2E5RA

Solution structure of the zz domain of dystrobrevin alpha (dystrobrevin-alpha)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
63
structure length
63
Chain Sequence
GSSGSSGVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dystrobrevin alpha
publication title Solution structure of the ZZ domain of Dystrobrevin alpha (Dystrobrevin-alpha)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 5
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2e5rA00
2E5RA 2DIPA 2N1AB 1TOTA
chains in the Genus database with same CATH superfamily
1TURA 2SGEI 1SGRI 2DB6A 1RFHA 2NU3I 2NU2I 2V1CC 3SGBI 2WGCA 2J87A 1WGCA 2ODDA 2XRCA 1SGQI 2JW6A 1HPTA 1MJ9A 2F3CI 2GKVA 3OL0A 3QAHA 2CWFA 2L8EA 1FY7A 2ELIA 1TIHA 2SGQI 2KMQA 1LR8A 3UGLA 5J8CA 1WKXA 1ULMA 1LR7A 2CWHA 1TBQR 1HEVA 2ERWA 2KMRA 1TGSI 4WP4A 1KMAA 1CT2I 3TOBA 2A20A 4FKDA 1X4SA 1V1HA 5FUWA 2NU0I 2GKTI 2JZMA 1PTRA 4A24A 2OD1A 1MJAA 1W3SA 2E5RA 2LUYA 2E73A 5HQ8A 2ENZA 4OVOA 5HI7A 4AMLA 1CGII 1NXUA 3GOXA 2QQDA 1FAQA 2M5XA 1V1IA 2N1AB 2ENNA 2QQEA 1M8CA 2BUSA 1ULKA 2DKVA 3HH2C 3KY9A 1SGPI 3RU0A 1HJAI 4E1RA 2LB7A 5E3PA 1PCEA 1SGYI 1U5KA 1UHAA 3MEKA 1XA6A 1UVFA 1W4RA 2RIJA 1BMOA 2CWGA 2DIPA 3SEKC 7WGAA 1TOTA 4E1PA 2KMOA 3FSXA 3OXLA 2NU1I 4MPIA 1WTJA 5FUXA 2WVJA 1PPFI 3R5DA 2ORWA 1CT4I 2QPOA 2W0TA 2UZ3A 4UXJA 3UEJA 2QQCA 2ARPF 2YUUA 3UEYA 1SGEI 1FARA 1K7TA 1Y8FA 1H0ZA 1K7UA 5E3RA 3OVOA 1NUBA 1R79A 1TBOA 1X74A 2KMPA 2GKRI 2OU2A 2QQ0A 2VRWB 3OXGA 2JA1A 2SGPI 1OYVI 2JYYA 1YTPA 2ORVA 4GI3C 3TO7A 3UGDA 3UGIA 5FUVA 1OVOA 2B8TA 3UFFA 1BUSA 2X3TA 3QTLD 4L9MA 1FYBA 1SGDI 4JCVE 2ROWA 3E59A 3B4VC 5CCLA 1WGTA 1PTQA 2J9RA 1SGNI 2X52A 3QWPA 1K7VA 1KBEA 1Y1CA 1CT0I 2Y0MA 5EX0A 1DS3I 1N13A 3BJIA 1IY5A 2L7XA 1OMTA 1CSOI 2B0UC 1KBFA 3D00A 2OZUA 3VE5A 1XBTA 3R5AA 5JHWC 1XX6A 1Q9BA 4UXHA 2JXDA 1CHOI 1MT1A 1PJUA 1ULNA 2SGDI 1LR9A 3R5CA 1TUSA 1TBRR 5FUYA 3UOEA 2V1CA 1M8BA 1VDDA 1YU6C 1Z2IA 2WCYA 4HGUA 2N71A 4B6DA 2PQ8A 5E3QA 2YQPA 2K9HA 1UUCA 2GIVA 9WGAA 3TO9A 1CGJI 1P9GA 3VDUA 2N17A 2V53A 3TJQA 2CJSC 2UVOA 4SGBI 5J8FA 5EX3A 1HDLA 2KCXA 5DAEA 1AN1I 2GVIA 2N52A 1TBNA 1Y1BA 3VDPA 3FSYA 2FNFX 3R5BA 3CXLA 1UVGA 3TO6A 1P9ZA 1DS2I 1MJBA 1R0RI 2OVOA 3PDNA 1Z7KB 2SGFI 3SGQI 3OXFA 1IW4A 4UXIA 3FC3A 1IY6A 3E2IA 2LEOA 2P6AC 3TOAA 5CCMA 1S20A 4DNCA 1CE3A 2NU4I 1OMUA 2RC4A
