2GVIA

Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords conserved hypothetical protein
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 51
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3320.10 Mainly Alpha Orthogonal Bundle pa2218 like fold pa2218 like domain 2gviA01
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gviA03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2gviA02
2WVJA 3HKBA 4X1KA 4X1YB 4YJ3B 5IJ0A 3RYCB 2RHHA 4I4TA 4I50A 4EB6A 3E22B 5ITZB 5IYZB 1RQ2A 2ENNA 1PTQA 4O4HA 5LYJA 5IJ9B 3UT5A 3WGLA 1TBOA 1TVKB 4O4JA 4X1KB 3JAKA 4EB6B 5EYPB 2VAWA 4UXIA 3JAWA 5LOVA 5MN5A 2QQEA 1OFUA 4U39A 3WGJA 1RLUA 4O4JB 1TUBA 3UFFA 3JAKB 3UGIA 4UXHA 3E2IA 5EIBC 5IYZA 3JAWB 3VOBA 5JQGB 5CA1A 5JVDA 4O2BB 2VAPA 4ZI7A 2Q1YA 4ZHQA 4IIJA 4X1YA 4YJ3A 2QPOA 2ELIA 4O2AA 3WGMA 2R6R1 2B8TA 3HKCA 3E22A 3CB2A 5CA1B 2ORWA 4WBNB 1KBFA 4O4IB 1XX6A 2ENZA 3WGNA 4O2AB 4TUYA 3HKCB 5EYPA 1SA0A 2BTOA 1XA6A 1XBTA 1RQ7A 5LXTA 3UGDA 1R79A 1W581 5CB4B 4FFBA 2R751 1Z5VA 4TUYB 1SA0B 5FNVB 5LA6A 5JQGA 5LXTB 2QQ0A 2RHJA 4O2BA 3KY9A 4FKDA 5KMGB 4FFBB 4TV9B 4IHJA 1RFHA 5LA6B 4WBNA 1PTRA 5FUWA 4O4IA 5J2UB 2VAMA 4F6RA 4IHJB 3HKDB 5FUVA 1W59A 4TV8B 5FUXA 1FSZA 1JFFB 4U3JB 1FARA 4DXDA 4F6RB 3VOAA 5CA0A 5CB4A 4IIJB 4M8IA 1W5FA 5MN4A 3RYFA 5FNVA 4DRXB 5JCOA 1W5EA 4UXJA 4YJ2A 1W5AA 5GONB 3BJIA 5KMGA 3JARA 3N2KB 2GVIA 5CA0B 4L9MA 3VO8A 4TV9A 3RYFB 1FFXA 3JATB 2VRWB 2VXYA 4O4LB 4YJ2B 2JA1A 3RYCA 3JARB 3RYIA 4B45A 5BMVA 5J2UA 3HKEA 4X20B 1FFXB 3HKDA 3UEJA 3JASA 4TV8A 4LNUA 4X1IA 1W4RA 5FUYA 5KX5A 2FNFX 5JCOC 3RYIB 1JFFA 4U3JA 5BMVB 4KWEA 3HKEB 1FAQA 5J2TB 2RHOA 2DB6A 3JASB 4HNAB 4I55B 4LNUB 4X1IB 3RYHA 4DRXA 2ORVA 5KX5B 1Z5WA 3UGLA 4ZOLA 3CXLA 5JH7A 5GONA 4E6EA 5C8YB 3N2KA 3WGKA 3C8LA 3HKBB 5IJ0B 5LP6A 3JATA 4I4TB 4I50B 2E73A 3RYHB 3UEYA 4O4LA 4ZOLB 2J9RA 5JH7B 4O4HB 5LYJB 3UT5B 1W5BA 2YUUA 1Y8FA 3N2GA 4X20A 2BTQB 5LP6B 5EZYA 2ROWA 3JALA 5LOVB 2RHLA 4B46A 5EIBD 2Q1XA 5MN6A 1TBNA 4B6DA 3N2GB 5J2TA 1TUBB 5EZYB 4HNAA 4I55A 5LP6C 3JALB 5ITZA 2J87A 5JVDB 4ZI7B 5IJ9A 5C8YA 1KBEA 2UZ3A 4ZHQB 1TVKA
chains in the Genus database with same CATH superfamily
2KMPA 2Y0MA 4X1KA 3RYCB 4X3MA 4I50A 3O85A 4I4TA 1PF5A 2ENNA 1PTQA 3LWOC 4O4HA 3SGQI 3FPIA 3TD4A 3WGLA 1T0KB 4G4ZA 4O4JA 2YXZA 4G4WA 4EB6B 3CCUF 3NMUC 5GANK 2WGCA 4UXIA 1W55A 1KNKA 3JAWA 5MN5A 3LYBA 2H8CA 2CWGA 2KGWA 4U39A 1X4SA 1V1HA 1WTJA 1Q8RA 3JAKB 2ZVYA 4O2BB 2B33A 3WJRA 3S06A 4BT3A 2Q1YA 4ZHQA 1JJ2F 3VYSC 2ELIA 3NK7A 2OU2A 1NMUB 3E22A 3K0TA 5J8CA 3V4DA 3VI6A 1YU6C 3SEKC 1XX6A 2LEOA 3CCLF 3QUWA 3WGNA 3CXCF 4TUYA 4X3LA 3UOEA 4WP4A 1XBTA 5EB1B 3CD6F 4C4WC 3K14A 5CB4B 2OD1A 2BO1A 2M5XA 2HP3A 1Q86H 1SGQI 2CW4A 2HRUA 3WPWA 2HRYA 1U43A 3E20B 4G88A 4IHJA 3VIUA 1K73H 3LWRC 1X25A 1N8RH 2HS3A 4O4IA 2VAMA 3DDNA 4ZHYB 5FUXA 2Z1EA 4GI3C 2KG4A 1JFFB 1FARA 5MN4A 2P6AC 1HDLA 1PXWA 3CCQF 5FNVA 3NVIB 5EO3A 4BVTA 1XV2A 1Q7YH 1S20A 3N2KB 4L9MA 2KTVA 3VO8A 3KJKA 3SGBI 2RC4A 3JATB 2GKVA 4O4LB 1U5KA 3RYIA 5J2UA 3HKEA 2DIPA 3HKDA 3UEJA 3F0GA 3JASA 3CC2F 3CCVF 5HY4A 3PAFA 3G4SF 5BMVB 3VDUA 1KQSF 5J2TB 3C9UA 1H7MA 1H0ZA 2LCAA 3MCAB 2ZODA 4HNAB 4LNUB 3JCMM 2NU2I 4X1IB 1SGDI 3OW2F 1UUCA 1SDSA 1Z5WA 4E6EA 5G4VC 2ERWA 2WALA 5LP6A 3TO7A 2G9IA 4I50B 4I4TB 3Q8HA 1Y1CA 2K1SA 2J9RA 