3A 5LA6A 2MQEA 5IYZB 3FSXA 2ORVA 4DRXB 5C8YB 2LBXA 3MCAB 1XHOA 2LCAA 4X1IB 3HAXD 2R6R1 3GHZA 3JAWA 4IHJB 2J9RA 3SEKC 2AIFA 3HKDB 4B62A 2W0TA 1QVGF 1UVFA 4BY9D 1Z7KB 4O2AB 2AIZP 2VXYA 4E1RA 3VO8A 1T0AA 5FUXA 1QD9A 1PF5A 1ULNA 1X7OA 2F9ZC 3WPWA 3VOBA 3OL0A 3CB2A 3JATB 2CW4A 5HP7A 1SGQI 1P9GA 3LDTA 1Y1CA 1WGCA 2B33A 4ZI7A 1VQ8F 4ZOLA 4BT7A 1JN1A 1OVOA 1W40A 2Z1UA 1VHAA 2SGDI 3CCMF 3QWPA 1Y1BA 4LCKA 3LFOA 1KBFA 2DKVA 4ZHVA 2GKTI 2KCXA 2QI2A 3M1XA 2CWHA 1MJ9A 3ELCA 4SGBI 3I3FA 5EAZA 5LA6B 3LWOC 3E2IA 3CC7F 1H0ZA 1DBFA 1E7KA 2SGPI 1NUBA 1CK2A 3WJQA 2ROWA 1W3EX 4UXIA 5HP8A 1W5AA 1K7UA 3HKEA 3KJKA 5FLXM 1TBRR 1HJAI 3V7QA 1SZQA 3UEJA 4X1KA 1K8AH 5KMGA 2NU0I 5EO3A 3TD5A 1Q82H 5J8FA 2N52A 2CWJA 2I6RA 2UYJA 1Q86H 3BYQA 2CVLA 3JATA 1W41A 3J7AR 2DB6A 2KTUA 4BVTA 5EB1B 5JVDB 3JASA 4O4LB 3D00A 1RQ2A 1FY7A 5HY2A 2QPOA 3RU0A 3VDPA 3P4EA 1UFYA 3CMEF 2RHOA 2SGEI 1W59A 1W42A 1RFHA 1VQ4F 2BTQB 3VE5A 3S06A 2FC3A 3VIUA 2KG4A 4FFBB 2NMUA 5LXTA 2VGNA 2YXZA 1WTJA 2BUSA 2XRCA 4BT6A 3WGLA 4NQ3A 4BT2A 3FFMA 1K7TA 5J2TB 2LBWA 2M5XA 4FKDA 2RHJA 4O4IB 5MN5A 3CCUF 2R751 1W5EA 1H48A 1HPTA 3JCMM 1XBTA 3RYHB 3FBAA 4O4HA 3G4SF 1VH8A 2OVOA 3D01A 5HQ8A 2HS0A 3E22B 3LMEA 5FJ4C 1UI9A 1MJBA 4B6DA 4WBNA 3TJQA 3CPQA 1XX6A 1M90H 1ODEA
chains in the Genus database with same CATH topology
1OFUA 1SGEI 2JXDA 3WGNA 5BMVA 4U39A 4DXDA 1TBQR 1FAQA 5GONB 2P6AC 4X1YB 3SGBI 1JFFA 1TOTA 2VAWA 4O2BB 1U5KA 4TUYB 5FNVB 5FUVA 1W5FA 2RHHA 4O4IA 4YJ2A 2L8EA 4O4HB 5EYPB 4OVOA 3UGIA 5EX3A 2JYYA 4IIJA 5BMVB 4TV8B 1BUSA 1CT4I 5IJ9B 3RYIB 4UXJA 5CB4B 5LP6C 4X20B 4TUYA 5FNVA 5JCOC 3UGLA 4X1IA 4IHJA 3OXLA 4YJ2B 1AN1I 1PJUA 2N1AB 4B45A 1CT0I 3JALA 1V1HA 2QQ0A 5EYPA 1M8BA 3HH2C 1CGII 2JA1A 3KY9A 1Z5VA 2FNFX 1PPFI 1CE3A 4ZOLB 4TV8A 1TIHA 1UVGA 5ITZA 1DS3I 1N13A 2GKRI 5J2UB 3OVOA 4X20A 5EIBD 2ORWA 5FUWA 4LNUB 4X1KB 4HGUA 3SGQI 1MT1A 1W581 2ODDA 2WVJA 1RLUA 2KMRA 4UXHA 2KMQA 1PTRA 3C8LA 4U3JB 2SGQI 2RHLA 1PCEA 4FFBA 4I50A 2QQDA 5LXTB 1KMAA 1SGPI 3E59A 2B8TA 2NU3I 5DAEA 2V1CA 2UZ3A 2Q1YA 2BTOA 5JH7B 4TV9B 4KWEA 3OXGA 3JARB 3QTLD 2A20A 3WGMA 4WBNB 2KMPA 3N2KA 2WCYA 3BJIA 1LR7A 4ZHQA 3UFFA 5GONA 4X1YA 1W5BA 1X74A 2LUYA 1M8CA 2B0UC 2DIPA 2K9HA 5LYJB 2ENNA 5JH7A 4TV9A 3JARA 2ARPF 1LR9A 1RQ7A 2QQEA 5JQGB 2KMOA 1R0RI 4ZHQB 4A24A 2J87A 5IJ9A 1IY5A 1CSOI 2NU2I 1CHOI 1KBEA 4F6RA 3B4VC 4L9MA 3HKCA 2NU1I 3JALB 2F3CI 5CCMA 1Z5WA 5KX5A 2YUUA 2LEOA 4GI3C 3N2GB 5EX0A 2JZMA 