chains in the Genus database with same CATH topology
1TURA 2SGEI 1SGRI 2DB6A 1RFHA 2NU3I 2NU2I 2V1CC 3SGBI 2J87A 2ODDA 2XRCA 1SGQI 2JW6A 1HPTA 2F3CI 2GKVA 3OL0A 2L8EA 2ELIA 2SGQI 1TIHA 3UGLA 2KMQA 1LR8A 1LR7A 1TBQR 2ERWA 2KMRA 1TGSI 1KMAA 1CT2I 2A20A 4FKDA 1X4SA 1V1HA 5FUWA 2NU0I 2GKTI 2JZMA 1PTRA 4A24A 2OD1A 1W3SA 2E5RA 2LUYA 2E73A 5HQ8A 2ENZA 4OVOA 5HI7A 1CGII 3GOXA 2QQDA 1FAQA 2M5XA 1V1IA 2N1AB 2ENNA 2QQEA 1M8CA 2BUSA 3HH2C 4E1RA 3KY9A 1SGPI 3RU0A 1HJAI 1PCEA 1SGYI 1U5KA 3MEKA 1XA6A 1UVFA 1W4RA 3SEKC 1BMOA 2DIPA 1TOTA 4E1PA 2KMOA 3OXLA 2NU1I 2WVJA 1PPFI 2ORWA 1CT4I 2QPOA 4UXJA 2UZ3A 3UEJA 2QQCA 2ARPF 2YUUA 3UEYA 1SGEI 1FARA 1Y8FA 1H0ZA 3OVOA 1NUBA 1R79A 1TBOA 1X74A 2KMPA 2GKRI 2VRWB 2QQ0A 3OXGA 5FUXA 2JA1A 2SGPI 1OYVI 2JYYA 1YTPA 2ORVA 4GI3C 3UGDA 3UGIA 5FUVA 1OVOA 2B8TA 3UFFA 1BUSA 4L9MA 3QTLD 1FYBA 1SGDI 4JCVE 2ROWA 3E59A 3B4VC 5CCLA 2J9RA 1PTQA 1SGNI 3QWPA 1KBEA 1Y1CA 1CT0I 5EX0A 1DS3I 1N13A 3BJIA 1IY5A 2L7XA 1OMTA 1CSOI 2B0UC 1KBFA 3D00A 3VE5A 1XBTA 5JHWC 1XX6A 4UXHA 2JXDA 1CHOI 1MT1A 1PJUA 2SGDI 1LR9A 1TUSA 1TBRR 5FUYA 2V1CA 1M8BA 1VDDA 1YU6C 2WCYA 4HGUA 2N71A 4B6DA 2YQPA 2K9HA 1UUCA 1CGJI 3VDUA 2N17A 2V53A 3TJQA 2CJSC 4SGBI 5EX3A 1HDLA 2KCXA 5DAEA 1AN1I 2GVIA 2N52A 1TBNA 1Y1BA 3VDPA 2FNFX 3CXLA 1UVGA 3SGQI 1DS2I 1R0RI 2OVOA 3PDNA 1Z7KB 2SGFI 3OXFA 1IW4A 4UXIA 3FC3A 1IY6A 3E2IA 2LEOA 2P6AC 5CCMA 1CE3A 2NU4I 1OMUA 2W0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5R A;  2DIP A;  2N1A B;  1TOT A; 
#chains in the Genus database with same CATH topology
 1TUR A;  2SGE I;  1SGR I;  2DB6 A;  1RFH A;  2NU3 I;  2NU2 I;  2V1C C;  3SGB I;  2WGC A;  2J87 A;  1WGC A;  2ODD A;  2XRC A;  1SGQ I;  2JW6 A;  1HPT A;  1MJ9 A;  2F3C I;  2GKV A;  3OL0 A;  3QAH A;  2CWF A;  2L8E A;  1FY7 A;  2ELI A;  1TIH A;  2SGQ I;  2KMQ A;  1LR8 A;  3UGL A;  5J8C A;  1WKX A;  1ULM A;  1LR7 A;  2CWH A;  1TBQ R;  1HEV A;  2ERW A;  2KMR A;  1TGS I;  4WP4 A;  1KMA A;  1CT2 I;  3TOB A;  2A20 A;  