2GVIA

Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords conserved hypothetical protein
total genus 51
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3320.10 Mainly Alpha Orthogonal Bundle pa2218 like fold pa2218 like domain 2gviA01
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gviA03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2gviA02
3UGDA 3VO8A 3JAWB 1W4RA 4YJ2B 3WGMA 3VOAA 4O4LB 4WBNA 5IJ9B 4F6RB 2QQ0A 3UEJA 4IIJB 3RYHB 1W5AA 5BMVB 1R79A 5LA6B 4I50A 4X1IA 2Q1XA 1TVKA 4X1KA 2WVJA 3JARB 4DXDA 3HKBA 4ZOLB 5FUXA 4I4TB 2YUUA 4FFBB 5JCOC 5C8YA 1FSZA 2VAWA 5EIBC 4E6EA 3N2GA 3WGKA 4WBNB 1Y8FA 1W59A 1RFHA 3BJIA 3RYCA 4B46A 4O4JB 4TUYA 4I55B 4YJ3B 4ZI7B 4B45A 5ITZB 4FFBA 2DB6A 2R751 2BTOA 5JQGB 2FNFX 5JCOA 5CA1B 5CB4B 4UXHA 3JARA 1Z5WA 3JALB 3RYIA 4YJ3A 3WGLA 1OFUA 3E2IA 4I4TA 5EIBD 3JAWA 1FARA 4DRXB 2VRWB 1W5BA 3JASB 4TV9B 3JAKA 2ELIA 4O4LA 5EZYA 4TV8B 5CA1A 4O2AB 5CB4A 3RYCB 5CA0A 4O4IB 3RYIB 3VOBA 4ZOLA 1RQ7A 5LP6A 3E22B 5GONB 5ITZA 5LXTA 2BTQB 2UZ3A 1KBEA 1TBNA 3HKDB 1JFFA 2VXYA 3RYFA 2ENNA 1TVKB 1W581 3HKCB 2ENZA 3JALA 2ORVA 3E22A 4HNAB 2QQEA 3KY9A 1RQ2A 1FFXA 4U3JA 5FNVB 5FUYA 3WGNA 4TV9A 3JATB 4EB6B 3N2GB 4O4HB 4LNUA 2RHOA 2VAPA 4O4IA 5IJ9A 4I55A 2R6R1 5LP6B 3UGLA 4HNAA 5GONA 2GVIA 4IHJB 5MN4A 5FNVA 5J2UA 1KBFA 3HKDA 5BMVA 4O4HA 5FUVA 4F6RA 4LNUB 2J87A 2ROWA 4X1IB 1FAQA 1XA6A 4X1KB 5JH7B 2QPOA 4KWEA 2B8TA 2Q1YA 4B6DA 4L9MA 5J2UB 1W5FA 3JAKB 5JVDB 3HKEA 4IIJA 5EZYB 3UT5A 4I50B 4EB6A 5C8YB 5CA0B 4O2BA 3N2KB 3CXLA 3CB2A 3WGJA 4TUYB 5LXTB 4IHJA 5J2TB 4M8IA 3UFFA 1TBOA 5LOVB 1JFFB 3RYFB 5FUWA 2JA1A 4FKDA 4O2BB 1TUBA 4X20B 5EYPB 5MN5A 5IJ0B 3C8LA 5J2TA 4UXIA 3UGIA 5LOVA 1PTQA 3JATA 5KMGB 5JQGA 3JASA 5LA6A 4X1YA 5LYJB 1TUBB 3N2KA 4O2AA 5EYPA 4ZHQB 1XX6A 5KX5B 1PTRA 2RHHA 4DRXA 2VAMA 1RLUA 4TV8A 2E73A 4UXJA 5IYZA 4YJ2A 5LP6C 1SA0B 4U39A 4X20A 5JH7A 4O4JA 5IJ0A 3RYHA 4ZI7A 5MN6A 3UEYA 5JVDA 2RHLA 1FFXB 3HKEB 4U3JB 3UT5B 5KMGA 5IYZB 1Z5VA 4X1YB 5LYJA 3HKCA 1XBTA 1SA0A 4ZHQA 5KX5A 2J9RA 2ORWA 3HKBB 2RHJA 1W5EA
chains in the Genus database with same CATH superfamily
2Z01A 2NU0I 4YJ2B 3TO7A 4O4LB 4WBNA 1XV2A 1Z7KB 2QQ0A 1S20A 4MPIA 4IIJB 1M1KH 3RA5A 1H0ZA 4C8IA 3G71F 3F0FA 3CXCF 2OZUA 4X1IA 1ONIA 2GKTI 2XRCA 2P6YA 3JARB 1KD1H 3OVOA 3S0YA 2SGDI 3CG6A 2VAWA 3FBAA 3N2GA 1CGJI 5EX0A 2HS4A 2CSLA 5E3RA 2HP0A 2L7XA 2KCXA 1CT4I 5EWRA 4C8GA 4B45A 4FFBA 2HP3A 1DS3I 1UFYA 3V4DA 2B0UC 3AGKA 5JQGB 1TURA 3K2XA 3IMPA 1FY7A 3JAMM 2NU4I 1Z5WA 3MCQA 2KMQA 3S0WA 1MJ9A 3MQWA 2ZODA 4C82A 2ODDA 1QVGF 2VRWB 1VQVA 3LDTA 9WGAA 4O2AB 5CA1A 3ZP4A 1K8AH 5CA0A 1X25A 3SGBI 2DIPA 2NU3I 5LP6A 2GKVA 3F0GA 2YXZA 5LXTA 1KBEA 4GI3C 1TBNA 3CC2F 3HKDB 1JFFA 1QAHA 3J81M 3IKEA 2NU1I 3RYFA 1W581 3CPWF 2ORVA 3V3TA 2QQEA 3KY9A 1HDLA 2UVOA 3WGNA 1VQMF 1Q9BA 2JNBA 4EB6B 2OD1A 4LNUA 2N1AB 5IJ9A 3CCUF 2HVYD 2JYYA 1M8BA 2EWCA 5FNVA 3ESJA 2UYNB 3OONA 2KGWA 3LWRC 4O4HA 4BT3A 3NVKE 2RB9A 4PWTA 1FAQA 2H6LA 1J7HA 5JH7B 4ERHA 2QPOA 2B8TA 4B6DA 3DC2A 1W5FA 5HY4A 4I50B 2KTUA 2W8BC 3TD5A 1KNJA 3TD4A 3WGJA 4TUYB 1V1IA 3UFFA 3ERNA 1V1HA 2UYNA 3LWPC 4BT2A 2JA1A 1JJ2F 4OVOA 3ZOPA 2MQEA 2X52A 2HRUA 3VMFB 3LWVC 5EYPB 1FNKA 1X4SA 3HH2C 1IV4A 5KMGB 3JASA 5LA6A 3CC7F 4X1YA 5LYJB 3CC4F 2BUSA 1TOTA 2HS3A 3BYQA 4ZHQB 