5JH7B 3I7TA 4O4HB 3IKFA 4B5CA 2SGQI 1K7TA 2YUUA 3CYPB 3S03A 2BTQB 3QTYA 1CE3A 1VQ8F 1CSOI 2ROWA 2UYPA 1UVFA 3CCRF 3N4ZA 2YYEA 1TIHA 3VCZA 4G4XA 2VGNA 2N71A 3P4EA 5EZYB 3D00A 3GHZA 3WPXA 3R0PA 1CT0I 3C9RA 5IJ9A 2UVOA 1M8CA 3WXMB 4ZHQB 3JVHA 2WVJA 3HKBA 5IJ0A 3HTNA 5ITZB 3E22B 3NK6A 2F3CI 3ZOPA 2UYNB 2RIJA 5HY2A 4BT2A 5HXUA 2N17A 2PHNA 1MJBA 1Q9BA 3IR9A 1W57A 2DKVA 1X52A 2VAWA 3MBMA 4RQOA 3JAMM 2HQSC 3CYQA 1UHAA 4HGUA 5FLXM 1X7OA 1VQOF 1RLUA 3WJQA 5FJ4C 3E2IA 1SZQA 5EIBC 5IYZA 3LWPC 1VQ9F 5CA1A 5JVDA 4ZI7A 3B4VC 2GZLA 3F6MA 2X3TA 1FY7A 4IIJA 2V53A 1CLIA 1QU9A 3OVOA 1W42A 1FNJA 3HKCA 4G4VA 3VDPA 2ORWA 2IG8A 3FFMA 1OMTA 2NU0I 3IMPA 3CPWF 4JCVE 4O4IB 1IV4A 3CCMF 3GOXA 1VH8A 2CVLA 3J80M 1X74A 2X52A 4O2AB 1WGTA 2HP0A 5GAPK 1IW4A 2CWJA 2JYYA 3C9TA 4LCKA 4C8IA 1K9MH 4FFBA 5DCVA 1V1IA 5GINC 3HAXD 3DC2A 3TOAA 1SA0B 2DYYA 5FNVB 4MPIA 5JQGA 3FSYA 5LXTB 3FD6A 2QQ0A 2KTUA 2ARPF 2ODDA 1RFHA 3E59A 5LA6B 5HY0A 5HQ8A 1KD1H 5FUWA 5J2UB 1CT4I 3P10A 2CWFA 1JN1A 1QVFF 3HKDB 3VYUC 2EWCA 3OL0A 4B62A 3I55F 4ZHWA 3KHNA 2CSLA 2IQQA 4AMLA 3LDTA 1GO0A 4F6RB 3F0EA 5CA0A 3MQWA 1QVGF 3RYFA 2BUSA 5JCOA 2HS4A 1W5AA 1Q81H 5KMGA 2OZBA 1YJ9F 5E3PA 3EORA 2QQCA 4TV9A 1COMA 3U0OA 2VRWB 3RU0A 4YJ2B 1HPTA 1W2BF 2LBXA 3TD5A 2W0TA 3JARB 4B45A 2ZAUA 1FFXB 5B8FA 1TUSA 4TV8A 5EX3A 3KE1A 5FUYA 2E5RA 1CHOI 2PMPA 4U3JA 2FC3A 4KWEA 5EWRA 1FAQA 3R5BA 2RHOA 3D54A 2LUYA 5HY1A 1N13A 2FGYA 3RYHA 5IT9M 5KX5B 1YJWF 1VQNF 4ZOLA 4G4YA 2LBTA 2Z01A 1VHAA 1YQNA 3HKBB 4EI8A 1XBIA 2OTMA 2SGFI 5IJ0B 2OTJF 2NU1I 2E73A 1IY6A 3UEYA 3IKEA 5EAZA 1CK2A 1W5BA 1K8AH 3N2GA 5EX0A 3B6NA 1OAPA 3J81M 4ERHA 5CCMA 3JALA 9WGAA 1P9GA 2SGDI 2I6RA 1YTPA 2ZOVA 1SGEI 3MCQA 3R5CA 5MN6A 2DT4A 3G71F 2Z1UA 3P0ZA 4PWTA 2BTUA 5A2QM 4I55A 1H47A 1VQMF 2P6YA 5LP6C 1CGII 1SGRI 5JVDB 4ZI7B 5C8YA 1KBEA 2UZ3A 2NMUA 4IIJB 4M8IA 1Y1BA 4C81A 2AIFA 2RHHA 4EB6A 3S0YA 3RE3A 4C82A 1RQ2A 2N1AB 3UT5A 1NXUA 1TBOA 1TVKB 3QHDA 5HXZA 2OZUA 4X1KB 4BVQA 1XHOA 3PLAC 2JNBA 3JAKA 2HP0B 2LBWA 2QQEA 1LR7A 1DBFA 2Z1TA 1YI2F 4O4JB 3OONA 1TUBA 3VE5A 3ESJA 2L7XA 3JAWB 5JQGB 1M90H 2VAPA 2HS0A 2KMQA 1ONIA 2ALEA 3ON1A 4X1YA 4YJ3A 2QPOA 3WGMA 1KMAA 3CB2A 4BVSA 1KBFA 4A24A 4DNCA 1FNKA 3OBWA 2ENZA 1ZWZA 5EYPA 4BY9D 2BTOA 3GTZA 1XA6A 3UGDA 3N4YA 1W581 3KJJA 3CC7F 4TUYB 2MQEA 3V7QA 3MDOA 1X7PA 5GIPC 4FKDA 5KMGB 3CCSF 4BVRA 1R0RI 3TJQA 2HVYD 1TBQR 5GIOC 4TV9B 1UFYA 5E3RA 1U40A 1MJ9A 1IY5A 1OVOA 4WBNA 2V9YA 1PTRA 1U3LA 3CPQA 4IHJB 2V1CA 5J8FA 1Z2IA 4TV8B 3I3FA 3MEKA 3OXGA 2ZF8A 1W40A 1OMUA 4ZHVA 3CMEF 4U3JB 3L7QA 4DXDA 3I56F 3VOAA 1W5FA 5AVMA 3NVKE 3FBAA 1ULMA 1M8BA 2NU4I 3LFOA 1K7VA 1VQKF 2XRCA 3BJIA 1K7UA 2UYJA 2GVIA 1UI9A 2GKRI 3OXLA 2QTPA 2RB9A 3K12A 3LMEA 2VXYA 3VTIC 2JA1A 4R40B 5BMVA 1VQVA 4NWOB 4LNUA 4X1IA 3HJWC 1W4RA 2GLZA 5JCOC 3RYIB 1AN1I 3QTLD 3HKEB 3CMAF 2DB6A 3JASB 2PQ8A 4I55B 3G6EF 2CWHA 1VQ7F 4DRXA 2QI2A 1CN7A 3ZP4A 3UGLA 3LWQC 5JH7A 5GONA 1IV2A 5C8YB 3CG6A 1VQLF 2SGPI 3FSXA 2IAFA 1TOTA 2CJSC 3OXFA 3R5DA 3C8LA 3S0WA 1NUBA 1YITF 5HI7A 1H48A 3LWVC 1GZ0A 3RA6A 3TO9A 1QAHA 1FYBA 3UT5B 1VQ6F 4X20A 1CGJI 1DS3I 5LP6B 1YJNF 3SIVA 5EZYA 3FD5A 2H6LA 5EB0A 2JW6A 4B46A 5EIBD 2Q1XA 3CC4F 1RA4A 3PDNA 4B6DA 1TUBB 1NJIH 2QA4F 3V3TA 4EI7A 5ITZA 2J87A 2OHWA 1LR8A 4TZZA 3HH2C 2UYNA 3D01A 1E7KA 4X1YB 4YJ3B 