1CGII

Three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CHYMOTRYPSINOGEN
publication title Three-dimensional structure of the complexes between bovine chymotrypsinogen A and two recombinant variants of human pancreatic secretory trypsin inhibitor (Kazal-type).
pubmed doi rcsb
source organism Bos taurus
molecule tags Serine protease/inhibitor complex
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1cgiI00
1CHOI 1HPTA 4GI3C 1YTPA 2KMQA 1SGDI 1TURA 1TBRR 2P6AC 1TIHA 1CT0I 2B0UC 2KMOA 1NUBA 1YU6C 3HH2C 1LR9A 2SGFI 3SEKC 2GKVA 2M5XA 1OVOA 2KCXA 2SGQI 2ERWA 2KMPA 4OVOA 5DAEA 1UUCA 5JHWC 2N17A 4SGBI 1KMAA 2F3CI 1HJAI 1Y1CA 1CSOI 2JYYA 1M8CA 1M8BA 1CE3A 2JXDA 3B4VC 2LEOA 2NU4I 2XRCA 1DS2I 1TGSI 1BMOA 2ARPF 1UVFA 4HGUA 1CGII 2V53A 1IY5A 2GKTI 2QQCA 2NU0I 1OYVI 1TUSA 2QQDA 3TJQA 1DS3I 2SGEI 1H0ZA 2GKRI 1R0RI 1BUSA 1UVGA 1N13A 2N52A 2JZMA 1AN1I 1CGJI 1SGQI 2BUSA 1TBQR 1SGRI 1Y1BA 1IY6A 1PPFI 2WCYA 1IW4A 1SGEI 2SGDI 3QTLD 1CT2I 1HDLA 2KMRA 2NU2I 1FYBA 1SGPI 2NU3I 1MT1A 1CT4I 3SGBI 1SGYI 2N71A 1OMUA 1Z7KB 1PCEA 3OVOA 3SGQI 2NU1I 1PJUA 1LR7A 1SGNI 2SGPI 1OMTA 2OVOA 1LR8A
chains in the Genus database with same CATH superfamily
1CHOI 1HPTA 3R5BA 5CCLA 4GI3C 1YTPA 3VDPA 2YQPA 2DB6A 1W3SA 2KMQA 2X3TA 5HI7A 1SGDI 2K9HA 1TURA 1TBRR 2WVJA 2P6AC 1TIHA 1CT0I 1W4RA 2B0UC 2UZ3A 1TBOA 2KMOA 5E3QA 1UHAA 5FUYA 3UFFA 9WGAA 1NUBA 1YU6C 3HH2C 2YUUA 3OXGA 1LR9A 3PDNA 2W0TA 4UXIA 2SGFI 1R79A 1ULNA 5EX0A 2L8EA 3OXFA 3D00A 3SEKC 2PQ8A 2GKVA 2M5XA 1OVOA 3TO9A 5J8FA 2ELIA 2KCXA 3VE5A 3UGIA 1MJAA 2CWHA 2SGQI 3RU0A 2J87A 2LUYA 1S20A 1X74A 2VRWB 3CXLA 5EX3A 3UOEA 2ERWA 1KBEA 2KMPA 4OVOA 5DAEA 1UUCA 2V1CC 5JHWC 2N17A 2RC4A 3R5CA 4SGBI 1KMAA 2QQ0A 4JCVE 2F3CI 1HJAI 1P9GA 1Y1CA 5E3RA 5E3PA 1CSOI 1MJ9A 2JYYA 1M8CA 1M8BA 1CE3A 2JXDA 1HEVA 1X4SA 1Y8FA 3B4VC 5FUWA 2B8TA 1V1IA 2LEOA 2NU4I 2RIJA 1FARA 2XRCA 1DS2I 1TGSI 1BMOA 1XX6A 3UEJA 2ARPF 2ENZA 1FY7A 2UVOA 1UVFA 1V1HA 2E73A 3BJIA 1PTRA 1WKXA 3MEKA 4HGUA 5FUXA 2L7XA 3TO6A 2V1CA 1CGII 4UXHA 4A24A 2V53A 2QQEA 3R5DA 1TBNA 5HQ8A 1KBFA 2ORWA 4L9MA 1PTQA 2DKVA 1IY5A 2GKTI 2QQCA 2NU0I 3KY9A 1OYVI 1TUSA 2GIVA 2QQDA 1Z2IA 1P9ZA 2OD1A 1FAQA 2FNFX 5CCMA 1K7VA 1ULKA 3TJQA 3TOAA 3TO7A 5FUVA 7WGAA 4E1RA 1NXUA 1DS3I 5J8CA 4UXJA 