4FKD A;  1X4S A;  1V1H A;  5FUW A;  2NU0 I;  2GKT I;  2JZM A;  1PTR A;  4A24 A;  2OD1 A;  1MJA A;  1W3S A;  2E5R A;  2LUY A;  2E73 A;  5HQ8 A;  2ENZ A;  4OVO A;  5HI7 A;  4AML A;  1CGI I;  1NXU A;  3GOX A;  2QQD A;  1FAQ A;  2M5X A;  1V1I A;  2N1A B;  2ENN A;  2QQE A;  1M8C A;  2BUS A;  1ULK A;  2DKV A;  3HH2 C;  3KY9 A;  1SGP I;  3RU0 A;  1HJA I;  4E1R A;  2LB7 A;  5E3P A;  1PCE A;  1SGY I;  1U5K A;  1UHA A;  3MEK A;  1XA6 A;  1UVF A;  1W4R A;  2RIJ A;  1BMO A;  2CWG A;  2DIP A;  3SEK C;  7WGA A;  1TOT A;  4E1P A;  2KMO A;  3FSX A;  3OXL A;  2NU1 I;  4MPI A;  1WTJ A;  5FUX A;  2WVJ A;  1PPF I;  3R5D A;  2ORW A;  1CT4 I;  2QPO A;  2W0T A;  2UZ3 A;  4UXJ A;  3UEJ A;  2QQC A;  2ARP F;  2YUU A;  3UEY A;  1SGE I;  1FAR A;  1K7T A;  1Y8F A;  1H0Z A;  1K7U A;  5E3R A;  3OVO A;  1NUB A;  1R79 A;  1TBO A;  1X74 A;  2KMP A;  2GKR I;  2OU2 A;  2QQ0 A;  2VRW B;  3OXG A;  2JA1 A;  2SGP I;  1OYV I;  2JYY A;  1YTP A;  2ORV A;  4GI3 C;  3TO7 A;  3UGD A;  3UGI A;  5FUV A;  1OVO A;  2B8T A;  3UFF A;  1BUS A;  2X3T A;  3QTL D;  4L9M A;  1FYB A;  1SGD I;  4JCV E;  2ROW A;  3E59 A;  3B4V C;  5CCL A;  1WGT A;  1PTQ A;  2J9R A;  1SGN I;  2X52 A;  3QWP A;  1K7V A;  1KBE A;  1Y1C A;  1CT0 I;  2Y0M A;  5EX0 A;  1DS3 I;  1N13 A;  3BJI A;  1IY5 A;  2L7X A;  1OMT A;  1CSO I;  2B0U C;  1KBF A;  3D00 A;  2OZU A;  3VE5 A;  1XBT A;  3R5A A;  5JHW C;  1XX6 A;  1Q9B A;  4UXH A;  2JXD A;  1CHO I;  1MT1 A;  1PJU A;  1ULN A;  2SGD I;  1LR9 A;  3R5C A;  1TUS A;  1TBR R;  5FUY A;  3UOE A;  2V1C A;  1M8B A;  1VDD A;  1YU6 C;  1Z2I A;  2WCY A;  4HGU A;  2N71 A;  4B6D A;  2PQ8 A;  5E3Q A;  2YQP A;  2K9H A;  1UUC A;  2GIV A;  9WGA A;  3TO9 A;  1CGJ I;  1P9G A;  3VDU A;  2N17 A;  2V53 A;  3TJQ A;  2CJS C;  2UVO A;  4SGB I;  5J8F A;  5EX3 A;  1HDL A;  2KCX A;  5DAE A;  1AN1 I;  2GVI A;  2N52 A;  1TBN A;  1Y1B A;  3VDP A;  3FSY A;  2FNF X;  3R5B A;  3CXL A;  1UVG A;  3TO6 A;  1P9Z A;  1DS2 I;  1MJB A;  1R0R I;  2OVO A;  3PDN A;  1Z7K B;  2SGF I;  3SGQ I;  3OXF A;  1IW4 A;  4UXI A;  3FC3 A;  1IY6 A;  3E2I A;  2LEO A;  2P6A C;  3TOA A;  5CCM A;  1S20 A;  4DNC A;  1CE3 A;  