1YHQF 1Z7KB 1W3SA 4BT6A 1SGYI 5LYJA 5IJ9B 2W8BC 3R5AA 1HJAI 1DT9A 3RA5A 3QAHA 3K2XA 1W3EX 4C8GA 5EYPB 3CCEF 3E1YA 2L26A 1WGCA 5LOVA 2CHTA 1OFUA 3WGJA 1M1KH 3ERNA 4NQ3A 3UFFA 3UGIA 4UXHA 1XRGA 1VQPF 7WGAA 1PJUA 4BW0B 3F0FA 3VOBA 4OVOA 2VGMA 1IPAA 2ZVZA 1BUSA 4BT5A 2L8EA 3HWUA 5IYZB 1ULKA 4O2AA 3RYCA 2R6R1 2B8TA 1S72F 5CA1B 1WKXA 1LR9A 2AIZP 1YGYA 4WBNB 4E1PA 3ZP7A 2QEXF 1VQ5F 1CT2I 1GX1A 3IEWA 3HKCB 3M1XA 4EI9A 1SA0A 2CZWA 4ZK7A 2LB7A 3S02A 2B0UC 1RQ7A 1ULNA 2N48A 5LXTA 3T80A 1R79A 5HP8A 1DS2I 1VQ4F 1QD9A 2R751 1U3PA 1Z5VA 5LA6A 2RHJA 3IEQA 1JD1A 3KY9A 3BYQA 4O2BA 1YIJF 2Z1FA 3TOBA 1JY8A 4FFBB 3M84A 1Q82H 3QWPA 2UZHA 2GIVA 2K9HA 3GYQA 2I6DA 2OTLF 3ELCA 3F0DA 4F6RA 2YQPA 5FUVA 1W59A 1SGNI 2AMTA 3FC3A 1P9ZA 1FSZA 2JZMA 5JHWC 5CB4A 1NQ3A 1IV3A 3VYTC 1GO1A 1PPFI 4DRXB 1W5EA 4UXJA 5HP7A 4YJ2A 5GONB 1ODEA 1KC8H 3JARA 5G4UC 5CA0B 3CCJF 3KIZA 3RYFB 1FFXA 2JXDA 2V1CC 2GKTI 3TD3A 1TGSI 5CCLA 3SIUA 2NU3I 1R1MA 2UYKA 4X20B 1HEVA 3C9SA 4NUTA 1BMOA 1SGPI 2CHSA 4RHAA 1T0AA 2F9ZC 5KX5A 3M4SA 2FNFX 3AGKA 1JFFA 2SGEI 2KCXA 4BT4A 3VMFB 4BT7A 1J7HA 2ORVA 2KMRA 1W41A 3V7EA 3CXLA 3TO6A 4C8EA 5HWEA 1UVGA 2H8EA 2QQDA 1MT1A 3N2KA 3WGKA 5DAEA 3JATA 3RYHB 3J7AR 4O4LA 4ZOLB 1VDDA 2WCYA 5LYJB 5E3QA 1Y8FA 1MJAA 2HX0A 3WJPA 2KMOA 1PCEA 3OBYA 2OVOA 1TBRR 5LOVB 2RHLA 1TURA 1TBNA 3N2GB 5J2TA 2A20A 1KNJA 4XCQA 4HNAA 3S0HA 1OYVI 3JALB 1RLGA 1IV1A 3ZO8A 4SGBI 4E1RA 1TVKA 1VK3A 2N52A
chains in the Genus database with same CATH topology
2KMPA 4X1KA 3RYCB 4I50A 4I4TA 2ENNA 1PTQA 4O4HA 3SGQI 3WGLA 4O4JA 4EB6B 4UXIA 3JAWA 5MN5A 4U39A 1X4SA 1V1HA 3JAKB 4O2BB 2Q1YA 4ZHQA 2ELIA 3E22A 1YU6C 3SEKC 1XX6A 2LEOA 3WGNA 4TUYA 1XBTA 5CB4B 2OD1A 2M5XA 1SGQI 4IHJA 4O4IA 2VAMA 5FUXA 4GI3C 1JFFB 1FARA 5MN4A 2P6AC 1HDLA 5FNVA 3N2KB 4L9MA 3VO8A 3SGBI 3JATB 2GKVA 4O4LB 1U5KA 3RYIA 5J2UA 3HKEA 2DIPA 3HKDA 3UEJA 3JASA 5BMVB 3VDUA 5J2TB 1H0ZA 4HNAB 4LNUB 2NU2I 4X1IB 1SGDI 1UUCA 1Z5WA 4E6EA 2ERWA 5LP6A 4I50B 4I4TB 1Y1CA 2J9RA 5JH7B 4O4HB 2SGQI 2YUUA 2BTQB 1CE3A 1CSOI 2ROWA 1UVFA 1TIHA 2N71A 5EZYB 3D00A 1CT0I 5IJ9A 1M8CA 4ZHQB 2WVJA 3HKBA 5IJ0A 5ITZB 3E22B 2F3CI 2N17A 2VAWA 4HGUA 1RLUA 3E2IA 5EIBC 5IYZA 5CA1A 5JVDA 4ZI7A 3B4VC 4IIJA 2V53A 3HKCA 3OVOA 3VDPA 2ORWA 1OMTA 2NU0I 4JCVE 4O4IB 3GOXA 1X74A 4O2AB 1IW4A 2JYYA 4FFBA 1V1IA 1SA0B 5FNVB 5JQGA 5LXTB 2QQ0A 2ARPF 2ODDA 1RFHA 3E59A 5LA6B 5HQ8A 5FUWA 5J2UB 1CT4I 3HKDB 3OL0A 4F6RB 5CA0A 3RYFA 2BUSA 5JCOA 1W5AA 5KMGA 4TV9A 2QQCA 2VRWB 3RU0A 4YJ2B 1HPTA 2W0TA 3JARB 4B45A 1FFXB 1TUSA 4TV8A 5EX3A 5FUYA 2E5RA 1CHOI 4U3JA 4KWEA 1FAQA 2RHOA 2LUYA 1N13A 3RYHA 5KX5B 4ZOLA 3HKBB 5IJ0B 2SGFI 2NU1I 2E73A 1IY6A 3UEYA 1W5BA 3N2GA 5EX0A 5CCMA 3JALA 2SGDI 1YTPA 1SGEI 5MN6A 4I55A 5LP6C 1CGII 1SGRI 5JVDB 4ZI7B 5C8YA 1KBEA 2UZ3A 4IIJB 4M8IA 1Y1BA 2RHHA 4EB6A 1RQ2A 2N1AB 3UT5A 1TBOA 1TVKB 4X1KB 3JAKA 2QQEA 1LR7A 4O4JB 1TUBA 3VE5A 2L7XA 3JAWB 5JQGB 2VAPA 2KMQA 4X1YA 4YJ3A 2QPOA 3WGMA 1KMAA 3CB2A 1KBFA 4A24A 2ENZA 5EYPA 2BTOA 1XA6A 3UGDA 1W581 4TUYB 4FKDA 5KMGB 1R0RI 3TJQA 1TBQR 4TV9B 1IY5A 1OVOA 4WBNA 1PTRA 4IHJB 2V1CA 4TV8B 3MEKA 3OXGA 1OMUA 4U3JB 4DXDA 3VOAA 1W5FA 1M8BA 2NU4I 2XRCA 3BJIA 2GVIA 2GKRI 3OXLA 2VXYA 2JA1A 5BMVA 4LNUA 4X1IA 1W4RA 5JCOC 3RYIB 1AN1I 3QTLD 3HKEB 2DB6A 3JASB 4I55B 4DRXA 3UGLA 5JH7A 