4DNCA 1VDDA 1MJBA 2QPOA 2SGEI 1H0ZA 2Y0MA 3OXLA 4AMLA 2J9RA 2GKRI 1R0RI 1BUSA 3TOBA 1UVGA 1U5KA 1N13A 1XA6A 3FSXA 2N52A 1WGCA 2ORVA 2E5RA 2JZMA 2ROWA 1AN1I 3E59A 1WGTA 3VDUA 1CGJI 1SGQI 2BUSA 1TBQR 4MPIA 1RFHA 1SGRI 1Y1BA 3E2IA 1IY6A 2JW6A 1PPFI 2WCYA 1IW4A 1SGEI 2CWGA 2SGDI 3QTLD 2ENNA 2N1AB 3OL0A 1CT2I 3FSYA 2OZUA 4E1PA 1HDLA 3UGDA 2KMRA 2NU2I 1FYBA 1SGPI 2NU3I 2WGCA 1MT1A 1CT4I 2GVIA 3SGBI 1K7TA 2A20A 2LB7A 1Q9BA 1SGYI 2CJSC 2N71A 3UEYA 1ULMA 1OMUA 1Z7KB 2CWFA 2DIPA 1TOTA 1PCEA 3OVOA 4WP4A 3FC3A 2JA1A 3SGQI 2ODDA 2OU2A 3QWPA 2NU1I 1PJUA 1XBTA 4B6DA 1WTJA 3UGLA 1LR7A 1K7UA 1SGNI 2SGPI 3QAHA 4FKDA 2X52A 1OMTA 3GOXA 2OVOA 3R5AA 1LR8A
chains in the Genus database with same CATH topology
1CHOI 1HPTA 5CCLA 4GI3C 1YTPA 3VDPA 2YQPA 2DB6A 1W3SA 2KMQA 5HI7A 1SGDI 2K9HA 1TURA 1TBRR 2WVJA 2P6AC 1TIHA 1CT0I 1W4RA 2B0UC 2UZ3A 1TBOA 2KMOA 5FUYA 3UFFA 1NUBA 1YU6C 3HH2C 2YUUA 3OXGA 1LR9A 3PDNA 2W0TA 4UXIA 2SGFI 1R79A 5EX0A 2L8EA 3OXFA 3D00A 3SEKC 2GKVA 2M5XA 1OVOA 2ELIA 2KCXA 3VE5A 3UGIA 2SGQI 3RU0A 2J87A 2LUYA 1X74A 3CXLA 2VRWB 5EX3A 2ERWA 1KBEA 2KMPA 4OVOA 5DAEA 1UUCA 2V1CC 5JHWC 2N17A 4SGBI 1KMAA 2QQ0A 4JCVE 2F3CI 1HJAI 1Y1CA 1CSOI 2JYYA 1M8CA 1M8BA 1CE3A 2JXDA 1X4SA 1Y8FA 3B4VC 5FUWA 2B8TA 1V1IA 2LEOA 2NU4I 1FARA 2XRCA 1DS2I 1TGSI 1BMOA 1XX6A 3UEJA 2ARPF 2ENZA 1UVFA 1V1HA 2E73A 3BJIA 1PTRA 3MEKA 4HGUA 5FUXA 2L7XA 2V1CA 1CGII 4UXHA 4A24A 2V53A 2QQEA 1TBNA 5HQ8A 1KBFA 2ORWA 4L9MA 1PTQA 1IY5A 2GKTI 2QQCA 2NU0I 3KY9A 1OYVI 1TUSA 2QQDA 2OD1A 1FAQA 2FNFX 5CCMA 3TJQA 5FUVA 4E1RA 1DS3I 4UXJA 1VDDA 2QPOA 2SGEI 1H0ZA 3OXLA 2J9RA 2GKRI 1R0RI 1BUSA 1UVGA 1U5KA 1N13A 1XA6A 2N52A 2ORVA 2ROWA 2E5RA 2JZMA 1AN1I 3E59A 3VDUA 1CGJI 1SGQI 2BUSA 1TBQR 1RFHA 1SGRI 1Y1BA 3E2IA 1IY6A 2JW6A 1PPFI 2WCYA 1IW4A 1SGEI 2SGDI 3QTLD 2ENNA 2N1AB 3OL0A 1CT2I 4E1PA 1HDLA 3UGDA 2KMRA 2NU2I 1FYBA 1SGPI 2NU3I 1MT1A 1CT4I 2GVIA 3SGBI 2A20A 1SGYI 2CJSC 2N71A 3UEYA 1OMUA 1Z7KB 2DIPA 1TOTA 1PCEA 3OVOA 3FC3A 2JA1A 3SGQI 2ODDA 3QWPA 2NU1I 1PJUA 1XBTA 4B6DA 3UGLA 1LR7A 1SGNI 2SGPI 4FKDA 1OMTA 3GOXA 2OVOA 1LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHO I;  1HPT A;  4GI3 C;  1YTP A;  2KMQ A;  1SGD I;  1TUR A;  1TBR R;  2P6A C;  1TIH A;  1CT0 I;  2B0U C;  2KMO A;  1NUB A;  1YU6 