2E5RA

Solution structure of the zz domain of dystrobrevin alpha (dystrobrevin-alpha)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
63
structure length
63
Chain Sequence
GSSGSSGVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Dystrobrevin alpha
publication title Solution structure of the ZZ domain of Dystrobrevin alpha (Dystrobrevin-alpha)
rcsb
source organism Homo sapiens
total genus 5
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2e5rA00
1TOTA 2E5RA 2N1AB 2DIPA
chains in the Genus database with same CATH superfamily
4SGBI 2XRCA 2KMQA 3UOEA 1SGEI 1VDDA 2RIJA 1OVOA 4MPIA 5FUXA 2SGFI 2W0TA 3E59A 2LB7A 1ULKA 3TO6A 2J9RA 1YTPA 1H0ZA 1Y1BA 2GVIA 1CE3A 2SGEI 1OMUA 1IY5A 1FARA 2JZMA 1ULMA 4L9MA 1AN1I 1XA6A 5FUVA 1U5KA 2M5XA 2PQ8A 3OVOA 3TJQA 2KMRA 1WGCA 1HEVA 3TOBA 2UZ3A 4UXJA 1UHAA 1MJAA 1CT0I 1N13A 2UVOA 5HI7A 2V53A 2V1CC 4UXHA 2DB6A 3UGDA 3VDUA 5J8CA 1W4RA 3PDNA 3UEJA 3QWPA 1TBOA 1TGSI 4JCVE 3VDPA 3FSXA 2B0UC 1PTQA 1XX6A 5EX0A 3OL0A 1IY6A 1FAQA 1OYVI 2JW6A 2NU1I 2WCYA 1BMOA 3MEKA 3TO9A 2NU2I 1FY7A 1TBNA 2N1AB 2FNFX 2OD1A 4E1RA 2E73A 1FYBA 1WTJA 1SGQI 2V1CA 1HDLA 2JA1A 3FSYA 2L7XA 2NU4I 2GKVA 5E3RA 3D00A 2VRWB 3OXFA 1CGJI 2KMPA 1PPFI 5EX3A 2L8EA 5JHWC 1S20A 2N17A 1HJAI 4B6DA 1K7TA 3GOXA 5E3QA 1V1IA 1WGTA 4A24A 2CWHA 1UUCA 2GKTI 2J87A 5CCLA 1LR9A 5CCMA 1RFHA 4HGUA 2GIVA 2OU2A 1SGRI 1Z2IA 1NXUA 1DS3I 1P9ZA 1R79A 2QQDA 1LR7A 2ORWA 1W3SA 4DNCA 1HPTA 1Y8FA 3CXLA 1XBTA 1K7VA 3KY9A 1NUBA 3R5DA 2SGDI 3R5CA 4WP4A 4UXIA 1WKXA 2KCXA 2LEOA 1UVGA 1R0RI 2NU0I 1SGYI 3E2IA 3B4VC 1K7UA 4E1PA 3OXGA 1KMAA 1M8CA 2ENZA 2A20A 1DS2I 1PTRA 2ERWA 3UGLA 1TBRR 2X3TA 2SGPI 2F3CI 1IW4A 5J8FA 2RC4A 2BUSA 2ENNA 3TOAA 1V1HA 1PCEA 1Z7KB 1TURA 2QQCA 3OXLA 1TIHA 1Q9BA 1OMTA 2CWFA 2E5RA 1CSOI 1MJ9A 1SGDI 2YQPA 3UGIA 7WGAA 1KBFA 2WVJA 2K9HA 1UVFA 5DAEA 3R5BA 1YU6C 3UFFA 2OVOA 3QTLD 1MT1A 2QQEA 2N71A 1SGPI 3FC3A 1CGII 1KBEA 1M8BA 1P9GA 2Y0MA 2CJSC 5FUYA 2JYYA 2QQ0A 2B8TA 4AMLA 2WGCA 2X52A 4FKDA 1CHOI 2P6AC 3HH2C 2SGQI 4OVOA 2ARPF 3SEKC 3SGQI 2OZUA 5E3PA 3UEYA 1X4SA 9WGAA 2LUYA 1Y1CA 2KMOA 3SGBI 4GI3C 2YUUA 2ORVA 5FUWA 3VE5A 2JXDA 3QAHA 1TOTA 2ODDA 1CT2I 2DKVA 2NU3I 3R5AA 1PJUA 1TUSA 2ELIA 2N52A 5HQ8A 1CT4I 1ULNA 1MJBA 1SGNI 3RU0A 3BJIA 2DIPA 1TBQR 2GKRI 2QPOA 2CWGA 1X74A 3TO7A 1BUSA 1LR8A 2ROWA