5GONA 5C8YB 2SGPI 1TOTA 2CJSC 3OXFA 3C8LA 1NUBA 5HI7A 1FYBA 3UT5B 4X20A 1CGJI 1DS3I 5LP6B 5EZYA 2JW6A 4B46A 5EIBD 2Q1XA 3PDNA 4B6DA 1TUBB 5ITZA 2J87A 1LR8A 3HH2C 4X1YB 4YJ3B 1Z7KB 1W3SA 1SGYI 5LYJA 5IJ9B 1HJAI 5EYPB 5LOVA 1OFUA 3WGJA 3UFFA 3UGIA 4UXHA 3VOBA 1PJUA 4OVOA 1BUSA 2L8EA 5IYZB 4O2AA 3RYCA 2R6R1 2B8TA 5CA1B 1LR9A 4WBNB 4E1PA 1CT2I 3HKCB 1SA0A 2B0UC 1RQ7A 5LXTA 1R79A 1DS2I 2R751 1Z5VA 5LA6A 2RHJA 4O2BA 3KY9A 4FFBB 3QWPA 2K9HA 4F6RA 2YQPA 5FUVA 1W59A 1SGNI 3FC3A 1FSZA 2JZMA 5JHWC 5CB4A 1PPFI 4DRXB 1W5EA 4UXJA 4YJ2A 5GONB 3JARA 5CA0B 3RYFB 1FFXA 2JXDA 2V1CC 2GKTI 1TGSI 5CCLA 2NU3I 4X20B 1BMOA 1SGPI 5KX5A 2FNFX 1JFFA 2SGEI 2KCXA 2ORVA 2KMRA 3CXLA 3N2KA 1UVGA 2QQDA 1MT1A 3WGKA 5DAEA 3JATA 3RYHB 4O4LA 4ZOLB 1VDDA 2WCYA 5LYJB 1Y8FA 2KMOA 1PCEA 2OVOA 1TBRR 5LOVB 2RHLA 1TURA 1TBNA 3N2GB 5J2TA 2A20A 4HNAA 1OYVI 3JALB 4SGBI 4E1RA 1TVKA 2N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVJ A;  3HKB A;  4X1K A;  4X1Y B;  4YJ3 B;  5IJ0 A;  3RYC B;  2RHH A;  4I4T A;  4I50 A;  4EB6 A;  3E22 B;  5ITZ B;  5IYZ B;  1RQ2 A;  2ENN A;  1PTQ A;  4O4H A;  5LYJ A;  5IJ9 B;  3UT5 A;  3WGL A;  1TBO A;  1TVK B;  4O4J A;  4X1K B;  3JAK A;  4EB6 B;  5EYP B;  2VAW A;  4UXI A;  3JAW A;  5LOV A;  5MN5 A;  2QQE A;  1OFU A;  4U39 A;  3WGJ A;  1RLU A;  4O4J B;  1TUB A;  3UFF A;  3JAK B;  3UGI A;  4UXH A;  3E2I A;  5EIB C;  5IYZ A;  3JAW B;  3VOB A;  5JQG B;  5CA1 A;  5JVD A;  4O2B B;  2VAP A;  4ZI7 A;  2Q1Y A;  4ZHQ A;  4IIJ A;  4X1Y A;  4YJ3 A;  2QPO A;  2ELI A;  4O2A A;  3WGM A;  2R6R 1;  2B8T A;  3HKC A;  3E22 A;  3CB2 A;  5CA1 B;  2ORW A;  4WBN B;  1KBF A;  4O4I B;  1XX6 A;  2ENZ A;  3WGN A;  4O2A B;  4TUY A;  3HKC B;  5EYP A;  1SA0 A;  2BTO A;  1XA6 A;  1XBT A;  1RQ7 A;  5LXT A;  3UGD A;  1R79 A;  1W58 1;  5CB4 B;  4FFB A;  2R75 1;  1Z5V A;  4TUY B;  1SA0 B;  5FNV B;  5LA6 A;  5JQG A;  5LXT B;  2QQ0 A;  2RHJ A;  4O2B A;  3KY9 A;  4FKD A;  5KMG B;  4FFB B;  4TV9 B;  4IHJ A;  1RFH A;  5LA6 B;  4WBN A;  1PTR A;  5FUW A;  4O4I A;  5J2U B;  2VAM A;  4F6R A;  4IHJ B;  3HKD B;  5FUV A;  1W59 A;  4TV8 B;  5FUX A;  1FSZ A;  1JFF B;  4U3J B;  1FAR A;  4DXD A;  4F6R B;  3VOA A;  5CA0 A;  5CB4 A;  4IIJ B;  4M8I A;  1W5F A;  5MN4 A;  3RYF A;  5FNV A;  4DRX B;  5JCO A;  1W5E A;  4UXJ A;  4YJ2 A;  1W5A A;  5GON B;  3BJI A;  5KMG A;  3JAR A;  3N2K B;  2GVI A;  5CA0 B;  4L9M A;  3VO8 A;  4TV9 A;  3RYF B;  1FFX A;  3JAT B;  2VRW B;  2VXY A;  4O4L B;  4YJ2 B;  2JA1 A;  3RYC A;  3JAR B;  3RYI A;  4B45 A;  5BMV A;  5J2U A;  3HKE A;  4X20 B;  1FFX B;  3HKD A;  3UEJ A;  3JAS A;  4TV8 A;  4LNU A;  4X1I A;  1W4R A;  5FUY A;  5KX5 A;  2FNF X;  5JCO C;  3RYI B;  1JFF A;  4U3J A;  5BMV B;  4KWE A;  3HKE B;  1FAQ A;  5J2T B;  2RHO A;  2DB6 A;  3JAS B;  4HNA B;  4I55 B;  4LNU B;  4X1I B;  3RYH A;  4DRX A;  2ORV A;  5KX5 B;  1Z5W A;  3UGL A;  4ZOL A;  3CXL A;  5JH7 A;  5GON A;  4E6E A;  5C8Y B;  3N2K A;  3WGK A;  3C8L A;  3HKB B;  5IJ0 B;  5LP6 A;  3JAT A;  4I4T B;  4I50 B;  2E73 A;  3RYH B;  3UEY A;  4O4L A;  4ZOL B;  2J9R A;  5JH7 B;  4O4H B;  5LYJ B;  3UT5 B;  1W5B A;  2YUU A;  1Y8F A;  3N2G A;  4X20 A;  2BTQ B;  5LP6 B;  5EZY A;  2ROW A;  3JAL A;  5LOV B;  2RHL A;  4B46 A;  5EIB D;  2Q1X A;  5MN6 A;  1TBN A;  4B6D A;  3N2G B;  5J2T A;  1TUB B;  5EZY B;  4HNA A;  4I55 A;  5LP6 C;  3JAL B;  5ITZ A;  2J87 A;  5JVD B;  4ZI7 B;  5IJ9 A;  5C8Y A;  1KBE A;  2UZ3 A;  4ZHQ B;  1TVK A; 