2SGFI 2NU4I 5ITZB 1HDLA 3WGKA 1YTPA 5J2UA 4E6EA 5CA1B 1SGYI 4E1PA 1SGNI 4EB6A 1FARA 2E5RA 3HKBA 4LNUA 1W3SA 3UT5B 5FUYA 1TVKA 3HKCB 5C8YA 4I55A 4DRXA 2JW6A 1FFXA 1W4RA 3HKDA 3GOXA 4O2AA 3N2GA 2VAPA 4JCVE 5HI7A 5IJ0A 3VDUA 4U3JA 2ELIA 4B46A 2E73A 2OD1A 4I50B 5CA1A 3PDNA 4ZI7B 4I4TA 5EZYA 1TUBB 4EB6B 5JHWC 3JAKB 3MEKA 1Y8FA 3CXLA 4I55B 1TBNA 1FFXB 1LR8A 3UGDA 3HKEB 1OYVI 1FYBA 3N2KB 2QQCA 3UEYA 5KMGB 1CT2I 1FSZA 1CGJI 3RYFB 1DS2I 2GVIA 5LP6B 5IJ0B 4M8IA 1R79A 3JASB 4O4LA 1BMOA 2Q1XA 4I4TB 5EZYB 1TUBA 5LOVB 3JAKA 1TUSA 1YU6C 2V1CC 5LYJA 2ENZA 2VAMA 4HNAA 5CCLA 5EIBC 5J2TA 3RYFA 5JQGA 3RYHA 4YJ3A 5LP6A 3E22A 5JCOA 2GKVA 1IW4A 5CA0B 1TGSI 5LOVA 1X4SA 3VOAA 3RYCB 4F6RB 4O4JB 1JFFB 5IYZA 2CJSC 1SA0B 4O2BA 4HNAB 2ERWA 2VRWB 3FC3A 5JVDA 1SGRI 1OMTA 3JAWB 5KX5B 1V1IA 2V53A 2N17A 2YQPA 3WGJA 4YJ3B 2N71A 5MN6A 1IY6A 1PTQA 1TBOA 1UUCA 5CA0A 4IIJB 2L7XA 1TURA 1OMUA 3RYCA 1SGDI 4O4JA 3HKBB 3OXFA 1XA6A 3RYIA 5MN4A 1VDDA 5CB4A 3UT5A 5IYZB 1TVKB 1SA0A 5LA6A 4DRXB 2ORVA 5C8YB 4X1IB 2R6R1 4IHJB 3JAWA 2J9RA 3SEKC 3HKDB 2W0TA 1UVFA 1Z7KB 4O2AB 2VXYA 4E1RA 3VO8A 5FUXA 3VOBA 3OL0A 3CB2A 3JATB 1SGQI 1Y1CA 4ZI7A 4ZOLA 1OVOA 2SGDI 3QWPA 1Y1BA 1KBFA 2GKTI 2KCXA 4SGBI 5LA6B 3E2IA 1H0ZA 2SGPI 1NUBA 2ROWA 4UXIA 1W5AA 3HKEA 1TBRR 1HJAI 3UEJA 4X1KA 5KMGA 2NU0I 2N52A 3JATA 2DB6A 5JVDB 3JASA 4O4LB 3D00A 1RQ2A 2QPOA 3RU0A 3VDPA 2RHOA 2SGEI 1W59A 1RFHA 2BTQB 3VE5A 4FFBB 5LXTA 2BUSA 2XRCA 3WGLA 5J2TB 2M5XA 4FKDA 2RHJA 4O4IB 5MN5A 2R751 1W5EA 1HPTA 1XBTA 3RYHB 4O4HA 2OVOA 5HQ8A 3E22B 4B6DA 4WBNA 3TJQA 1XX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFU A;  5FUY A;  1TVK A;  5LXT B;  3HKC B;  5C8Y A;  4I55 A;  3WGN A;  4DRX A;  5BMV A;  3WGJ A;  1FFX A;  2B8T A;  4U39 A;  4YJ3 B;  4DXD A;  1W4R A;  5MN6 A;  1FAQ A;  1PTQ A;  3HKD A;  1TBO A;  4X1Y B;  5GON B;  1JFF A;  2UZ3 A;  2Q1Y A;  5CA0 A;  2VAW A;  4IIJ B;  4O2A A;  4O2B B;  3N2G A;  4TUY B;  2VAP A;  2BTO A;  5FNV B;  5FUV A;  5JH7 B;  4TV9 B;  3RYC A;  4KWE A;  1W5F A;  3JAR B;  4O4J A;  3HKB B;  4U3J A;  5IJ0 A;  3RYI A;  1XA6 A;  2RHH A;  4O4I A;  2ELI A;  3WGM A;  4B46 A;  2E73 A;  4WBN B;  5MN4 A;  3N2K A;  4YJ2 A;  4I50 B;  5CB4 A;  3UT5 A;  5CA1 A;  5IYZ B;  1TVK B;  1SA0 A;  4ZI7 B;  4I4T A;  5EZY A;  5LA6 A;  4DRX B;  2ORV A;  1TUB B;  5C8Y B;  3BJI A;  4O4H B;  5EYP B;  3JAK B;  4EB6 B;  4ZHQ A;  3UGI A;  4X1I B;  2R6R 1;  4IHJ B;  3UFF A;  3JAW A;  