3S03A 1PTRA 2A20A 2RHHA 1LR7A 3FSYA 1OVOA 3E59A 1DT9A 5GAPK 2GKRI 2E73A 3D00A 4U39A 3T80A 4O4JA 1GX1A 5IJ0A 5HI7A 3CYQA 5EB1B 3CPQA 1YHQF 2JW6A 1Z5VA 1SGEI 1SA0A 4C81A 2J9RA 1YU6C 1Y1CA 4ZOLA 2RHJA 2CWJA 5E3QA 3C9RA 3TJQA 2DYYA 1W4RA 3VO8A 3V7EA 2HS0A 1FNJA 3OXFA 1X7OA 5IJ9B 2LCAA 3HTNA 1UVFA 2CHSA 3UOEA 3RYHB 1JD1A 3WPWA 2IAFA 1IW4A 2M5XA 1MT1A 2N52A 3HWUA 2CWFA 2ARPF 4X1KA 2WVJA 2WALA 3I7TA 1BMOA 4DXDA 1UHAA 3J80M 4ZHYB 3S02A 4ZOLB 3S0HA 4I4TB 1PJUA 1U3LA 3MBMA 4FFBB 1RLGA 1GO1A 1FSZA 1VQ9F 3OXLA 5J8CA 3TO6A 3E1YA 3CCVF 1W59A 1RFHA 3BJIA 2OHWA 4YJ3B 1K73H 5ITZB 5GANK 2KTVA 4NQ3A 5G4VC 2HRYA 3MDOA 1Q86H 1CK2A 1W3EX 1W55A 1VHAA 3JARA 4G4XA 1VQLF 5HY0A 1OMUA 2I6RA 3VDUA 4I4TA 1KMAA 5EIBD 1ODEA 3VDPA 3JAKA 3FFMA 1YJWF 5EZYA 4TV8B 3S06A 2RC4A 4O4IB 3RYIB 3VE5A 3VOBA 1RQ7A 1RA4A 1N8RH 1SZQA 5ITZA 2BTQB 2UZ3A 4E1RA 2VXYA 3CCMF 4G4YA 3CCSF 1X52A 2ENNA 2OTJF 3HKCB 2ENZA 2ZVYA 3E22A 1Q7YH 3TOBA 3P0ZA 2CJSC 3QWPA 3O85A 5FNVB 5HWEA 2ALEA 4TV9A 4AMLA 2G9IA 2RHOA 2V53A 2DT4A 1K9MH 4BW0B 4I55A 1UI9A 3R5DA 4HNAA 2GVIA 3OXGA 1XRGA 3R5BA 1KBFA 5BMVA 1IV2A 1QU9A 3U0OA 4BT7A 1UVGA 1ULMA 4X1IB 3FC3A 1R0RI 3LMEA 3GYQA 1VQNF 2GIVA 4L9MA 1H47A 2E5RA 5CA0B 1GO0A 1YQNA 3WJQA 3LWOC 2PQ8A 2AMTA 3F0EA 4M8IA 3NK6A 1WTJA 2OU2A 4HGUA 5LOVB 1M8CA 4G4WA 1KC8H 2N48A 4O2BB 1CSOI 4X20B 1WGTA 4BVTA 1XHOA 1COMA 5FJ4C 3JATA 2KMOA 1YI2F 2FGYA 3SIUA 2QQDA 1H7MA 3QTLD 3D54A 3N2KA 4O2AA 5KX5B 1VQ7F 3EORA 4G4VA 1M90H 3M1XA 4LCKA 1BUSA 1MJAA 2GLZA 3R0PA 2YYEA 1SGPI 4TV8A 3R5AA 1H48A 3HJWC 1TUSA 1VQ6F 1VQKF 5LP6C 2PHNA 3ON1A 1W2BF 2Y0MA 1VQ5F 1YITF 3UEYA 5JVDA 1AN1I 3HKEB 3UT5B 1TIHA 1HPTA 4X1YB 5LYJA 2LBWA 1TBRR 1NJIH 1VK3A 2Z1EA 2ORWA 4BVQA 3K0TA 3GOXA 1W5EA 3UGDA 2BO1A 1VH8A 3VI6A 3VOAA 4EI8A 3IEQA 2HQSC 2YQPA 1YTPA 5B8FA 5GIPC 5EX3A 2V1CC 1SDSA 4A24A 4I50A 1PXWA 2HP0B 1TVKA 2NU2I 2IQQA 2Q1XA 2OTLF 2L8EA 3I55F 4JCVE 3HKBA 3IKFA 2F3CI 5C8YA 5FLXM 4E6EA 1ULKA 5EIBC 3VCZA 2CWGA 1P9GA 1Y8FA 4B46A 4TZZA 2ERWA 3CCQF 2CW4A 4BY9D 2QI2A 2HX0A 3CYPB 1NUBA 1ZWZA 3FSXA 2DB6A 2R751 5A2QM 2FNFX 5JCOA 5CA1B 3F6MA 5HXZA 4UXHA 2SGFI 3JALB 3WGLA 5DCVA 2L26A 3E2IA 3KHNA 4DRXB 1FARA 3WPXA 2CVLA 2ELIA 3PLAC 1CLIA 2H8EA 3RYCB 1HJAI 5IT9M 2QTPA 3E22B 1WKXA 3F0DA 4ZHWA 2FC3A 2Z1UA 3CCJF 3OL0A 3KJJA 3CCLF 2LBTA 2QA4F 4R40B 1DS2I 1CE3A 1SGRI 5HXUA 1GZ0A 3JALA 4HNAB 1RQ2A 1FFXA 4U3JA 5GIOC 5FUYA 3OBYA 4RHAA 4O4HB 2VAPA 1W3SA 3UGLA 3VYSC 3WJPA 3CMAF 3G6EF 5GINC 1SGNI 3LFOA 5J2UA 1KQSF 3B4VC 1S72F 3PAFA 5FUVA 4LNUB 2J87A 3L7QA 1XA6A 3FD5A 1YJNF 3NVIB 2AIFA 1LR8A 2IG8A 2V1CA 5HY1A 4KWEA 2Q1YA 3CCRF 2SGPI 3WGKA 3JAKB 3HKEA 3UT5A 5EZYB 1OYVI 5C8YB 3TO9A 3I56F 4C4WC 3CB2A 3J7AR 2PMPA 5LXTB 1PF5A 5J2TB 2OTMA 1TGSI 5FUWA 5EAZA 3P10A 4FKDA 2VGNA 1ULNA 1TUBA 3NK7A 3QUWA 1W41A 5MN5A 2P6AC 1Z2IA 5IJ0B 3C8LA 4UXIA 2I6DA 1JY8A 3N4YA 4BVSA 5JQGA 2WGCA 1TUBB 3TOAA 3GTZA 4NWOB 3VIUA 1XX6A 1WGCA 2LUYA 4G88A 4BT4A 2VAMA 2AIZP 4RQOA 1RLUA 2NMUA 3SGQI 1W42A 3ELCA 3GHZA 4X20A 2Z1TA 2CZWA 3RYHA 4WP4A 1W40A 3DDNA 3RU0A 4ZI7A 4B5CA 2RHLA 1FFXB 2BTUA 4U3JB 5MN6A 2VGMA 3JCMM 3VYTC 3K14A 5E3PA 1Q82H 1IV1A 3QHDA 1PPFI 5KX5A 1X7PA 3G4SF 4IIJA 2SGEI 1FYBA 1U3PA 1CT2I 3FPIA 3KE1A 3JAWB 1E7KA 3WGMA 2B33A 4ZK7A 3WJRA 3RA6A 4F6RB 3UEJA 4BT5A 5HP7A 4NUTA 2ZF8A 4SGBI 