#chains in the Genus database with same CATH topology
 2KMP A;  2Y0M A;  4X1K A;  3RYC B;  4X3M A;  4I50 A;  3O85 A;  4I4T A;  1PF5 A;  2ENN A;  1PTQ A;  3LWO C;  4O4H A;  3SGQ I;  3FPI A;  3TD4 A;  3WGL A;  1T0K B;  4G4Z A;  4O4J A;  2YXZ A;  4G4W A;  4EB6 B;  3CCU F;  3NMU C;  5GAN K;  2WGC A;  4UXI A;  1W55 A;  1KNK A;  3JAW A;  5MN5 A;  3LYB A;  2H8C A;  2CWG A;  2KGW A;  4U39 A;  1X4S A;  1V1H A;  1WTJ A;  1Q8R A;  3JAK B;  2ZVY A;  4O2B B;  2B33 A;  3WJR A;  3S06 A;  4BT3 A;  2Q1Y A;  4ZHQ A;  1JJ2 F;  3VYS C;  2ELI A;  3NK7 A;  2OU2 A;  1NMU B;  3E22 A;  3K0T A;  5J8C A;  3V4D A;  3VI6 A;  1YU6 C;  3SEK C;  1XX6 A;  2LEO A;  3CCL F;  3QUW A;  3WGN A;  3CXC F;  4TUY A;  4X3L A;  3UOE A;  4WP4 A;  1XBT A;  5EB1 B;  3CD6 F;  4C4W C;  3K14 A;  5CB4 B;  2OD1 A;  2BO1 A;  2M5X A;  2HP3 A;  1Q86 H;  1SGQ I;  2CW4 A;  2HRU A;  3WPW A;  2HRY A;  1U43 A;  3E20 B;  4G88 A;  4IHJ A;  3VIU A;  1K73 H;  3LWR C;  1X25 A;  1N8R H;  2HS3 A;  4O4I A;  2VAM A;  3DDN A;  4ZHY B;  5FUX A;  2Z1E A;  4GI3 C;  2KG4 A;  1JFF B;  1FAR A;  5MN4 A;  2P6A C;  1HDL A;  1PXW A;  3CCQ F;  5FNV A;  3NVI B;  5EO3 A;  4BVT A;  1XV2 A;  1Q7Y H;  1S20 A;  3N2K B;  4L9M A;  2KTV A;  3VO8 A;  3KJK A;  3SGB I;  2RC4 A;  3JAT B;  2GKV A;  4O4L B;  1U5K A;  3RYI A;  5J2U A;  3HKE A;  2DIP A;  3HKD A;  3UEJ A;  3F0G A;  3JAS A;  3CC2 F;  3CCV F;  5HY4 A;  3PAF A;  3G4S F;  5BMV B;  3VDU A;  1KQS F;  5J2T B;  3C9U A;  1H7M A;  1H0Z A;  2LCA A;  3MCA B;  2ZOD A;  4HNA B;  4LNU B;  3JCM M;  2NU2 I;  4X1I B;  1SGD I;  3OW2 F;  1UUC A;  1SDS A;  1Z5W A;  4E6E A;  5G4V C;  2ERW A;  2WAL A;  5LP6 A;  3TO7 A;  2G9I A;  4I50 B;  4I4T B;  3Q8H A;  1Y1C A;  2K1S A;  2J9R A;  5JH7 B;  3I7T A;  4O4H B;  3IKF A;  4B5C A;  2SGQ I;  1K7T A;  2YUU A;  3CYP B;  3S03 A;  2BTQ B;  3QTY A;  1CE3 A;  1VQ8 F;  1CSO I;  2ROW A;  2UYP A;  1UVF A;  3CCR F;  3N4Z A;  2YYE A;  1TIH A;  3VCZ A;  4G4X A;  2VGN A;  2N71 A;  3P4E A;  5EZY B;  3D00 A;  3GHZ A;  3WPX A;  3R0P A;  1CT0 I;  3C9R A;  5IJ9 A;  2UVO A;  1M8C A;  3WXM B;  4ZHQ B;  3JVH A;  2WVJ A;  3HKB A;  5IJ0 A;  3HTN A;  5ITZ B;  3E22 B;  3NK6 A;  2F3C I;  3ZOP A;  2UYN B;  2RIJ A;  5HY2 A;  4BT2 A;  5HXU A;  2N17 A;  2PHN A;  1MJB A;  1Q9B A;  3IR9 A;  1W57 A;  2DKV A;  1X52 A;  2VAW A;  3MBM A;  4RQO A;  3JAM M;  2HQS C;  3CYQ A;  1UHA A;  4HGU A;  5FLX M;  1X7O A;  1VQO F;  1RLU A;  3WJQ A;  5FJ4 C;  3E2I A;  1SZQ A;  5EIB C;  5IYZ A;  3LWP C;  1VQ9 F;  5CA1 A;  5JVD A;  4ZI7 A;  3B4V C;  2GZL A;  3F6M A;  2X3T A;  1FY7 A;  4IIJ A;  2V53 A;  1CLI A;  1QU9 A;  3OVO A;  1W42 A;  1FNJ A;  3HKC A;  4G4V A;  3VDP A;  2ORW A;  2IG8 A;  3FFM A;  1OMT A;  2NU0 I;  3IMP A;  3CPW F;  4JCV E;  4O4I B;  1IV4 A;  3CCM F;  3GOX A;  1VH8 A;  2CVL A;  3J80 M;  1X74 A;  2X52 A;  4O2A B;  1WGT A;  2HP0 A;  5GAP K;  1IW4 A;  2CWJ A;  2JYY A;  3C9T A;  4LCK A;  4C8I A;  1K9M H;  4FFB A;  5DCV A;  1V1I A;  5GIN C;  3HAX D;  3DC2 A;  3TOA A;  1SA0 B;  2DYY A;  5FNV B;  4MPI A;  5JQG A;  3FSY A;  5LXT B;  3FD6 A;  2QQ0 A;  2KTU