1Y8F A;  2J9R A;  3CXL A;  3HKD B;  5GON A;  4X1Y A;  1W5B A;  4I55 B;  4IIJ A;  4O2A B;  5BMV B;  2VXY A;  4TV8 B;  1TBN A;  1FFX B;  3VO8 A;  5FUX A;  3UGD A;  3HKE B;  3VOB A;  3CB2 A;  3JAT B;  5IJ9 B;  3RYI B;  4UXJ A;  5LYJ B;  3N2K B;  5CB4 B;  5LP6 C;  3UEY A;  5KMG B;  2ENN A;  4ZI7 A;  4ZOL A;  1FSZ A;  4X20 B;  3RYF B;  4TUY A;  5FNV A;  5JH7 A;  5JCO C;  3UGL A;  2GVI A;  4TV9 A;  5LP6 B;  3JAR A;  5IJ0 B;  4X1I A;  4IHJ A;  4M8I A;  1KBF A;  1R79 A;  1RQ7 A;  4YJ2 B;  2QQE A;  3JAS B;  4B45 A;  4O4L A;  2Q1X A;  4I4T B;  3E2I A;  5EZY B;  3JAL A;  5LA6 B;  1TUB A;  5JQG B;  5LOV B;  2QQ0 A;  5EYP A;  3JAK A;  2ROW A;  4UXI A;  4ZHQ B;  1W5A A;  3HKE A;  2J87 A;  2JA1 A;  5IJ9 A;  3KY9 A;  1Z5V A;  2FNF X;  5LYJ A;  3UEJ A;  4X1K A;  5KMG A;  4ZOL B;  4TV8 A;  2ENZ A;  2VAM A;  4HNA A;  4LNU A;  1KBE A;  5EIB C;  4F6R A;  5ITZ A;  5J2T A;  3JAT A;  4WBN A;  2DB6 A;  5J2U B;  5JVD B;  3JAS A;  4O4L B;  1RQ2 A;  4L9M A;  3HKC A;  4X20 A;  3RYF A;  3JAL B;  2QPO A;  5JQG A;  3RYH A;  2RHO A;  1W59 A;  5EIB D;  4YJ3 A;  2ORW A;  1RFH A;  5LP6 A;  2BTQ B;  3E22 A;  5JCO A;  5FUW A;  1Z5W A;  5KX5 A;  4FFB B;  4LNU B;  2YUU A;  4X1K B;  5LXT A;  5CA0 B;  5LOV A;  3N2G B;  3WGL A;  3VOA A;  3RYC B;  4F6R B;  1W58 1;  4O4J B;  5ITZ B;  5J2T B;  4FKD A;  2RHJ A;  4O4I B;  3WGK A;  5MN5 A;  5J2U A;  2R75 1;  2WVJ A;  1JFF B;  1W5E A;  4E6E A;  1RLU A;  5CA1 B;  5IYZ A;  1SA0 B;  4O2B A;  4UXH A;  4HNA B;  1XBT A;  3RYH B;  2VRW B;  4O4H A;  4EB6 A;  1FAR A;  5JVD A;  1PTR A;  3C8L A;  3HKB A;  4U3J B;  3E22 B;  3JAW B;  5KX5 B;  4B6D A;  2RHL A;  4FFB A;  1XX6 A;  4I50 A;  3UT5 B; 
#chains in the Genus database with same CATH topology
 2OU2 A;  1OFU A;  3M4S A;  1SGE I;  2JXD A;  3WGN A;  1KQS F;  5BMV A;  2HP0 B;  3C9U A;  4U39 A;  4DXD A;  1TBQ R;  1FAQ A;  1HEV A;  5GON B;  1GO0 A;  2P6A C;  4X1Y B;  3SGB I;  2AMT A;  3F6M A;  3VI6 A;  3S0Y A;  1JFF A;  1W2B F;  1TOT A;  3NVK E;  1H47 A;  2VAW A;  4O2B B;  1U5K A;  3S0H A;  4TUY B;  5FNV B;  4ZHY B;  5FUV A;  3HWU A;  1Q81 H;  1W5F A;  2RHH A;  4O4I A;  4YJ2 A;  3F0D A;  3F0G A;  3OON A;  1K73 H;  3EOR A;  2L8E A;  4G4Y A;  1VQN F;  1WKX A;  2UVO A;  1XRG A;  2IG8 A;  3CG6 A;  4O4H B;  5EYP B;  5A2Q M;  4OVO A;  3UGI A;  3N4Y A;  4PWT A;  5HY1 A;  5EX3 A;  1M1K H;  3G71 F;  2WGC A;  2OZU A;  3S03 A;  1YJW F;  2JYY A;  4IIJ A;  