3LYBA 1W5AA 3CD6F 5BMVB 1TBQR 1R79A 3I3FA 5LA6B 3WXMB 1YJ9F 1LR9A 3QAHA 5EB0A 1K7VA 1P9ZA 1HEVA 4G4ZA 5FUXA 4ZHVA 2YUUA 5JCOC 2UYPA 7WGAA 1U40A 5AVMA 1SGYI 3KIZA 2UZHA 4WBNB 3RE3A 4C8EA 3RYCA 1YIJF 4O4JB 4TUYA 4I55B 1DBFA 4EI9A 4ZI7B 5JHWC 2CWHA 3TD3A 1IV3A 2LBXA 2BTOA 3M4SA 5CB4B 3C9TA 1Y1BA 3R5CA 4E1PA 3SEKC 3PDNA 1NXUA 4XCQA 2WCYA 4YJ3A 3RYIA 3ZO8A 3LWQC 1OFUA 1VQPF 4X3LA 3NMUC 1VDDA 1CHOI 2X3TA 1OAPA 2JZMA 1W5BA 3JAWA 3JASB 4TV9B 1VQOF 1CN7A 4O4LA 1IPAA 2ZOVA 5CB4A 1OMTA 5CCMA 1Q8RA 5DAEA 1NQ3A 5GONB 2F9ZC 2QQCA 3N4ZA 2UYKA 2N71A 1PCEA 1TVKB 1UUCA 2OVOA 3OBWA 4EI7A 3FD6A 5EO3A 3VYUC 3C9SA 2RIJA 3JATB 3N2GB 1T0AA 3JVHA 2K9HA 4O4IA 2R6R1 5LP6B 3KJKA 1SGQI 2ZAUA 5GONA 4IHJB 5MN4A 3CMEF 2KG4A 3HKDA 2V9YA 4F6RA 1U43A 1K7UA 2ROWA 5J8FA 1VQ8F 3V7QA 1IY6A 5CCLA 1QD9A 4X1KB 1W57A 2KMPA 4BT6A 2LEOA 5J2UB 5JVDB 4EB6A 3E20B 2QEXF 4O2BA 3N2KB 3CXLA 3ZP7A 1CT0I 2UYJA 4IHJA 1T0KB 1TBOA 2N17A 1JFFB 3RYFB 1VQ4F 1SGDI 2OZBA 3D01A 2CHTA 3P4EA 2LB7A 2H8CA 1YGYA 3CCEF 1X74A 5G4UC 3VTIC 1K7TA 4B62A 5J2TA 1Q81H 3UGIA 5LOVA 1PTQA 1N13A 2SGQI 3IEWA 3Q8HA 3MEKA 1XBIA 1QVFF 3QTYA 5EYPA 3HAXD 1NMUB 3MCAB 4X3MA 2GZLA 4DRXA 2DKVA 1JN1A 4YJ2A 4UXJA 1IY5A 2ZVZA 5IYZA 5HP8A 1CGII 5HQ8A 1SA0B 2KMRA 5JH7A 3SIVA 3K12A 2W0TA 1R1MA 4BVRA 1MJBA 3IR9A 2K1SA 5KMGA 1KNKA 5IYZB 2Z1FA 2JXDA 4DNCA 3HKCA 1XBTA 5HY2A 3M84A 3C9UA 4ZHQA 3OW2F 1U5KA 3HKBB 3B6NA
chains in the Genus database with same CATH topology
2NU0I 4YJ2B 4O4LB 4WBNA 1Z7KB 2QQ0A 4IIJB 1H0ZA 4X1IA 2GKTI 2XRCA 3JARB 3OVOA 2SGDI 2VAWA 3N2GA 1CGJI 5EX0A 2L7XA 2KCXA 1CT4I 4B45A 4FFBA 1DS3I 2B0UC 5JQGB 1TURA 2NU4I 1Z5WA 2KMQA 2ODDA 2VRWB 5CA1A 4O2AB 5CA0A 3SGBI 2DIPA 2NU3I 5LP6A 2GKVA 5LXTA 1KBEA 4GI3C 1TBNA 3HKDB 1JFFA 3RYFA 2NU1I 1W581 2ORVA 2QQEA 3KY9A 1HDLA 3WGNA 4EB6B 2OD1A 4LNUA 2N1AB 5IJ9A 2JYYA 1M8BA 5FNVA 4O4HA 1FAQA 5JH7B 2QPOA 2B8TA 4B6DA 1W5FA 4I50B 3WGJA 4TUYB 1V1IA 3UFFA 1V1HA 2JA1A 4OVOA 5EYPB 1X4SA 3HH2C 5KMGB 3JASA 5LA6A 4X1YA 5LYJB 2BUSA 1TOTA 4ZHQB 1PTRA 2A20A 2RHHA 1LR7A 1OVOA 3E59A 2GKRI 2E73A 3D00A 4U39A 4O4JA 5IJ0A 5HI7A 2JW6A 1Z5VA 1SGEI 1SA0A 2J9RA 1YU6C 1Y1CA 4ZOLA 2RHJA 3VO8A 3TJQA 1W4RA 3OXFA 5IJ9B 1UVFA 3RYHB 1IW4A 2M5XA 1MT1A 2N52A 2ARPF 4X1KA 2WVJA 4DXDA 1BMOA 4ZOLB 4I4TB 1PJUA 4FFBB 1FSZA 3OXLA 1W59A 1RFHA 3BJIA 4YJ3B 5ITZB 3JARA 1OMUA 4I4TA 3VDUA 5EIBD 1KMAA 3VDPA 3JAKA 5EZYA 4TV8B 4O4IB 3RYIB 3VE5A 3VOBA 1RQ7A 5ITZA 2BTQB 2UZ3A 4E1RA 2VXYA 2ENNA 3HKCB 2ENZA 3E22A 2CJSC 3QWPA 5FNVB 4TV9A 2RHOA 2V53A 4I55A 4HNAA 2GVIA 3OXGA 1KBFA 5BMVA 1UVGA 4X1IB 3FC3A 1R0RI 4L9MA 2E5RA 5CA0B 4M8IA 5LOVB 4HGUA 1M8CA 4O2BB 1CSOI 4X20B 3JATA 2KMOA 2QQDA 3N2KA 3QTLD 4O2AA 5KX5B 1BUSA 4TV8A 1SGPI 1TUSA 5LP6C 3UEYA 5JVDA 1AN1I 3HKEB 3UT5B 1TIHA 1HPTA 4X1YB 5LYJA 1TBRR 2ORWA 3GOXA 1W5EA 3UGDA 3VOAA 2YQPA 1YTPA 5EX3A 2V1CC 4A24A 4I50A 2Q1XA 1TVKA 2NU2I 2L8EA 4JCVE 3HKBA 2F3CI 5C8YA 4E6EA 5EIBC 1Y8FA 4B46A 2ERWA 1NUBA 2DB6A 2R751 2FNFX 5JCOA 5CA1B 4UXHA 2SGFI 3JALB 3WGLA 3E2IA 4DRXB 1FARA 2ELIA 3RYCB 1HJAI 3E22B 3OL0A 1DS2I 1CE3A 1SGRI 3JALA 4HNAB 1RQ2A 1FFXA 4U3JA 5FUYA 4O4HB 2VAPA 1W3SA 3UGLA 1SGNI 5J2UA 3B4VC 5FUVA 4LNUB 2J87A 1XA6A 1LR8A 2V1CA 4KWEA 2Q1YA 2SGPI 3WGKA 3JAKB 3HKEA 3UT5A 5EZYB 1OYVI 5C8YB 3CB2A 5LXTB 5J2TB 1TGSI 5FUWA 