C;  3HH2 C;  1LR9 A;  2SGF I;  3SEK C;  2GKV A;  2M5X A;  1OVO A;  2KCX A;  2SGQ I;  2ERW A;  2KMP A;  4OVO A;  5DAE A;  1UUC A;  5JHW C;  2N17 A;  4SGB I;  1KMA A;  2F3C I;  1HJA I;  1Y1C A;  1CSO I;  2JYY A;  1M8C A;  1M8B A;  1CE3 A;  2JXD A;  3B4V C;  2LEO A;  2NU4 I;  2XRC A;  1DS2 I;  1TGS I;  1BMO A;  2ARP F;  1UVF A;  4HGU A;  1CGI I;  2V53 A;  1IY5 A;  2GKT I;  2QQC A;  2NU0 I;  1OYV I;  1TUS A;  2QQD A;  3TJQ A;  1DS3 I;  2SGE I;  1H0Z A;  2GKR I;  1R0R I;  1BUS A;  1UVG A;  1N13 A;  2N52 A;  2JZM A;  1AN1 I;  1CGJ I;  1SGQ I;  2BUS A;  1TBQ R;  1SGR I;  1Y1B A;  1IY6 A;  1PPF I;  2WCY A;  1IW4 A;  1SGE I;  2SGD I;  3QTL D;  1CT2 I;  1HDL A;  2KMR A;  2NU2 I;  1FYB A;  1SGP I;  2NU3 I;  1MT1 A;  1CT4 I;  3SGB I;  1SGY I;  2N71 A;  1OMU A;  1Z7K B;  1PCE A;  3OVO A;  3SGQ I;  2NU1 I;  1PJU A;  1LR7 A;  1SGN I;  2SGP I;  1OMT A;  2OVO A;  1LR8 A; 
#chains in the Genus database with same CATH topology
 1CHO I;  1HPT A;  3R5B A;  5CCL A;  4GI3 C;  1YTP A;  3VDP A;  2YQP A;  2DB6 A;  1W3S A;  2KMQ A;  2X3T A;  5HI7 A;  1SGD I;  2K9H A;  1TUR A;  1TBR R;  2WVJ A;  2P6A C;  1TIH A;  1CT0 I;  1W4R A;  2B0U C;  2UZ3 A;  1TBO A;  2KMO A;  5E3Q A;  1UHA A;  5FUY A;  3UFF A;  9WGA A;  1NUB A;  1YU6 C;  3HH2 C;  2YUU A;  3OXG A;  1LR9 A;  3PDN A;  2W0T A;  4UXI A;  2SGF I;  1R79 A;  1ULN A;  5EX0 A;  2L8E A;  3OXF A;  3D00 A;  3SEK C;  2PQ8 A;  2GKV A;  2M5X A;  1OVO A;  3TO9 A;  5J8F A;  2ELI A;  2KCX A;  3VE5 A;  3UGI A;  1MJA A;  2CWH A;  2SGQ I;  3RU0 A;  2J87 A;  2LUY A;  1S20 A;  1X74 A;  2VRW B;  3CXL A;  5EX3 A;  3UOE A;  2ERW A;  1KBE A;  2KMP A;  4OVO A;  5DAE A;  1UUC A;  2V1C C;  5JHW C;  2N17 A;  2RC4 A;  3R5C A;  4SGB I;  1KMA A;  2QQ0 A;  4JCV E;  2F3C I;  1HJA I;  1P9G A;  1Y1C A;  5E3R A;  5E3P A;  1CSO I;  1MJ9 A;  2JYY A;  1M8C A;  1M8B A;  1CE3 A;  2JXD A;  1HEV A;  1X4S A;  1Y8F A;  3B4V C;  5FUW A;  2B8T A;  1V1I A;  2LEO A;  2NU4 I;  2RIJ A;  1FAR A;  2XRC A;  1DS2 I;  1TGS I;  1BMO A;  1XX6 A;  3UEJ A;  2ARP F;  2ENZ A;  1FY7 A;  2UVO A;  1UVF A;  1V1H A;  2E73 A;  3BJI A;  1PTR A;  1WKX A;  3MEK A;  4HGU A;  5FUX A;  2L7X A;  3TO6 A;  2V1C A;  1CGI I;  4UXH A;  4A24 A;  2V53 A;  2QQE A;  3R5D A;  1TBN A;  5HQ8 