5BMV B;  4TV8 B;  1BUS A;  2HP0 A;  1CT4 I;  2YYE A;  5HWE A;  5IJ9 B;  3RYI B;  3CCJ F;  4UXJ A;  1IV1 A;  2Z1F A;  1U3L A;  2H6L A;  5CB4 B;  5LP6 C;  3CC4 F;  2DYY A;  4X20 B;  3LWQ C;  1KNK A;  2ZOV A;  4TUY A;  5FNV A;  3R0P A;  5JCO C;  3UGL A;  3I56 F;  1W57 A;  1ZWZ A;  4X1I A;  3R5C A;  2HX0 A;  4IHJ A;  3OXL A;  4YJ2 B;  3K2X A;  1AN1 I;  4C8E A;  1PJU A;  2N1A B;  4B45 A;  1VQP F;  1CT0 I;  2G9I A;  3JAL A;  1V1H A;  2QQ0 A;  5GAN K;  5EYP A;  1M8B A;  3HH2 C;  1CGI I;  2JA1 A;  3S02 A;  3S0W A;  3KY9 A;  1Z5V A;  2FNF X;  1X25 A;  1COM A;  1PPF I;  1CE3 A;  1TIH A;  1UVG A;  2I6D A;  3ESJ A;  4TV8 A;  4ZOL B;  3WPX A;  5G4V C;  1VQO F;  2RC4 A;  1VQ9 F;  2PQ8 A;  5ITZ A;  1DS3 I;  1N13 A;  2ZAU A;  3CYP B;  3P10 A;  5E3R A;  2GKR I;  5J2U B;  3OVO A;  3WXM B;  3C9R A;  2OZB A;  4X20 A;  3CMA F;  1N8R H;  3OBY A;  1YJ9 F;  3IEW A;  3J80 M;  2RIJ A;  1VQV A;  1Q8R A;  2ZF8 A;  3QHD A;  5EIB D;  2OTL F;  2ORW A;  1CN7 A;  5G4U C;  5FUW A;  4BVQ A;  1VQK F;  3DC2 A;  1WGT A;  4LNU B;  3VYS C;  4X1K B;  3Q8H A;  2BTU A;  4HGU A;  1VQ6 F;  3SGQ I;  1ONI A;  1UHA A;  2FGY A;  1MT1 A;  1W58 1;  3NK7 A;  4BT5 A;  2ODD A;  2WVJ A;  2ZVY A;  1RLU A;  1S20 A;  2KMR A;  4UXH A;  5GIO C;  4EI8 A;  1Q9B A;  3MBM A;  2KMQ A;  2CWF A;  3DDN A;  5B8F A;  1PTR A;  3C8L A;  4U3J B;  2SGQ I;  4G4Z A;  3C9S A;  1PCE A;  2RHL A;  4FFB A;  3ON1 A;  3TO9 A;  4I50 A;  1GZ0 A;  2QQD A;  5LXT B;  1KMA A;  1SGP I;  3E59 A;  2HS3 A;  2OTM A;  2B8T A;  1NMU B;  4RHA A;  2NU3 I;  5DAE A;  4G4V A;  3J81 M;  3TD3 A;  3V3T A;  2P6Y A;  2PMP A;  2V1C A;  2UZ3 A;  2Q1Y A;  3ZO8 A;  1JY8 A;  3O85 A;  3JVH A;  2BTO A;  5JH7 B;  4TV9 B;  2DT4 A;  4KWE A;  3OXG A;  3JAR B;  3QTL D;  3UOE A;  2A20 A;  3WGM A;  4BT4 A;  3FSY A;  2VGM A;  3CC2 F;  4WBN B;  2KMP A;  3N2K A;  1ULM A;  3IMP A;  2WCY A;  1VK3 A;  3HTN A;  3U0O A;  5GIP C;  3BJI A;  3NK6 A;  3FD5 A;  1LR7 A;  3WJR A;  4ZHQ A;  3MQW A;  3UFF A;  3V7E A;  1VQ5 F;  5GON A;  4X1Y A;  2UYK A;  1RLG A;  4NWO B;  1W5B A;  1X74 A;  2LUY A;  4C8G A;  1GX1 A;  3CCQ F;  1M8C A;  2B0U C;  2DIP A;  1H7M A;  3E1Y A;  2X3T A;  2K1S A;  2L26 A;  2QA4 F;  2K9H A;  5LYJ B;  2ENN A;  3MCQ A;  3G6E F;  5JH7 A;  4G88 A;  1YJN F;  4TV9 A;  3TD4 A;  2IQQ A;  1VQM F;  3JAR A;  4TZZ A;  2ARP F;  1LR9 A;  5HXZ A;  2KGW A;  1RQ7 A;  2QQE A;  3L7Q A;  1Q7Y H;  5JQG B;  2KMO A;  3CCR