4FKDA 1TUBA 5MN5A 2P6AC 5IJ0B 3C8LA 4UXIA 5JQGA 1TUBB 1XX6A 2LUYA 2VAMA 1RLUA 3SGQI 4X20A 3RYHA 4ZI7A 5MN6A 3RU0A 2RHLA 1FFXB 4U3JB 1PPFI 5KX5A 4IIJA 2SGEI 1FYBA 1CT2I 3JAWB 3WGMA 4F6RB 3UEJA 4SGBI 1W5AA 5BMVB 1TBQR 1R79A 5LA6B 1LR9A 5FUXA 2YUUA 5JCOC 1SGYI 4WBNB 3RYCA 4O4JB 4TUYA 4I55B 4ZI7B 5JHWC 2BTOA 5CB4B 1Y1BA 4E1PA 3SEKC 3PDNA 3RYIA 4YJ3A 2WCYA 1OFUA 1VDDA 1CHOI 3JAWA 2JZMA 1W5BA 3JASB 4TV9B 4O4LA 5CB4A 1OMTA 5CCMA 5DAEA 5GONB 2QQCA 2N71A 1PCEA 1TVKB 1UUCA 2OVOA 3JATB 3N2GB 2K9HA 4O4IA 2R6R1 5LP6B 1SGQI 5GONA 4IHJB 5MN4A 3HKDA 4F6RA 2ROWA 1IY6A 5CCLA 4X1KB 2KMPA 2LEOA 5J2UB 5JVDB 4EB6A 4O2BA 3N2KB 3CXLA 1CT0I 4IHJA 1TBOA 2N17A 1JFFB 3RYFB 1SGDI 1X74A 5J2TA 3UGIA 5LOVA 1PTQA 1N13A 2SGQI 3MEKA 5EYPA 4DRXA 4YJ2A 4UXJA 1IY5A 5IYZA 1CGII 5HQ8A 1SA0B 2KMRA 5JH7A 2W0TA 5KMGA 5IYZB 2JXDA 3HKCA 1XBTA 4ZHQA 1U5KA 3HKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGD A;  3VO8 A;  3JAW B;  1W4R A;  4YJ2 B;  3WGM A;  3VOA A;  4O4L B;  4WBN A;  5IJ9 B;  4F6R B;  2QQ0 A;  3UEJ A;  4IIJ B;  3RYH B;  1W5A A;  5BMV B;  1R79 A;  5LA6 B;  4I50 A;  4X1I A;  2Q1X A;  1TVK A;  4X1K A;  2WVJ A;  3JAR B;  4DXD A;  3HKB A;  4ZOL B;  5FUX A;  4I4T B;  2YUU A;  4FFB B;  5JCO C;  5C8Y A;  1FSZ A;  2VAW A;  5EIB C;  4E6E A;  3N2G A;  3WGK A;  4WBN B;  1Y8F A;  1W59 A;  1RFH A;  3BJI A;  3RYC A;  4B46 A;  4O4J B;  4TUY A;  4I55 B;  4YJ3 B;  4ZI7 B;  4B45 A;  5ITZ B;  4FFB A;  2DB6 A;  2R75 1;  2BTO A;  5JQG B;  2FNF X;  5JCO A;  5CA1 B;  5CB4 B;  4UXH A;  3JAR A;  1Z5W A;  3JAL B;  3RYI A;  4YJ3 A;  3WGL A;  1OFU A;  3E2I A;  4I4T A;  5EIB D;  3JAW A;  1FAR A;  4DRX B;  2VRW B;  1W5B A;  3JAS B;  4TV9 B;  3JAK A;  2ELI A;  4O4L A;  5EZY A;  4TV8 B;  5CA1 A;  4O2A B;  5CB4 A;  3RYC B;  5CA0 A;  4O4I B;  3RYI B;  3VOB A;  4ZOL A;  1RQ7 A;  5LP6 A;  3E22 B;  5GON B;  5ITZ A;  5LXT A;  2BTQ B;  2UZ3 A;  1KBE A;  1TBN A;  3HKD B;  1JFF A;  2VXY A;  3RYF A;  2ENN A;  1TVK B;  1W58 1;  3HKC B;  2ENZ A;  3JAL A;  2ORV A;  3E22 A;  4HNA B;  2QQE A;  3KY9 A;  1RQ2 A;  1FFX A;  4U3J A;  5FNV B;  5FUY A;  3WGN A;  4TV9 A;  3JAT B;  4EB6 B;  3N2G B;  4O4H B;  4LNU A;  2RHO A;  2VAP A;  4O4I A;  5IJ9 A;  4I55 A;  2R6R 1;  5LP6 B;  3UGL A;  4HNA A;  5GON A;  2GVI A;  4IHJ B;  5MN4 A;  5FNV A;  5J2U A;  1KBF A;  3HKD A;  5BMV A;  4O4H A;  5FUV A;  4F6R A;  4LNU B;  2J87 A;  2ROW A;  4X1I B;  1FAQ A;  1XA6 A;  4X1K B;  5JH7 B;  2QPO A;  4KWE A;  2B8T A;  2Q1Y A;  4B6D A;  4L9M A;  5J2U B;  1W5F A;  3JAK B;  5JVD B;  3HKE A;  4IIJ A;  5EZY B;  3UT5 A;  4I50 B;  4EB6 A;  5C8Y B;  5CA0 B;  4O2B A;  3N2K B;  3CXL A;  3CB2 A;  3WGJ A;  4TUY B;  5LXT B;  4IHJ A;  5J2T B;  4M8I A;  3UFF A;  1TBO A;  5LOV B;  1JFF B;  3RYF B;  5FUW A;  2JA1 A;  4FKD A;  4O2B B;  1TUB A;  4X20 B;  5EYP B;  5MN5 A;  5IJ0 B;  3C8L A;  5J2T A;  4UXI A;  3UGI A;  5LOV A;  1PTQ A;  3JAT A;  5KMG B;  5JQG A;  3JAS A;  5LA6 A;  4X1Y A;  5LYJ B;  1TUB B;  3N2K A;  4O2A A;  5EYP A;  4ZHQ B;  1XX6 A;  5KX5 B;  1PTR A;  2RHH A;  4DRX A;  2VAM A;  1RLU A;  4TV8 A;  2E73 A;  4UXJ A;  5IYZ A;  4YJ2 A;  5LP6 C;  1SA0 B;  4U39 A;  4X20 A;  5JH7 A;  4O4J A;  5IJ0 A;  3RYH A;  4ZI7 A;  5MN6 A;  3UEY A;  5JVD A;  2RHL A;  1FFX B;  3HKE B;  4U3J B;  3UT5 B;  5KMG A;  5IYZ B;  1Z5V A;  4X1Y B;  5LYJ A;  3HKC A;  1XBT A;  1SA0 A;  4ZHQ A;  5KX5 A;  2J9R A;  2ORW A;  3HKB B;  2RHJ A;  1W5E A; 