A;  2ARP F;  2ODD A;  1RFH A;  3E59 A;  5LA6 B;  5HY0 A;  5HQ8 A;  1KD1 H;  5FUW A;  5J2U B;  1CT4 I;  3P10 A;  2CWF A;  1JN1 A;  1QVF F;  3HKD B;  3VYU C;  2EWC A;  3OL0 A;  4B62 A;  3I55 F;  4ZHW A;  3KHN A;  2CSL A;  2IQQ A;  4AML A;  3LDT A;  1GO0 A;  4F6R B;  3F0E A;  5CA0 A;  3MQW A;  1QVG F;  3RYF A;  2BUS A;  5JCO A;  2HS4 A;  1W5A A;  1Q81 H;  5KMG A;  2OZB A;  1YJ9 F;  5E3P A;  3EOR A;  2QQC A;  4TV9 A;  1COM A;  3U0O A;  2VRW B;  3RU0 A;  4YJ2 B;  1HPT A;  1W2B F;  2LBX A;  3TD5 A;  2W0T A;  3JAR B;  4B45 A;  2ZAU A;  1FFX B;  5B8F A;  1TUS A;  4TV8 A;  5EX3 A;  3KE1 A;  5FUY A;  2E5R A;  1CHO I;  2PMP A;  4U3J A;  2FC3 A;  4KWE A;  5EWR A;  1FAQ A;  3R5B A;  2RHO A;  3D54 A;  2LUY A;  5HY1 A;  1N13 A;  2FGY A;  3RYH A;  5IT9 M;  5KX5 B;  1YJW F;  1VQN F;  4ZOL A;  4G4Y A;  2LBT A;  2Z01 A;  1VHA A;  1YQN A;  3HKB B;  4EI8 A;  1XBI A;  2OTM A;  2SGF I;  5IJ0 B;  2OTJ F;  2NU1 I;  2E73 A;  1IY6 A;  3UEY A;  3IKE A;  5EAZ A;  1CK2 A;  1W5B A;  1K8A H;  3N2G A;  5EX0 A;  3B6N A;  1OAP A;  3J81 M;  4ERH A;  5CCM A;  3JAL A;  9WGA A;  1P9G A;  2SGD I;  2I6R A;  1YTP A;  2ZOV A;  1SGE I;  3MCQ A;  3R5C A;  5MN6 A;  2DT4 A;  3G71 F;  2Z1U A;  3P0Z A;  4PWT A;  2BTU A;  5A2Q M;  4I55 A;  1H47 A;  1VQM F;  2P6Y A;  5LP6 C;  1CGI I;  1SGR I;  5JVD B;  4ZI7 B;  5C8Y A;  1KBE A;  2UZ3 A;  2NMU A;  4IIJ B;  4M8I A;  1Y1B A;  4C81 A;  2AIF A;  2RHH A;  4EB6 A;  3S0Y A;  3RE3 A;  4C82 A;  1RQ2 A;  2N1A B;  3UT5 A;  1NXU A;  1TBO A;  1TVK B;  3QHD A;  5HXZ A;  2OZU A;  4X1K B;  4BVQ A;  1XHO A;  3PLA C;  2JNB A;  3JAK A;  2HP0 B;  2LBW A;  2QQE A;  1LR7 A;  1DBF A;  2Z1T A;  1YI2 F;  4O4J B;  3OON A;  1TUB A;  3VE5 A;  3ESJ A;  2L7X A;  3JAW B;  5JQG B;  1M90 H;  2VAP A;  2HS0 A;  2KMQ A;  1ONI A;  2ALE A;  3ON1 A;  4X1Y A;  4YJ3 A;  2QPO A;  3WGM A;  1KMA A;  3CB2 A;  4BVS A;  1KBF A;  4A24 A;  4DNC A;  1FNK A;  3OBW A;  2ENZ A;  1ZWZ A;  5EYP A;  4BY9 D;  2BTO A;  3GTZ A;  1XA6 A;  3UGD A;  3N4Y A;  1W58 1;  3KJJ A;  3CC7 F;  4TUY B;  2MQE A;  3V7Q A;  3MDO A;  1X7P A;  5GIP C;  4FKD A;  5KMG B;  3CCS F;  4BVR A;  1R0R I;  3TJQ A;  2HVY D;  1TBQ R;  5GIO C;  4TV9 B;  1UFY A;  5E3R A;  1U40 A;  1MJ9 A;  1IY5 A;  1OVO A;  4WBN A;  2V9Y A;  1PTR A;  1U3L A;  3CPQ A;  4IHJ B;  2V1C A;  5J8F A;  1Z2I A;  4TV8 B;  3I3F A;  3MEK A;  3OXG A;  2ZF8 A;  1W40 A;  1OMU A;  4ZHV A;  3CME F;  4U3J B;  3L7Q A;  4DXD A;  3I56 F;  3VOA A;  1W5F A;  5AVM A;  3NVK E;  3FBA A;  1ULM A;  1M8B A;  2NU4 I;  3LFO A;  1K7V A;  1VQK F;  2XRC A;  3BJI A;  1K7U A;  2UYJ A;  2GVI A;  1UI9 A;  2GKR I;  3OXL A;  2QTP A;  2RB9 A;  3K12 A;  3LME A;  2VXY A;  3VTI C;  2JA1 A;  4R40 B;  5BMV A;  1VQV A;  4NWO B;  4LNU A;  4X1I A;  3HJW C;  1W4R A;  2GLZ A;  5JCO C;  3RYI B;  1AN1 I;  3QTL D;  3HKE B;  3CMA F;  2DB6 A;  3JAS B;  2PQ8 A;  4I55 B;  3G6E F;  2CWH A;  1VQ7 F;  4DRX A;  2QI2 A;  1CN7 A;  3ZP4 A;  3UGL A;  3LWQ C;  5JH7 A;  5GON A;  1IV2 A;  5C8Y B;  3CG6 A;  1VQL F;  2SGP I;  3FSX A;  2IAF A;  1TOT A;  2CJS C;  3OXF A;  3R5D A;  3C8L A;  3S0W A;  1NUB A;  1YIT F;  5HI7 A;  1H48 A;  3LWV C;  1GZ0 A;  3RA6 A;  3TO9 A;  1QAH A;  1FYB A;  3UT5 B;  1VQ6 F;  4X20 A;  1CGJ I;  1DS3 I;  5LP6 B;  1YJN F;  