F;  3CCV F;  5IT9 M;  2QTP A;  5DCV A;  1R0R I;  3PAF A;  3F0F A;  1W55 A;  4A24 A;  4ZHQ B;  1VQL F;  1R1M A;  3NMU C;  2J87 A;  5IJ9 A;  3I55 F;  4XCQ A;  1IY5 A;  1KD1 H;  1CSO I;  3VMF B;  2NU2 I;  3K12 A;  1CHO I;  1KBE A;  1U3P A;  3RA5 A;  4F6R A;  1J7H A;  3B4V C;  1CLI A;  2HRU A;  5E3Q A;  3VCZ A;  1KC8 H;  4L9M A;  3HKC A;  1SDS A;  2NU1 I;  3JAL B;  1T0K B;  2F3C I;  5CCM A;  1YIJ F;  1YGY A;  3R5A A;  1K7V A;  2OTJ F;  7WGA A;  1Z5W A;  5KX5 A;  2HP3 A;  1RA4 A;  2YUU A;  1ULK A;  2LEO A;  4GI3 C;  3QTY A;  3N2G B;  5EX0 A;  2JZM A;  2SGF I;  2JNB A;  4WP4 A;  2V9Y A;  2NU4 I;  2UYN B;  5ITZ B;  3KHN A;  5GIN C;  1HDL A;  4EI9 A;  1KNJ A;  3C9T A;  2Z1E A;  3WGK A;  1YTP A;  5J2U A;  3CPW F;  2EWC A;  3SIV A;  4E6E A;  5CA1 B;  4R40 B;  1SGY I;  3RA6 A;  3LWV C;  4E1P A;  1NQ3 A;  2CHS A;  1SGN I;  4EB6 A;  1FAR A;  3P0Z A;  5HY0 A;  2E5R A;  3TOA A;  3HKB A;  3FD6 A;  4LNU A;  1W3S A;  3UT5 B;  3R5B A;  3M84 A;  5FUY A;  1TVK A;  3F0E A;  3HKC B;  5C8Y A;  4I55 A;  4DRX A;  2JW6 A;  3ERN A;  1FFX A;  1NJI H;  5EB0 A;  1YI2 F;  3ZP4 A;  1W4R A;  1Z2I A;  1JJ2 F;  3IR9 A;  3HKD A;  2GLZ A;  3HJW C;  3GOX A;  2Z1T A;  3FPI A;  3K0T A;  5E3P A;  4B5C A;  4O2A A;  4ZK7 A;  3N2G A;  3QAH A;  2VAP A;  4JCV E;  5GAP K;  2UYN A;  5HI7 A;  5IJ0 A;  3VDU A;  4U3J A;  3VYT C;  3CYQ A;  1VQ7 F;  3AGK A;  2ELI A;  4B46 A;  1OAP A;  2E73 A;  2OD1 A;  4DNC A;  4I50 B;  2QEX F;  2X52 A;  5CA1 A;  3PDN A;  1NXU A;  3OBW A;  4ZI7 B;  4I4T A;  5EZY A;  1TUB B;  5J8C A;  4BW0 B;  2CWG A;  4EB6 B;  5JHW C;  3JAK B;  1QVF F;  1S72 F;  3CCE F;  3MEK A;  1Y8F A;  3V4D A;  3CXL A;  3QUW A;  1QU9 A;  1YHQ F;  4I55 B;  2WAL A;  1YQN A;  1TBN A;  1FFX B;  1LR8 A;  3UGD A;  2HQS C;  3HKE B;  3VYU C;  1OYV I;  4C81 A;  1FYB A;  3N2K B;  2QQC A;  4X3L A;  3UEY A;  1X52 A;  3KJJ A;  1CT2 I;  5KMG B;  1FSZ A;  1CGJ I;  3RYF B;  1DS2 I;  2GVI A;  2LB7 A;  5LP6 B;  5IJ0 B;  4ZHW A;  3IEQ A;  4M8I A;  1R79 A;  3TOB A;  1P9Z A;  3JAS B;  3IKF A;  4O4L A;  1BMO A;  2CHT A;  3KIZ A;  2Q1X A;  4I4T B;  5EZY B;  1TUB A;  5LOV B;  3GTZ A;  3T80 A;  2W8B C;  3JAK A;  2HVY D;  3ZP7 A;  3R5D A;  3CD6 F;  1TUS A;  1YU6 C;  3MDO A;  3K14 A;  2GIV A;  2CZW A;  2V1C C;  5LYJ A;  2PHN A;  1IPA A;  1DT9 A;  4C82 A;  4BT3 A;  3CCL F;  2ENZ A;  2VAM A;  4HNA A;  5CCL A;  2ZOD A;  5EIB C;  3D54 A;  4G4X A;  3TO6 A;  2ZVZ A;  