#chains in the Genus database with same CATH topology
 2Z01 A;  2NU0 I;  4YJ2 B;  3TO7 A;  4O4L B;  4WBN A;  1XV2 A;  1Z7K B;  2QQ0 A;  1S20 A;  4MPI A;  4IIJ B;  1M1K H;  3RA5 A;  1H0Z A;  4C8I A;  3G71 F;  3F0F A;  3CXC F;  2OZU A;  4X1I A;  1ONI A;  2GKT I;  2XRC A;  2P6Y A;  3JAR B;  1KD1 H;  3OVO A;  3S0Y A;  2SGD I;  3CG6 A;  2VAW A;  3FBA A;  3N2G A;  1CGJ I;  5EX0 A;  2HS4 A;  2CSL A;  5E3R A;  2HP0 A;  2L7X A;  2KCX A;  1CT4 I;  5EWR A;  4C8G A;  4B45 A;  4FFB A;  2HP3 A;  1DS3 I;  1UFY A;  3V4D A;  2B0U C;  3AGK A;  5JQG B;  1TUR A;  3K2X A;  3IMP A;  1FY7 A;  3JAM M;  2NU4 I;  1Z5W A;  3MCQ A;  2KMQ A;  3S0W A;  1MJ9 A;  3MQW A;  2ZOD A;  4C82 A;  2ODD A;  1QVG F;  2VRW B;  1VQV A;  3LDT A;  9WGA A;  4O2A B;  5CA1 A;  3ZP4 A;  1K8A H;  5CA0 A;  1X25 A;  3SGB I;  2DIP A;  2NU3 I;  5LP6 A;  2GKV A;  3F0G A;  2YXZ A;  5LXT A;  1KBE A;  4GI3 C;  1TBN A;  3CC2 F;  3HKD B;  1JFF A;  1QAH A;  3J81 M;  3IKE A;  2NU1 I;  3RYF A;  1W58 1;  3CPW F;  2ORV A;  3V3T A;  2QQE A;  3KY9 A;  1HDL A;  2UVO A;  3WGN A;  1VQM F;  1Q9B A;  2JNB A;  4EB6 B;  2OD1 A;  4LNU A;  2N1A B;  5IJ9 A;  3CCU F;  2HVY D;  2JYY A;  1M8B A;  2EWC A;  5FNV A;  3ESJ A;  2UYN B;  3OON A;  2KGW A;  3LWR C;  4O4H A;  4BT3 A;  3NVK E;  2RB9 A;  4PWT A;  1FAQ A;  2H6L A;  1J7H A;  5JH7 B;  4ERH A;  2QPO A;  2B8T A;  4B6D A;  3DC2 A;  1W5F A;  5HY4 A;  4I50 B;  2KTU A;  2W8B C;  3TD5 A;  1KNJ A;  3TD4 A;  3WGJ A;  4TUY B;  1V1I A;  3UFF A;  3ERN A;  1V1H A;  2UYN A;  3LWP C;  4BT2 A;  2JA1 A;  1JJ2 F;  4OVO A;  3ZOP A;  2MQE A;  2X52 A;  2HRU A;  3VMF B;  3LWV C;  5EYP B;  1FNK A;  1X4S A;  3HH2 C;  1IV4 A;  5KMG B;  3JAS A;  5LA6 A;  3CC7 F;  4X1Y A;  5LYJ B;  3CC4 F;  2BUS A;  1TOT A;  2HS3 A;  3BYQ A;  4ZHQ B;  3S03 A;  1PTR A;  2A20 A;  2RHH A;  1LR7 A;  3FSY A;  1OVO A;  3E59 A;  1DT9 A;  5GAP K;  2GKR I;  2E73 A;  3D00 A;  4U39 A;  3T80 A;  4O4J A;  1GX1 A;  5IJ0 A;  5HI7 A;  3CYQ A;  5EB1 B;  3CPQ A;  1YHQ F;  2JW6 A;  1Z5V A;  1SGE I;  1SA0 A;  4C81 A;  2J9R A;  1YU6 C;  1Y1C A;  4ZOL A;  2RHJ A;  2CWJ A;  5E3Q A;  3C9R A;  3TJQ A;  2DYY A;  1W4R A;  3VO8 A;  3V7E A;  2HS0 A;  1FNJ A;  3OXF A;  1X7O A;  5IJ9 B;  2LCA A;  3HTN A;  1UVF A;  2CHS A;  3UOE A;  3RYH B;  1JD1 A;  3WPW A;  2IAF A;  1IW4 A;  2M5X A;  1MT1 A;  2N52 A;  3HWU A;  2CWF A;  2ARP F;  4X1K A;  2WVJ A;  2WAL A;  3I7T A;  1BMO A;  4DXD A;  1UHA A;  3J80 M;  4ZHY B;  3S02 A;  4ZOL B;  3S0H A;  4I4T B;  1PJU A;  1U3L A;  3MBM A;  4FFB B;  1RLG A;  1GO1 A;  1FSZ A;  1VQ9 F;  3OXL A;  5J8C A;  3TO6 A;  3E1Y A;  3CCV F;  1W59 A;  1RFH A;  3BJI A;  2OHW A;  4YJ3 B;  1K73 H;  5ITZ B;  5GAN K;  2KTV A;  4NQ3 A;  5G4V C;  2HRY A;  3MDO A;  1Q86 H;  1CK2 A;  1W3E X;  1W55 A;  1VHA A;  3JAR A;  4G4X A;  1VQL F;  5HY0 A;  1OMU A;  2I6R A;  3VDU A;  4I4T A;  1KMA A;  5EIB D;  1ODE A;  3VDP A;  3JAK A;  3FFM A;  1YJW F;  5EZY A;  4TV8 B;  3S06 A;  2RC4 A;  4O4I B;  3RYI B;  3VE5 A;  3VOB A;  1RQ7 A;  1RA4 A;  1N8R H;  1SZQ A;  5ITZ A;  2BTQ B;  2UZ3 A;  4E1R A;  2VXY A;  3CCM F;  4G4Y A;  3CCS