3SIV A;  5EZY A;  3FD5 A;  2H6L A;  5EB0 A;  2JW6 A;  4B46 A;  5EIB D;  2Q1X A;  3CC4 F;  1RA4 A;  3PDN A;  4B6D A;  1TUB B;  1NJI H;  2QA4 F;  3V3T A;  4EI7 A;  5ITZ A;  2J87 A;  2OHW A;  1LR8 A;  4TZZ A;  3HH2 C;  2UYN A;  3D01 A;  1E7K A;  4X1Y B;  4YJ3 B;  1YHQ F;  1Z7K B;  1W3S A;  4BT6 A;  1SGY I;  5LYJ A;  5IJ9 B;  2W8B C;  3R5A A;  1HJA I;  1DT9 A;  3RA5 A;  3QAH A;  3K2X A;  1W3E X;  4C8G A;  5EYP B;  3CCE F;  3E1Y A;  2L26 A;  1WGC A;  5LOV A;  2CHT A;  1OFU A;  3WGJ A;  1M1K H;  3ERN A;  4NQ3 A;  3UFF A;  3UGI A;  4UXH A;  1XRG A;  1VQP F;  7WGA A;  1PJU A;  4BW0 B;  3F0F A;  3VOB A;  4OVO A;  2VGM A;  1IPA A;  2ZVZ A;  1BUS A;  4BT5 A;  2L8E A;  3HWU A;  5IYZ B;  1ULK A;  4O2A A;  3RYC A;  2R6R 1;  2B8T A;  1S72 F;  5CA1 B;  1WKX A;  1LR9 A;  2AIZ P;  1YGY A;  4WBN B;  4E1P A;  3ZP7 A;  2QEX F;  1VQ5 F;  1CT2 I;  1GX1 A;  3IEW A;  3HKC B;  3M1X A;  4EI9 A;  1SA0 A;  2CZW A;  4ZK7 A;  2LB7 A;  3S02 A;  2B0U C;  1RQ7 A;  1ULN A;  2N48 A;  5LXT A;  3T80 A;  1R79 A;  5HP8 A;  1DS2 I;  1VQ4 F;  1QD9 A;  2R75 1;  1U3P A;  1Z5V A;  5LA6 A;  2RHJ A;  3IEQ A;  1JD1 A;  3KY9 A;  3BYQ A;  4O2B A;  1YIJ F;  2Z1F A;  3TOB A;  1JY8 A;  4FFB B;  3M84 A;  1Q82 H;  3QWP A;  2UZH A;  2GIV A;  2K9H A;  3GYQ A;  2I6D A;  2OTL F;  3ELC A;  3F0D A;  4F6R A;  2YQP A;  5FUV A;  1W59 A;  1SGN I;  2AMT A;  3FC3 A;  1P9Z A;  1FSZ A;  2JZM A;  5JHW C;  5CB4 A;  1NQ3 A;  1IV3 A;  3VYT C;  1GO1 A;  1PPF I;  4DRX B;  1W5E A;  4UXJ A;  5HP7 A;  4YJ2 A;  5GON B;  1ODE A;  1KC8 H;  3JAR A;  5G4U C;  5CA0 B;  3CCJ F;  3KIZ A;  3RYF B;  1FFX A;  2JXD A;  2V1C C;  2GKT I;  3TD3 A;  1TGS I;  5CCL A;  3SIU A;  2NU3 I;  1R1M A;  2UYK A;  4X20 B;  1HEV A;  3C9S A;  4NUT A;  1BMO A;  1SGP I;  2CHS A;  4RHA A;  1T0A A;  2F9Z C;  5KX5 A;  3M4S A;  2FNF X;  3AGK A;  1JFF A;  2SGE I;  2KCX A;  4BT4 A;  3VMF B;  4BT7 A;  1J7H A;  2ORV A;  2KMR A;  1W41 A;  3V7E A;  3CXL A;  3TO6 A;  4C8E A;  5HWE A;  1UVG A;  2H8E A;  2QQD A;  1MT1 A;  3N2K A;  3WGK A;  5DAE A;  3JAT A;  3RYH B;  3J7A R;  4O4L A;  4ZOL B;  1VDD A;  2WCY A;  5LYJ B;  5E3Q A;  1Y8F A;  1MJA A;  2HX0 A;  3WJP A;  2KMO A;  1PCE A;  3OBY A;  2OVO A;  1TBR R;  5LOV B;  2RHL A;  1TUR A;  1TBN A;  3N2G B;  5J2T A;  2A20 A;  1KNJ A;  4XCQ A;  4HNA A;  3S0H A;  1OYV I;  3JAL B;  1RLG A;  1IV1 A;  3ZO8 A;  4SGB I;  4E1R A;  1TVK A;  1VK3 A;  2N52 A; 
#chains in the Genus database with same CATH homology
 2KMP A;  4X1K A;  3RYC B;  4I50 A;  4I4T A;  2ENN A;  1PTQ A;  4O4H A;  3SGQ I;  3WGL A;  4O4J A;  4EB6 B;  4UXI A;  3JAW A;  5MN5 A;  4U39 A;  1X4S A;  1V1H A;  3JAK B;  4O2B B;  2Q1Y A;  4ZHQ A;  2ELI A;  3E22 A;  1YU6 C;  3SEK C;  1XX6 A;  2LEO A;  3WGN A;  4TUY A;  1XBT A;  5CB4 B;  2OD1 A;  2M5X A;  1SGQ I;  4IHJ A;  4O4I A;  2VAM A;  5FUX A;  4GI3 C;  1JFF B;  1FAR A;  5MN4 A;  2P6A C;  1HDL A;  5FNV A;  3N2K B;  4L9M A;  3VO8 A;  3SGB I;  3JAT B;  2GKV A;  4O4L B;  1U5K A;  3RYI A;  5J2U A;  3HKE A;  2DIP A;  3HKD A;  3UEJ A;  3JAS A;  5BMV B;  3VDU A;  5J2T B;  1H0Z A;  4HNA B;  4LNU B;  2NU2 I;  4X1I B;  1SGD I;  1UUC A;  1Z5W A;  4E6E A;  2ERW A;  5LP6 A;  4I50 B;  4I4T B;  1Y1C A;  2J9R A;  5JH7 B;  4O4H B;  2SGQ I;  2YUU A;  2BTQ B;  