chains in the Genus database with same CATH topology
4SGBI 2XRCA 2KMQA 1SGEI 1VDDA 1OVOA 5FUXA 2SGFI 2W0TA 3E59A 2J9RA 1YTPA 1H0ZA 1Y1BA 2GVIA 1CE3A 2SGEI 1OMUA 1IY5A 1FARA 2JZMA 4L9MA 1AN1I 1XA6A 5FUVA 1U5KA 2M5XA 3OVOA 3TJQA 2KMRA 2UZ3A 4UXJA 1CT0I 1N13A 5HI7A 2V53A 2V1CC 4UXHA 2DB6A 3UGDA 3VDUA 1W4RA 3PDNA 3UEJA 3QWPA 1TBOA 1TGSI 4JCVE 3VDPA 2B0UC 1PTQA 1XX6A 5EX0A 3OL0A 1IY6A 1FAQA 1OYVI 2JW6A 2NU1I 2WCYA 1BMOA 3MEKA 2NU2I 1TBNA 2N1AB 2FNFX 2OD1A 4E1RA 2E73A 1FYBA 1SGQI 2V1CA 1HDLA 2JA1A 2L7XA 2NU4I 2GKVA 3D00A 2VRWB 3OXFA 1CGJI 2KMPA 1PPFI 5EX3A 2L8EA 5JHWC 2N17A 1HJAI 4B6DA 3GOXA 1V1IA 4A24A 1UUCA 2GKTI 2J87A 5CCLA 1LR9A 5CCMA 1RFHA 4HGUA 1SGRI 1DS3I 1R79A 2QQDA 1LR7A 2ORWA 1W3SA 1HPTA 1Y8FA 3CXLA 1XBTA 3KY9A 1NUBA 2SGDI 4UXIA 2KCXA 2LEOA 1UVGA 1R0RI 2NU0I 1SGYI 3E2IA 3B4VC 4E1PA 3OXGA 1KMAA 1M8CA 2ENZA 2A20A 1DS2I 1PTRA 2ERWA 3UGLA 1TBRR 2SGPI 2F3CI 1IW4A 2BUSA 2ENNA 1V1HA 1PCEA 1Z7KB 1TURA 2QQCA 3OXLA 1TIHA 1OMTA 2E5RA 3UGIA 1CSOI 1SGDI 2YQPA 1KBFA 2WVJA 2K9HA 1UVFA 5DAEA 1YU6C 3UFFA 2OVOA 3QTLD 1MT1A 2QQEA 2N71A 1SGPI 3FC3A 1CGII 1KBEA 1M8BA 2CJSC 5FUYA 2JYYA 2QQ0A 2B8TA 4FKDA 1CHOI 2P6AC 3HH2C 2SGQI 4OVOA 2ARPF 3SEKC 3SGQI 3UEYA 1X4SA 2LUYA 1Y1CA 2KMOA 3SGBI 4GI3C 2YUUA 2ORVA 5FUWA 3VE5A 2JXDA 1TOTA 2ODDA 1CT2I 2NU3I 5HQ8A 1PJUA 1TUSA 2ELIA 2N52A 1CT4I 1SGNI 3RU0A 3BJIA 2DIPA 1TBQR 2GKRI 2QPOA 1BUSA 1X74A 1LR8A 2ROWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOT A;  2E5R A;  2N1A B;  2DIP A; 
#chains in the Genus database with same CATH topology
 4SGB I;  2XRC A;  2KMQ A;  3UOE A;  1SGE I;  1VDD A;  2RIJ A;  1OVO A;  4MPI A;  5FUX A;  2SGF I;  2W0T A;  3E59 A;  2LB7 A;  1ULK A;  3TO6 A;  2J9R A;  1YTP A;  1H0Z A;  1Y1B A;  2GVI A;  1CE3 A;  2SGE I;  1OMU A;  1IY5 A;  1FAR A;  2JZM A;  1ULM A;  4L9M A;  1AN1 I;  1XA6 A;  5FUV A;  1U5K A;  2M5X A;  2PQ8 A;  3OVO A;  3TJQ A;  2KMR A;  1WGC A;  1HEV A;  3TOB A;  2UZ3 A;  4UXJ A;  1UHA A;  1MJA A;  1CT0 I;  1N13 A;  2UVO