F;  1X52 A;  2ENN A;  2OTJ F;  3HKC B;  2ENZ A;  2ZVY A;  3E22 A;  1Q7Y H;  3TOB A;  3P0Z A;  2CJS C;  3QWP A;  3O85 A;  5FNV B;  5HWE A;  2ALE A;  4TV9 A;  4AML A;  2G9I A;  2RHO A;  2V53 A;  2DT4 A;  1K9M H;  4BW0 B;  4I55 A;  1UI9 A;  3R5D A;  4HNA A;  2GVI A;  3OXG A;  1XRG A;  3R5B A;  1KBF A;  5BMV A;  1IV2 A;  1QU9 A;  3U0O A;  4BT7 A;  1UVG A;  1ULM A;  4X1I B;  3FC3 A;  1R0R I;  3LME A;  3GYQ A;  1VQN F;  2GIV A;  4L9M A;  1H47 A;  2E5R A;  5CA0 B;  1GO0 A;  1YQN A;  3WJQ A;  3LWO C;  2PQ8 A;  2AMT A;  3F0E A;  4M8I A;  3NK6 A;  1WTJ A;  2OU2 A;  4HGU A;  5LOV B;  1M8C A;  4G4W A;  1KC8 H;  2N48 A;  4O2B B;  1CSO I;  4X20 B;  1WGT A;  4BVT A;  1XHO A;  1COM A;  5FJ4 C;  3JAT A;  2KMO A;  1YI2 F;  2FGY A;  3SIU A;  2QQD A;  1H7M A;  3QTL D;  3D54 A;  3N2K A;  4O2A A;  5KX5 B;  1VQ7 F;  3EOR A;  4G4V A;  1M90 H;  3M1X A;  4LCK A;  1BUS A;  1MJA A;  2GLZ A;  3R0P A;  2YYE A;  1SGP I;  4TV8 A;  3R5A A;  1H48 A;  3HJW C;  1TUS A;  1VQ6 F;  1VQK F;  5LP6 C;  2PHN A;  3ON1 A;  1W2B F;  2Y0M A;  1VQ5 F;  1YIT F;  3UEY A;  5JVD A;  1AN1 I;  3HKE B;  3UT5 B;  1TIH A;  1HPT A;  4X1Y B;  5LYJ A;  2LBW A;  1TBR R;  1NJI H;  1VK3 A;  2Z1E A;  2ORW A;  4BVQ A;  3K0T A;  3GOX A;  1W5E A;  3UGD A;  2BO1 A;  1VH8 A;  3VI6 A;  3VOA A;  4EI8 A;  3IEQ A;  2HQS C;  2YQP A;  1YTP A;  5B8F A;  5GIP C;  5EX3 A;  2V1C C;  1SDS A;  4A24 A;  4I50 A;  1PXW A;  2HP0 B;  1TVK A;  2NU2 I;  2IQQ A;  2Q1X A;  2OTL F;  2L8E A;  3I55 F;  4JCV E;  3HKB A;  3IKF A;  2F3C I;  5C8Y A;  5FLX M;  4E6E A;  1ULK A;  5EIB C;  3VCZ A;  2CWG A;  1P9G A;  1Y8F A;  4B46 A;  4TZZ A;  2ERW A;  3CCQ F;  2CW4 A;  4BY9 D;  2QI2 A;  2HX0 A;  3CYP B;  1NUB A;  1ZWZ A;  3FSX A;  2DB6 A;  2R75 1;  5A2Q M;  2FNF X;  5JCO A;  5CA1 B;  3F6M A;  5HXZ A;  4UXH A;  2SGF I;  3JAL B;  3WGL A;  5DCV A;  2L26 A;  3E2I A;  3KHN A;  4DRX B;  1FAR A;  3WPX A;  2CVL A;  2ELI A;  3PLA C;  1CLI A;  2H8E A;  3RYC B;  1HJA I;  5IT9 M;  2QTP A;  3E22 B;  1WKX A;  3F0D A;  4ZHW A;  2FC3 A;  2Z1U A;  3CCJ F;  3OL0 A;  3KJJ A;  3CCL F;  2LBT A;  2QA4 F;  4R40 B;  1DS2 I;  1CE3 A;  1SGR I;  5HXU A;  1GZ0 A;  3JAL A;  4HNA B;  1RQ2 A;  1FFX A;  4U3J A;  5GIO C;  5FUY A;  3OBY A;  4RHA A;  4O4H B;  2VAP A;  1W3S A;  3UGL A;  3VYS C;  3WJP A;  3CMA F;  3G6E F;  5GIN C;  1SGN I;  3LFO A;  5J2U A;  1KQS F;  3B4V C;  1S72 F;  3PAF A;  5FUV A;  4LNU B;  2J87 A;  3L7Q A;  1XA6 A;  3FD5 A;  1YJN F;  3NVI B;  2AIF A;  1LR8 A;  2IG8 A;  2V1C A;  5HY1 A;  4KWE A;  2Q1Y A;  3CCR F;  2SGP I;  3WGK A;  3JAK B;  3HKE A;  3UT5 A;  5EZY B;  1OYV I;  5C8Y B;  3TO9 A;  3I56 F;  4C4W C;  3CB2 A;  3J7A R;  2PMP A;  5LXT B;  1PF5 A;  5J2T B;  2OTM A;  1TGS I;  5FUW A;  5EAZ A;  3P10 A;  4FKD A;  2VGN A;  1ULN A;  1TUB A;  3NK7 A;  3QUW A;  1W41 A;  5MN5 A;  2P6A C;  1Z2I A;  5IJ0 B;  3C8L A;  4UXI A;  2I6D A;  1JY8 A;  3N4Y A;  4BVS A;  5JQG A;  2WGC A;  1TUB B;  3TOA A;  3GTZ A;  4NWO B;  3VIU A;  1XX6 A;  1WGC A;  2LUY A;  4G88 A;  4BT4 A;  2VAM A;  2AIZ P;  4RQO A;  1RLU A;  2NMU A;  3SGQ I;  1W42 A;  3ELC A;  3GHZ A;  4X20 A;  2Z1T A;  2CZW A;  3RYH A;  4WP4 A;  1W40 A;  3DDN A;  3RU0 A;  4ZI7 A;  4B5C A;  2RHL A;  1FFX B;  2BTU A;  4U3J B;  5MN6 A;  