1CE3 A;  1CSO I;  2ROW A;  1UVF A;  1TIH A;  2N71 A;  5EZY B;  3D00 A;  1CT0 I;  5IJ9 A;  1M8C A;  4ZHQ B;  2WVJ A;  3HKB A;  5IJ0 A;  5ITZ B;  3E22 B;  2F3C I;  2N17 A;  2VAW A;  4HGU A;  1RLU A;  3E2I A;  5EIB C;  5IYZ A;  5CA1 A;  5JVD A;  4ZI7 A;  3B4V C;  4IIJ A;  2V53 A;  3HKC A;  3OVO A;  3VDP A;  2ORW A;  1OMT A;  2NU0 I;  4JCV E;  4O4I B;  3GOX A;  1X74 A;  4O2A B;  1IW4 A;  2JYY A;  4FFB A;  1V1I A;  1SA0 B;  5FNV B;  5JQG A;  5LXT B;  2QQ0 A;  2ARP F;  2ODD A;  1RFH A;  3E59 A;  5LA6 B;  5HQ8 A;  5FUW A;  5J2U B;  1CT4 I;  3HKD B;  3OL0 A;  4F6R B;  5CA0 A;  3RYF A;  2BUS A;  5JCO A;  1W5A A;  5KMG A;  4TV9 A;  2QQC A;  2VRW B;  3RU0 A;  4YJ2 B;  1HPT A;  2W0T A;  3JAR B;  4B45 A;  1FFX B;  1TUS A;  4TV8 A;  5EX3 A;  5FUY A;  2E5R A;  1CHO I;  4U3J A;  4KWE A;  1FAQ A;  2RHO A;  2LUY A;  1N13 A;  3RYH A;  5KX5 B;  4ZOL A;  3HKB B;  5IJ0 B;  2SGF I;  2NU1 I;  2E73 A;  1IY6 A;  3UEY A;  1W5B A;  3N2G A;  5EX0 A;  5CCM A;  3JAL A;  2SGD I;  1YTP A;  1SGE I;  5MN6 A;  4I55 A;  5LP6 C;  1CGI I;  1SGR I;  5JVD B;  4ZI7 B;  5C8Y A;  1KBE A;  2UZ3 A;  4IIJ B;  4M8I A;  1Y1B A;  2RHH A;  4EB6 A;  1RQ2 A;  2N1A B;  3UT5 A;  1TBO A;  1TVK B;  4X1K B;  3JAK A;  2QQE A;  1LR7 A;  4O4J B;  1TUB A;  3VE5 A;  2L7X A;  3JAW B;  5JQG B;  2VAP A;  2KMQ A;  4X1Y A;  4YJ3 A;  2QPO A;  3WGM A;  1KMA A;  3CB2 A;  1KBF A;  4A24 A;  2ENZ A;  5EYP A;  2BTO A;  1XA6 A;  3UGD A;  1W58 1;  4TUY B;  4FKD A;  5KMG B;  1R0R I;  3TJQ A;  1TBQ R;  4TV9 B;  1IY5 A;  1OVO A;  4WBN A;  1PTR A;  4IHJ B;  2V1C A;  4TV8 B;  3MEK A;  3OXG A;  1OMU A;  4U3J B;  4DXD A;  3VOA A;  1W5F A;  1M8B A;  2NU4 I;  2XRC A;  3BJI A;  2GVI A;  2GKR I;  3OXL A;  2VXY A;  2JA1 A;  5BMV A;  4LNU A;  4X1I A;  1W4R A;  5JCO C;  3RYI B;  1AN1 I;  3QTL D;  3HKE B;  2DB6 A;  3JAS B;  4I55 B;  4DRX A;  3UGL A;  5JH7 A;  5GON A;  5C8Y B;  2SGP I;  1TOT A;  2CJS C;  3OXF A;  3C8L A;  1NUB A;  5HI7 A;  1FYB A;  3UT5 B;  4X20 A;  1CGJ I;  1DS3 I;  5LP6 B;  5EZY A;  2JW6 A;  4B46 A;  5EIB D;  2Q1X A;  3PDN A;  4B6D A;  1TUB B;  5ITZ A;  2J87 A;  1LR8 A;  3HH2 C;  4X1Y B;  4YJ3 B;  1Z7K B;  1W3S A;  1SGY I;  5LYJ A;  5IJ9 B;  1HJA I;  5EYP B;  5LOV A;  1OFU A;  3WGJ A;  3UFF A;  3UGI A;  4UXH A;  3VOB A;  1PJU A;  4OVO A;  1BUS A;  2L8E A;  5IYZ B;  4O2A A;  3RYC A;  2R6R 1;  2B8T A;  5CA1 B;  1LR9 A;  4WBN B;  4E1P A;  1CT2 I;  3HKC B;  1SA0 A;  2B0U C;  1RQ7 A;  5LXT A;  1R79 A;  1DS2 I;  2R75 1;  1Z5V A;  5LA6 A;  2RHJ A;  4O2B A;  3KY9 A;  4FFB B;  3QWP A;  2K9H A;  4F6R A;  2YQP A;  5FUV A;  1W59 A;  1SGN I;  3FC3 A;  1FSZ A;  2JZM A;  5JHW C;  5CB4 A;  1PPF I;  4DRX B;  1W5E A;  4UXJ A;  4YJ2 A;  5GON B;  3JAR A;  5CA0 B;  3RYF B;  1FFX A;  2JXD A;  2V1C C;  2GKT I;  1TGS I;  5CCL A;  2NU3 I;  4X20 B;  1BMO A;  1SGP I;  5KX5 A;  2FNF X;  1JFF A;  2SGE I;  2KCX A;  2ORV A;  2KMR A;  3CXL A;  3N2K A;  1UVG A;  2QQD A;  1MT1 A;  3WGK A;  5DAE A;  3JAT A;  3RYH B;  4O4L A;  4ZOL B;  1VDD A;  2WCY A;  5LYJ B;  1Y8F A;  2KMO A;  1PCE A;  2OVO A;  1TBR R;  5LOV B;  2RHL A;  1TUR A;  1TBN A;  3N2G B;  5J2T A;  2A20 A;  4HNA A;  1OYV I;  3JAL B;  4SGB I;  4E1R A;  1TVK A;  2N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...