1PXW A;  3LWP C;  5J2T A;  4C4W C;  1MJA A;  4RQO A;  1FNK A;  3RYF A;  5JQG A;  3VTI C;  2UYP A;  3RYH A;  3E20 B;  1JD1 A;  1XBI A;  3CCS F;  3TO7 A;  4YJ3 A;  5LP6 A;  2BO1 A;  3E22 A;  5JCO A;  2GKV A;  3N4Z A;  3NVI B;  1IW4 A;  2Y0M A;  5EWR A;  3PLA C;  3WJP A;  3LYB A;  5CA0 B;  1TGS I;  1GO1 A;  5HXU A;  5LOV A;  3CXC F;  1X4S A;  2N48 A;  3GYQ A;  3VOA A;  4F6R B;  3RYC B;  4O4J B;  2Z01 A;  2CSL A;  1QAH A;  5AVM A;  3RE3 A;  2KTV A;  1JFF B;  5IYZ A;  2CJS C;  1SA0 B;  3LWR C;  4O2B A;  4HNA B;  2ERW A;  3B6N A;  2VRW B;  3FC3 A;  3JAM M;  3ZOP A;  5JVD A;  3SIU A;  1SGR I;  1OMT A;  1X7P A;  3JAW B;  4X3M A;  1FNJ A;  5KX5 B;  2RB9 A;  1YIT F;  1V1I A;  2ALE A;  2V53 A;  2OHW A;  2UZH A;  5HY4 A;  2N17 A;  2YQP A;  4NUT A;  3KE1 A;  2LBT A;  2IAF A;  3WGJ A;  1IV2 A;  1XV2 A;  4BVS A;  4YJ3 B;  2N71 A;  5MN6 A;  4EI7 A;  1IY6 A;  3OW2 F;  1PTQ A;  4ERH A;  1TBO A;  1UUC A;  2HS4 A;  1U43 A;  2HRY A;  5CA0 A;  1U40 A;  4IIJ B;  1IV4 A;  4G4W A;  2L7X A;  1TUR A;  1OMU A;  3RYC A;  4MPI A;  1SGD I;  3IKE A;  4O4J A;  2H8C A;  3HKB B;  3OXF A;  1XA6 A;  2H8E A;  3RYI A;  1VDD A;  9WGA A;  4BVR A;  5MN4 A;  1K9M H;  4AML A;  3I7T A;  2GZL A;  3UT5 A;  4C8I A;  1TVK B;  1SA0 A;  5CB4 A;  1IV3 A;  5LA6 A;  2MQE A;  5IYZ B;  3FSX A;  2ORV A;  4DRX B;  5C8Y B;  2LBX A;  3MCA B;  1XHO A;  2LCA A;  4X1I B;  3HAX D;  2R6R 1;  3GHZ A;  3JAW A;  4IHJ B;  2J9R A;  3SEK C;  2AIF A;  3HKD B;  4B62 A;  2W0T A;  1QVG F;  1UVF A;  4BY9 D;  1Z7K B;  4O2A B;  2AIZ P;  2VXY A;  4E1R A;  3VO8 A;  1T0A A;  5FUX A;  1QD9 A;  1PF5 A;  1ULN A;  1X7O A;  2F9Z C;  3WPW A;  3VOB A;  3OL0 A;  3CB2 A;  3JAT B;  2CW4 A;  5HP7 A;  1SGQ I;  1P9G A;  3LDT A;  1Y1C A;  1WGC A;  2B33 A;  4ZI7 A;  1VQ8 F;  4ZOL A;  4BT7 A;  1JN1 A;  1OVO A;  1W40 A;  2Z1U A;  1VHA A;  2SGD I;  3CCM F;  3QWP A;  1Y1B A;  4LCK A;  3LFO A;  1KBF A;  2DKV A;  4ZHV A;  2GKT I;  2KCX A;  2QI2 A;  3M1X A;  2CWH A;  1MJ9 A;  3ELC A;  4SGB I;  3I3F A;  5EAZ A;  5LA6 B;  3LWO C;  3E2I A;  3CC7 F;  1H0Z A;  1DBF A;  1E7K A;  2SGP I;  1NUB A;  1CK2 A;  3WJQ A;  2ROW A;  1W3E X;  4UXI A;  5HP8 A;  1W5A A;  1K7U A;  3HKE A;  3KJK A;  5FLX M;  1TBR R;  1HJA I;  3V7Q A;  1SZQ A;  3UEJ A;  4X1K A;  1K8A H;  5KMG A;  2NU0 I;  5EO3 A;  3TD5 A;  1Q82 H;  5J8F A;  2N52 A;  2CWJ A;  2I6R A;  2UYJ A;  1Q86 H;  3BYQ A;  2CVL A;  3JAT A;  1W41 A;  