2VGM A;  3JCM M;  3VYT C;  3K14 A;  5E3P A;  1Q82 H;  1IV1 A;  3QHD A;  1PPF I;  5KX5 A;  1X7P A;  3G4S F;  4IIJ A;  2SGE I;  1FYB A;  1U3P A;  1CT2 I;  3FPI A;  3KE1 A;  3JAW B;  1E7K A;  3WGM A;  2B33 A;  4ZK7 A;  3WJR A;  3RA6 A;  4F6R B;  3UEJ A;  4BT5 A;  5HP7 A;  4NUT A;  2ZF8 A;  4SGB I;  3LYB A;  1W5A A;  3CD6 F;  5BMV B;  1TBQ R;  1R79 A;  3I3F A;  5LA6 B;  3WXM B;  1YJ9 F;  1LR9 A;  3QAH A;  5EB0 A;  1K7V A;  1P9Z A;  1HEV A;  4G4Z A;  5FUX A;  4ZHV A;  2YUU A;  5JCO C;  2UYP A;  7WGA A;  1U40 A;  5AVM A;  1SGY I;  3KIZ A;  2UZH A;  4WBN B;  3RE3 A;  4C8E A;  3RYC A;  1YIJ F;  4O4J B;  4TUY A;  4I55 B;  1DBF A;  4EI9 A;  4ZI7 B;  5JHW C;  2CWH A;  3TD3 A;  1IV3 A;  2LBX A;  2BTO A;  3M4S A;  5CB4 B;  3C9T A;  1Y1B A;  3R5C A;  4E1P A;  3SEK C;  3PDN A;  1NXU A;  4XCQ A;  2WCY A;  4YJ3 A;  3RYI A;  3ZO8 A;  3LWQ C;  1OFU A;  1VQP F;  4X3L A;  3NMU C;  1VDD A;  1CHO I;  2X3T A;  1OAP A;  2JZM A;  1W5B A;  3JAW A;  3JAS B;  4TV9 B;  1VQO F;  1CN7 A;  4O4L A;  1IPA A;  2ZOV A;  5CB4 A;  1OMT A;  5CCM A;  1Q8R A;  5DAE A;  1NQ3 A;  5GON B;  2F9Z C;  2QQC A;  3N4Z A;  2UYK A;  2N71 A;  1PCE A;  1TVK B;  1UUC A;  2OVO A;  3OBW A;  4EI7 A;  3FD6 A;  5EO3 A;  3VYU C;  3C9S A;  2RIJ A;  3JAT B;  3N2G B;  1T0A A;  3JVH A;  2K9H A;  4O4I A;  2R6R 1;  5LP6 B;  3KJK A;  1SGQ I;  2ZAU A;  5GON A;  4IHJ B;  5MN4 A;  3CME F;  2KG4 A;  3HKD A;  2V9Y A;  4F6R A;  1U43 A;  1K7U A;  2ROW A;  5J8F A;  1VQ8 F;  3V7Q A;  1IY6 A;  5CCL A;  1QD9 A;  4X1K B;  1W57 A;  2KMP A;  4BT6 A;  2LEO A;  5J2U B;  5JVD B;  4EB6 A;  3E20 B;  2QEX F;  4O2B A;  3N2K B;  3CXL A;  3ZP7 A;  1CT0 I;  2UYJ A;  4IHJ A;  1T0K B;  1TBO A;  2N17 A;  1JFF B;  3RYF B;  1VQ4 F;  1SGD I;  2OZB A;  3D01 A;  2CHT A;  3P4E A;  2LB7 A;  2H8C A;  1YGY A;  3CCE F;  1X74 A;  5G4U C;  3VTI C;  1K7T A;  4B62 A;  5J2T A;  1Q81 H;  3UGI A;  5LOV A;  1PTQ A;  1N13 A;  2SGQ I;  3IEW A;  3Q8H A;  3MEK A;  1XBI A;  1QVF F;  3QTY A;  5EYP A;  3HAX D;  1NMU B;  3MCA B;  4X3M A;  2GZL A;  4DRX A;  2DKV A;  1JN1 A;  4YJ2 A;  4UXJ A;  1IY5 A;  2ZVZ A;  5IYZ A;  5HP8 A;  1CGI I;  5HQ8 A;  1SA0 B;  2KMR A;  5JH7 A;  3SIV A;  3K12 A;  2W0T A;  1R1M A;  4BVR A;  1MJB A;  3IR9 A;  2K1S A;  5KMG A;  1KNK A;  5IYZ B;  2Z1F A;  2JXD A;  4DNC A;  3HKC A;  1XBT A;  5HY2 A;  3M84 A;  3C9U A;  4ZHQ A;  3OW2 F;  1U5K A;  3HKB B;  3B6N A; 
#chains in the Genus database with same CATH homology
 2NU0 I;  4YJ2 B;  4O4L B;  4WBN A;  1Z7K B;  2QQ0 A;  4IIJ B;  1H0Z A;  4X1I A;  2GKT I;  2XRC A;  3JAR B;  3OVO A;  2SGD I;  2VAW A;  3N2G A;  1CGJ I;  5EX0 A;  2L7X A;  2KCX A;  1CT4 I;  4B45 A;  4FFB A;  1DS3 I;  2B0U C;  5JQG B;  1TUR A;  2NU4 I;  1Z5W A;  2KMQ A;  2ODD A;  2VRW B;  5CA1 A;  4O2A B;  5CA0 A;  3SGB I;  2DIP A;  2NU3 I;  5LP6 A;  2GKV A;  5LXT A;  1KBE A;  4GI3 C;  1TBN A;  3HKD B;  1JFF A;  3RYF A;  2NU1 I;  1W58 1;  2ORV A;  2QQE A;  3KY9 A;  1HDL A;  3WGN A;  4EB6 B;  2OD1 A;  4LNU A;  2N1A B;  5IJ9 A;  2JYY A;  1M8B A;  5FNV A;  4O4H A;  1FAQ A;  5JH7 B;  2QPO A;  2B8T A;  4B6D A;  1W5F A;  4I50 B;  3WGJ A;  4TUY B;  1V1I A;  3UFF A;  1V1H A;  2JA1 A;  4OVO A;  5EYP B;  1X4S A;  3HH2 C;  5KMG B;  3JAS A;  5LA6 A;  4X1Y A;  5LYJ B;  2BUS A;  1TOT A;  4ZHQ B;  1PTR A;  2A20 A;  2RHH A;  1LR7 A;  1OVO A;  3E59 A;  2GKR I;  2E73 A;  3D00 A;  4U39 A;  4O4J A;  5IJ0 A;  5HI7 A;  2JW6 A;  1Z5V A;  1SGE I;  1SA0 A;  2J9R A;  1YU6 C;  1Y1C A;  4ZOL A;  2RHJ A;  3VO8 A;  3TJQ A;  1W4R A;  3OXF A;  5IJ9 B;  1UVF A;  3RYH B;  1IW4 A;  2M5X A;  1MT1 A;  2N52 A;  2ARP F;  4X1K A;  2WVJ A;  4DXD A;  1BMO A;  4ZOL B;  4I4T B;  1PJU A;  4FFB B;  1FSZ A;  3OXL A;  1W59 A;  1RFH A;  3BJI A;  4YJ3 B;  5ITZ B;  3JAR A;  1OMU A;  4I4T A;  3VDU A;  5EIB D;  1KMA A;  3VDP A;  3JAK A;  5EZY A;  4TV8 B;  4O4I B;  3RYI B;  3VE5 A;  3VOB A;  1RQ7 A;  5ITZ A;  2BTQ B;  2UZ3 A;  4E1R A;  2VXY A;  2ENN A;  3HKC B;  2ENZ A;  3E22 A;  2CJS C;  3QWP A;  5FNV B;  4TV9 A;  2RHO A;  2V53 A;  4I55 A;  4HNA A;  2GVI A;  3OXG A;  1KBF A;  5BMV A;  1UVG A;  4X1I B;  3FC3 A;  1R0R I;  4L9M A;  2E5R A;  5CA0 B;  4M8I A;  5LOV B;  4HGU A;  1M8C A;  4O2B B;  1CSO I;  4X20 B;  3JAT A;  2KMO A;  2QQD A;  3N2K A;  3QTL D;  4O2A A;  5KX5 B;  1BUS A;  4TV8 A;  1SGP I;  1TUS A;  5LP6 C;  3UEY A;  5JVD A;  1AN1 I;  3HKE B;  3UT5 B;  1TIH A;  1HPT A;  4X1Y B;  5LYJ A;  1TBR R;  2ORW A;  3GOX A;  1W5E A;  3UGD A;  3VOA A;  2YQP A;  1YTP A;  5EX3 A;  2V1C C;  4A24 A;  4I50 A;  2Q1X A;  1TVK A;  2NU2 I;  2L8E A;  4JCV E;  3HKB A;  2F3C I;  5C8Y A;  4E6E A;  5EIB C;  1Y8F A;  4B46 A;  2ERW A;  1NUB A;  2DB6 A;  2R75 1;  2FNF X;  5JCO A;  5CA1 B;  4UXH A;  2SGF I;  3JAL B;  3WGL A;  3E2I A;  4DRX B;  1FAR A;  2ELI A;  3RYC B;  1HJA I;  3E22 B;  3OL0 A;  1DS2 I;  1CE3 A;  1SGR I;  3JAL A;  4HNA B;  1RQ2 A;  1FFX A;  4U3J A;  5FUY A;  4O4H B;  2VAP A;  1W3S A;  3UGL A;  1SGN I;  5J2U A;  3B4V C;  5FUV A;  4LNU B;  2J87 A;  1XA6 A;  1LR8 A;  2V1C A;  4KWE A;  2Q1Y A;  2SGP I;  3WGK A;  3JAK B;  3HKE A;  3UT5 A;  5EZY B;  1OYV I;  5C8Y B;  3CB2 A;  5LXT B;  5J2T B;  1TGS I;  5FUW A;  4FKD A;  1TUB A;  5MN5 A;  2P6A C;  5IJ0 B;  3C8L A;  4UXI A;  5JQG A;  1TUB B;  1XX6 A;  2LUY A;  2VAM A;  1RLU A;  3SGQ I;  4X20 A;  3RYH A;  4ZI7 A;  5MN6 A;  3RU0 A;  2RHL A;  1FFX B;  4U3J B;  1PPF I;  5KX5 A;  4IIJ A;  2SGE I;  1FYB A;  1CT2 I;  3JAW B;  3WGM A;  4F6R B;  3UEJ A;  4SGB I;  1W5A A;  5BMV B;  1TBQ R;  1R79 A;  5LA6 B;  1LR9 A;  5FUX A;  2YUU A;  5JCO C;  1SGY I;  4WBN B;  3RYC A;  4O4J B;  4TUY A;  4I55 B;  4ZI7 B;  5JHW C;  2BTO A;  5CB4 B;  1Y1B A;  4E1P A;  3SEK C;  3PDN A;  3RYI A;  4YJ3 A;  2WCY A;  1OFU A;  1VDD A;  1CHO I;  3JAW A;  2JZM A;  1W5B A;  3JAS B;  4TV9 B;  4O4L A;  5CB4 A;  1OMT A;  5CCM A;  5DAE A;  5GON B;  2QQC A;  2N71 A;  1PCE A;  1TVK B;  1UUC A;  2OVO A;  3JAT B;  3N2G B;  2K9H A;  4O4I A;  2R6R 1;  5LP6 B;  1SGQ I;  5GON A;  4IHJ B;  5MN4 A;  3HKD A;  4F6R A;  2ROW A;  1IY6 A;  5CCL A;  4X1K B;  2KMP A;  2LEO A;  5J2U B;  5JVD B;  4EB6 A;  4O2B A;  3N2K B;  3CXL A;  1CT0 I;  4IHJ A;  1TBO A;  2N17 A;  1JFF B;  3RYF B;  1SGD I;  1X74 A;  5J2T A;  3UGI A;  5LOV A;  1PTQ A;  1N13 A;  2SGQ I;  3MEK A;  5EYP A;  4DRX A;  4YJ2 A;  4UXJ A;  1IY5 A;  5IYZ A;  1CGI I;  5HQ8 A;  1SA0 B;  2KMR A;  5JH7 A;  2W0T A;  5KMG A;  5IYZ B;  2JXD A;  3HKC A;  1XBT A;  4ZHQ A;  1U5K A;  3HKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...