2NU4 I;  1OMU A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 1TUR A;  2SGE I;  1SGR I;  2DB6 A;  1RFH A;  2NU3 I;  2NU2 I;  2V1C C;  3SGB I;  2J87 A;  2ODD A;  2XRC A;  1SGQ I;  2JW6 A;  1HPT A;  2F3C I;  2GKV A;  3OL0 A;  2L8E A;  2ELI A;  2SGQ I;  1TIH A;  3UGL A;  2KMQ A;  1LR8 A;  1LR7 A;  1TBQ R;  2ERW A;  2KMR A;  1TGS I;  1KMA A;  1CT2 I;  2A20 A;  4FKD A;  1X4S A;  1V1H A;  5FUW A;  2NU0 I;  2GKT I;  2JZM A;  1PTR A;  4A24 A;  2OD1 A;  1W3S A;  2E5R A;  2LUY A;  2E73 A;  5HQ8 A;  2ENZ A;  4OVO A;  5HI7 A;  1CGI I;  3GOX A;  2QQD A;  1FAQ A;  2M5X A;  1V1I A;  2N1A B;  2ENN A;  2QQE A;  1M8C A;  2BUS A;  3HH2 C;  4E1R A;  3KY9 A;  1SGP I;  3RU0 A;  1HJA I;  1PCE A;  1SGY I;  1U5K A;  3MEK A;  1XA6 A;  1UVF A;  1W4R A;  3SEK C;  1BMO A;  2DIP A;  1TOT A;  4E1P A;  2KMO A;  3OXL A;  2NU1 I;  2WVJ A;  1PPF I;  2ORW A;  1CT4 I;  2QPO A;  4UXJ A;  2UZ3 A;  3UEJ A;  2QQC A;  2ARP F;  2YUU A;  3UEY A;  1SGE I;  1FAR A;  1Y8F A;  1H0Z A;  3OVO A;  1NUB A;  1R79 A;  1TBO A;  1X74 A;  2KMP A;  2GKR I;  2VRW B;  2QQ0 A;  3OXG A;  5FUX A;  2JA1 A;  2SGP I;  1OYV I;  2JYY A;  1YTP A;  2ORV A;  4GI3 C;  3UGD A;  3UGI A;  5FUV A;  1OVO A;  2B8T A;  3UFF A;  1BUS A;  4L9M A;  3QTL D;  1FYB A;  1SGD I;  4JCV E;  2ROW A;  3E59 A;  3B4V C;  5CCL A;  2J9R A;  1PTQ A;  1SGN I;  3QWP A;  1KBE A;  1Y1C A;  1CT0 I;  5EX0 A;  1DS3 I;  1N13 A;  3BJI A;  1IY5 A;  2L7X A;  1OMT A;  1CSO I;  2B0U C;  1KBF A;  3D00 A;  3VE5 A;  1XBT A;  5JHW C;  1XX6 A;  4UXH A;  2JXD A;  1CHO I;  1MT1 A;  1PJU A;  2SGD I;  1LR9 A;  1TUS A;  1TBR R;  5FUY A;  2V1C A;  1M8B A;  1VDD A;  1YU6 C;  2WCY A;  4HGU A;  2N71 A;  4B6D A;  2YQP A;  2K9H A;  1UUC A;  1CGJ I;  3VDU A;  2N17 A;  2V53 A;  3TJQ A;  2CJS C;  4SGB I;  5EX3 A;  1HDL A;  2KCX A;  5DAE A;  1AN1 I;  2GVI A;  2N52 A;  1TBN A;  1Y1B A;  3VDP A;  2FNF X;  3CXL A;  1UVG A;  3SGQ I;  1DS2 I;  1R0R I;  2OVO A;  3PDN A;  1Z7K B;  2SGF I;  3OXF A;  1IW4 A;  4UXI A;  3FC3 A;  1IY6 A;  3E2I A;  2LEO A;  2P6A C;  5CCM A;  1CE3 A;  2NU4 I;  1OMU A;  2W0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...