3J7A R;  2DB6 A;  2KTU A;  4BVT A;  5EB1 B;  5JVD B;  3JAS A;  4O4L B;  3D00 A;  1RQ2 A;  1FY7 A;  5HY2 A;  2QPO A;  3RU0 A;  3VDP A;  3P4E A;  1UFY A;  3CME F;  2RHO A;  2SGE I;  1W59 A;  1W42 A;  1RFH A;  1VQ4 F;  2BTQ B;  3VE5 A;  3S06 A;  2FC3 A;  3VIU A;  2KG4 A;  4FFB B;  2NMU A;  5LXT A;  2VGN A;  2YXZ A;  1WTJ A;  2BUS A;  2XRC A;  4BT6 A;  3WGL A;  4NQ3 A;  4BT2 A;  3FFM A;  1K7T A;  5J2T B;  2LBW A;  2M5X A;  4FKD A;  2RHJ A;  4O4I B;  5MN5 A;  3CCU F;  2R75 1;  1W5E A;  1H48 A;  1HPT A;  3JCM M;  1XBT A;  3RYH B;  3FBA A;  4O4H A;  3G4S F;  1VH8 A;  2OVO A;  3D01 A;  5HQ8 A;  2HS0 A;  3E22 B;  3LME A;  5FJ4 C;  1UI9 A;  1MJB A;  4B6D A;  4WBN A;  3TJQ A;  3CPQ A;  1XX6 A;  1M90 H;  1ODE A; 
#chains in the Genus database with same CATH homology
 1OFU A;  1SGE I;  2JXD A;  3WGN A;  5BMV A;  4U39 A;  4DXD A;  1TBQ R;  1FAQ A;  5GON B;  2P6A C;  4X1Y B;  3SGB I;  1JFF A;  1TOT A;  2VAW A;  4O2B B;  1U5K A;  4TUY B;  5FNV B;  5FUV A;  1W5F A;  2RHH A;  4O4I A;  4YJ2 A;  2L8E A;  4O4H B;  5EYP B;  4OVO A;  3UGI A;  5EX3 A;  2JYY A;  4IIJ A;  5BMV B;  4TV8 B;  1BUS A;  1CT4 I;  5IJ9 B;  3RYI B;  4UXJ A;  5CB4 B;  5LP6 C;  4X20 B;  4TUY A;  5FNV A;  5JCO C;  3UGL A;  4X1I A;  4IHJ A;  3OXL A;  4YJ2 B;  1AN1 I;  1PJU A;  2N1A B;  4B45 A;  1CT0 I;  3JAL A;  1V1H A;  2QQ0 A;  5EYP A;  1M8B A;  3HH2 C;  1CGI I;  2JA1 A;  3KY9 A;  1Z5V A;  2FNF X;  1PPF I;  1CE3 A;  4ZOL B;  4TV8 A;  1TIH A;  1UVG A;  5ITZ A;  1DS3 I;  1N13 A;  2GKR I;  5J2U B;  3OVO A;  4X20 A;  5EIB D;  2ORW A;  5FUW A;  4LNU B;  4X1K B;  4HGU A;  3SGQ I;  1MT1 A;  1W58 1;  2ODD A;  2WVJ A;  1RLU A;  2KMR A;  4UXH A;  2KMQ A;  1PTR A;  3C8L A;  4U3J B;  2SGQ I;  2RHL A;  1PCE A;  4FFB A;  4I50 A;  2QQD A;  5LXT B;  1KMA A;  1SGP I;  3E59 A;  2B8T A;  2NU3 I;  5DAE A;  2V1C A;  2UZ3 A;  2Q1Y A;  2BTO A;  5JH7 B;  4TV9 B;  4KWE A;  3OXG A;  3JAR B;  3QTL D;  2A20 A;  3WGM A;  4WBN B;  2KMP A;  3N2K A;  2WCY A;  3BJI A;  1LR7 A;  4ZHQ A;  3UFF A;  5GON A;  4X1Y A;  1W5B A;  1X74 A;  2LUY A;  1M8C A;  2B0U C;  2DIP A;  2K9H A;  5LYJ B;  2ENN A;  5JH7 A;  4TV9 A;  3JAR A;  2ARP F;  1LR9 A;  1RQ7 A;  2QQE A;  5JQG B;  2KMO A;  1R0R I;  4ZHQ B;  4A24 A;  2J87 A;  5IJ9 A;  1IY5 A;  1CSO I;  2NU2 I;  1CHO I;  1KBE A;  4F6R A;  3B4V C;  4L9M A;  3HKC A;  2NU1 I;  3JAL B;  2F3C I;  5CCM A;  1Z5W A;  5KX5 A;  2YUU A;  2LEO A;  