A;  5HI7 A;  2V53 A;  2V1C C;  4UXH A;  2DB6 A;  3UGD A;  3VDU A;  5J8C A;  1W4R A;  3PDN A;  3UEJ A;  3QWP A;  1TBO A;  1TGS I;  4JCV E;  3VDP A;  3FSX A;  2B0U C;  1PTQ A;  1XX6 A;  5EX0 A;  3OL0 A;  1IY6 A;  1FAQ A;  1OYV I;  2JW6 A;  2NU1 I;  2WCY A;  1BMO A;  3MEK A;  3TO9 A;  2NU2 I;  1FY7 A;  1TBN A;  2N1A B;  2FNF X;  2OD1 A;  4E1R A;  2E73 A;  1FYB A;  1WTJ A;  1SGQ I;  2V1C A;  1HDL A;  2JA1 A;  3FSY A;  2L7X A;  2NU4 I;  2GKV A;  5E3R A;  3D00 A;  2VRW B;  3OXF A;  1CGJ I;  2KMP A;  1PPF I;  5EX3 A;  2L8E A;  5JHW C;  1S20 A;  2N17 A;  1HJA I;  4B6D A;  1K7T A;  3GOX A;  5E3Q A;  1V1I A;  1WGT A;  4A24 A;  2CWH A;  1UUC A;  2GKT I;  2J87 A;  5CCL A;  1LR9 A;  5CCM A;  1RFH A;  4HGU A;  2GIV A;  2OU2 A;  1SGR I;  1Z2I A;  1NXU A;  1DS3 I;  1P9Z A;  1R79 A;  2QQD A;  1LR7 A;  2ORW A;  1W3S A;  4DNC A;  1HPT A;  1Y8F A;  3CXL A;  1XBT A;  1K7V A;  3KY9 A;  1NUB A;  3R5D A;  2SGD I;  3R5C A;  4WP4 A;  4UXI A;  1WKX A;  2KCX A;  2LEO A;  1UVG A;  1R0R I;  2NU0 I;  1SGY I;  3E2I A;  3B4V C;  1K7U A;  4E1P A;  3OXG A;  1KMA A;  1M8C A;  2ENZ A;  2A20 A;  1DS2 I;  1PTR A;  2ERW A;  3UGL A;  1TBR R;  2X3T A;  2SGP I;  2F3C I;  1IW4 A;  5J8F A;  2RC4 A;  2BUS A;  2ENN A;  3TOA A;  1V1H A;  1PCE A;  1Z7K B;  1TUR A;  2QQC A;  3OXL A;  1TIH A;  1Q9B A;  1OMT A;  2CWF A;  2E5R A;  1CSO I;  1MJ9 A;  1SGD I;  2YQP A;  3UGI A;  7WGA A;  1KBF A;  2WVJ A;  2K9H A;  1UVF A;  5DAE A;  3R5B A;  1YU6 C;  3UFF A;  2OVO A;  3QTL D;  1MT1 A;  2QQE A;  2N71 A;  1SGP I;  3FC3 A;  1CGI I;  1KBE A;  1M8B A;  1P9G A;  2Y0M A;  2CJS C;  5FUY A;  2JYY A;  2QQ0 A;  2B8T A;  4AML A;  2WGC A;  2X52 A;  4FKD A;  1CHO I;  2P6A C;  3HH2 C;  2SGQ I;  4OVO A;  2ARP F;  3SEK C;  3SGQ I;  2OZU A;  5E3P A;  3UEY A;  1X4S A;  9WGA A;  2LUY A;  1Y1C A;  2KMO A;  3SGB I;  4GI3 C;  2YUU A;  2ORV A;  5FUW A;  3VE5 A;  2JXD A;  3QAH A;  1TOT A;  2ODD A;  1CT2 I;  2DKV A;  2NU3 I;  3R5A A;  1PJU A;  1TUS A;  2ELI A;  2N52 A;  5HQ8 A;  1CT4 I;  1ULN A;  1MJB A;  1SGN I;  3RU0 A;  3BJI A;  2DIP A;  1TBQ R;  2GKR I;  2QPO A;  2CWG A;  1X74 A;  3TO7 A;  1BUS A;  1LR8 A;  2ROW A; 
#chains in the Genus database with same CATH homology
 4SGB I;  2XRC A;  2KMQ A;  1SGE I;  1VDD A;  1OVO A;  5FUX A;  2SGF I;  2W0T A;  3E59 A;  2J9R A;  1YTP A;  1H0Z A;  1Y1B A;  2GVI A;  1CE3 A;  2SGE I;  1OMU A;  1IY5 A;  1FAR A;  2JZM A;  4L9M A;  1AN1 I;  1XA6 A;  5FUV A;  1U5K A;  2M5X A;  3OVO A;  3TJQ A;  2KMR A;  2UZ3 A;  4UXJ A;  1CT0 I;  1N13 A;  5HI7 A;  2V53 A;  2V1C C;  4UXH A;  2DB6 A;  3UGD A;  3VDU A;  1W4R A;  3PDN A;  3UEJ A;  3QWP A;  1TBO A;  1TGS I;  4JCV E;  3VDP A;  2B0U C;  1PTQ A;  1XX6 A;  5EX0 A;  3OL0 A;  1IY6 A;  1FAQ A;  1OYV I;  2JW6 A;  2NU1 I;  2WCY A;  1BMO A;  3MEK A;  2NU2 I;  1TBN A;  2N1A B;  2FNF X;  2OD1 A;  4E1R A;  2E73 A;  1FYB A;  1SGQ I;  2V1C A;  1HDL A;  2JA1 A;  2L7X A;  2NU4 I;  2GKV A;  3D00 A;  2VRW B;  3OXF A;  1CGJ I;  2KMP A;  1PPF I;  5EX3 A;  2L8E A;  5JHW C;  2N17 A;  1HJA I;  4B6D A;  3GOX A;  1V1I A;  4A24 A;  1UUC A;  2GKT I;  2J87 A;  5CCL A;  1LR9 A;  5CCM A;  1RFH A;  4HGU A;  1SGR I;  1DS3 I;  1R79 A;  2QQD A;  1LR7 A;  2ORW A;  1W3S A;  1HPT A;  1Y8F A;  3CXL A;  1XBT A;  3KY9 A;  1NUB A;  2SGD I;  4UXI A;  2KCX A;  2LEO A;  1UVG A;  1R0R I;  2NU0 I;  1SGY I;  3E2I A;  3B4V C;  4E1P A;  3OXG A;  1KMA A;  1M8C A;  2ENZ A;  2A20 A;  1DS2 I;  1PTR A;  2ERW A;  3UGL A;  1TBR R;  2SGP I;  2F3C I;  1IW4 A;  2BUS A;  2ENN A;  1V1H A;  1PCE A;  1Z7K B;  1TUR A;  2QQC A;  3OXL A;  1TIH A;  1OMT A;  2E5R A;  3UGI A;  1CSO I;  1SGD I;  2YQP A;  1KBF A;  2WVJ A;  2K9H A;  1UVF A;  5DAE A;  1YU6 C;  3UFF A;  2OVO A;  3QTL D;  1MT1 A;  2QQE A;  2N71 A;  1SGP I;  3FC3 A;  1CGI I;  1KBE A;  1M8B A;  2CJS C;  5FUY A;  2JYY A;  2QQ0 A;  2B8T A;  4FKD A;  1CHO I;  2P6A C;  3HH2 C;  2SGQ I;  4OVO A;  2ARP F;  3SEK C;  3SGQ I;  3UEY A;  1X4S A;  2LUY A;  1Y1C A;  2KMO A;  3SGB I;  4GI3 C;  2YUU A;  2ORV A;  5FUW A;  3VE5 A;  2JXD A;  1TOT A;  2ODD A;  1CT2 I;  2NU3 I;  5HQ8 A;  1PJU A;  1TUS A;  2ELI A;  2N52 A;  1CT4 I;  1SGN I;  3RU0 A;  3BJI A;  2DIP A;  1TBQ R;  2GKR I;  2QPO A;  1BUS A;  1X74 A;  1LR8 A;  2ROW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...