4GI3 C;  3N2G B;  5EX0 A;  2JZM A;  2SGF I;  2NU4 I;  5ITZ B;  1HDL A;  3WGK A;  1YTP A;  5J2U A;  4E6E A;  5CA1 B;  1SGY I;  4E1P A;  1SGN I;  4EB6 A;  1FAR A;  2E5R A;  3HKB A;  4LNU A;  1W3S A;  3UT5 B;  5FUY A;  1TVK A;  3HKC B;  5C8Y A;  4I55 A;  4DRX A;  2JW6 A;  1FFX A;  1W4R A;  3HKD A;  3GOX A;  4O2A A;  3N2G A;  2VAP A;  4JCV E;  5HI7 A;  5IJ0 A;  3VDU A;  4U3J A;  2ELI A;  4B46 A;  2E73 A;  2OD1 A;  4I50 B;  5CA1 A;  3PDN A;  4ZI7 B;  4I4T A;  5EZY A;  1TUB B;  4EB6 B;  5JHW C;  3JAK B;  3MEK A;  1Y8F A;  3CXL A;  4I55 B;  1TBN A;  1FFX B;  1LR8 A;  3UGD A;  3HKE B;  1OYV I;  1FYB A;  3N2K B;  2QQC A;  3UEY A;  5KMG B;  1CT2 I;  1FSZ A;  1CGJ I;  3RYF B;  1DS2 I;  2GVI A;  5LP6 B;  5IJ0 B;  4M8I A;  1R79 A;  3JAS B;  4O4L A;  1BMO A;  2Q1X A;  4I4T B;  5EZY B;  1TUB A;  5LOV B;  3JAK A;  1TUS A;  1YU6 C;  2V1C C;  5LYJ A;  2ENZ A;  2VAM A;  4HNA A;  5CCL A;  5EIB C;  5J2T A;  3RYF A;  5JQG A;  3RYH A;  4YJ3 A;  5LP6 A;  3E22 A;  5JCO A;  2GKV A;  1IW4 A;  5CA0 B;  1TGS I;  5LOV A;  1X4S A;  3VOA A;  3RYC B;  4F6R B;  4O4J B;  1JFF B;  5IYZ A;  2CJS C;  1SA0 B;  4O2B A;  4HNA B;  2ERW A;  2VRW B;  3FC3 A;  5JVD A;  1SGR I;  1OMT A;  3JAW B;  5KX5 B;  1V1I A;  2V53 A;  2N17 A;  2YQP A;  3WGJ A;  4YJ3 B;  2N71 A;  5MN6 A;  1IY6 A;  1PTQ A;  1TBO A;  1UUC A;  5CA0 A;  4IIJ B;  2L7X A;  1TUR A;  1OMU A;  3RYC A;  1SGD I;  4O4J A;  3HKB B;  3OXF A;  1XA6 A;  3RYI A;  5MN4 A;  1VDD A;  5CB4 A;  3UT5 A;  5IYZ B;  1TVK B;  1SA0 A;  5LA6 A;  4DRX B;  2ORV A;  5C8Y B;  4X1I B;  2R6R 1;  4IHJ B;  3JAW A;  2J9R A;  3SEK C;  3HKD B;  2W0T A;  1UVF A;  1Z7K B;  4O2A B;  2VXY A;  4E1R A;  3VO8 A;  5FUX A;  3VOB A;  3OL0 A;  3CB2 A;  3JAT B;  1SGQ I;  1Y1C A;  4ZI7 A;  4ZOL A;  1OVO A;  2SGD I;  3QWP A;  1Y1B A;  1KBF A;  2GKT I;  2KCX A;  4SGB I;  5LA6 B;  3E2I A;  1H0Z A;  2SGP I;  1NUB A;  2ROW A;  4UXI A;  1W5A A;  3HKE A;  1TBR R;  1HJA I;  3UEJ A;  4X1K A;  5KMG A;  2NU0 I;  2N52 A;  3JAT A;  2DB6 A;  5JVD B;  3JAS A;  4O4L B;  3D00 A;  1RQ2 A;  2QPO A;  3RU0 A;  3VDP A;  2RHO A;  2SGE I;  1W59 A;  1RFH A;  2BTQ B;  3VE5 A;  4FFB B;  5LXT A;  2BUS A;  2XRC A;  3WGL A;  5J2T B;  2M5X A;  4FKD A;  2RHJ A;  4O4I B;  5MN5 A;  2R75 1;  1W5E A;  1HPT A;  1XBT A;  3RYH B;  4O4H A;  2OVO A;  5HQ8 A;  3E22 B;  4B6D A;  4WBN A;  3TJQ A;  1XX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...