A;  1KBF A;  2ORW A;  4L9M A;  1PTQ A;  2DKV A;  1IY5 A;  2GKT I;  2QQC A;  2NU0 I;  3KY9 A;  1OYV I;  1TUS A;  2GIV A;  2QQD A;  1Z2I A;  1P9Z A;  2OD1 A;  1FAQ A;  2FNF X;  5CCM A;  1K7V A;  1ULK A;  3TJQ A;  3TOA A;  3TO7 A;  5FUV A;  7WGA A;  4E1R A;  1NXU A;  1DS3 I;  5J8C A;  4UXJ A;  4DNC A;  1VDD A;  1MJB A;  2QPO A;  2SGE I;  1H0Z A;  2Y0M A;  3OXL A;  4AML A;  2J9R A;  2GKR I;  1R0R I;  1BUS A;  3TOB A;  1UVG A;  1U5K A;  1N13 A;  1XA6 A;  3FSX A;  2N52 A;  1WGC A;  2ORV A;  2E5R A;  2JZM A;  2ROW A;  1AN1 I;  3E59 A;  1WGT A;  3VDU A;  1CGJ I;  1SGQ I;  2BUS A;  1TBQ R;  4MPI A;  1RFH A;  1SGR I;  1Y1B A;  3E2I A;  1IY6 A;  2JW6 A;  1PPF I;  2WCY A;  1IW4 A;  1SGE I;  2CWG A;  2SGD I;  3QTL D;  2ENN A;  2N1A B;  3OL0 A;  1CT2 I;  3FSY A;  2OZU A;  4E1P A;  1HDL A;  3UGD A;  2KMR A;  2NU2 I;  1FYB A;  1SGP I;  2NU3 I;  2WGC A;  1MT1 A;  1CT4 I;  2GVI A;  3SGB I;  1K7T A;  2A20 A;  2LB7 A;  1Q9B A;  1SGY I;  2CJS C;  2N71 A;  3UEY A;  1ULM A;  1OMU A;  1Z7K B;  2CWF A;  2DIP A;  1TOT A;  1PCE A;  3OVO A;  4WP4 A;  3FC3 A;  2JA1 A;  3SGQ I;  2ODD A;  2OU2 A;  3QWP A;  2NU1 I;  1PJU A;  1XBT A;  4B6D A;  1WTJ A;  3UGL A;  1LR7 A;  1K7U A;  1SGN I;  2SGP I;  3QAH A;  4FKD A;  2X52 A;  1OMT A;  3GOX A;  2OVO A;  3R5A A;  1LR8 A; 
#chains in the Genus database with same CATH homology
 1CHO I;  1HPT A;  5CCL A;  4GI3 C;  1YTP A;  3VDP A;  2YQP A;  2DB6 A;  1W3S A;  2KMQ A;  5HI7 A;  1SGD I;  2K9H A;  1TUR A;  1TBR R;  2WVJ A;  2P6A C;  1TIH A;  1CT0 I;  1W4R A;  2B0U C;  2UZ3 A;  1TBO A;  2KMO A;  5FUY A;  3UFF A;  1NUB A;  1YU6 C;  3HH2 C;  2YUU A;  3OXG A;  1LR9 A;  3PDN A;  2W0T A;  4UXI A;  2SGF I;  1R79 A;  5EX0 A;  2L8E A;  3OXF A;  3D00 A;  3SEK C;  2GKV A;  2M5X A;  1OVO A;  2ELI A;  2KCX A;  3VE5 A;  3UGI A;  2SGQ I;  3RU0 A;  2J87 A;  2LUY A;  1X74 A;  3CXL A;  2VRW B;  5EX3 A;  2ERW A;  1KBE A;  2KMP A;  4OVO A;  5DAE A;  1UUC A;  2V1C C;  5JHW C;  2N17 A;  4SGB I;  1KMA A;  2QQ0 A;  4JCV E;  2F3C I;  1HJA I;  1Y1C A;  1CSO I;  2JYY A;  1M8C A;  1M8B A;  1CE3 A;  2JXD A;  1X4S A;  1Y8F A;  3B4V C;  5FUW A;  2B8T A;  1V1I A;  2LEO A;  2NU4 I;  1FAR A;  2XRC A;  1DS2 I;  1TGS I;  1BMO A;  1XX6 A;  3UEJ A;  2ARP F;  2ENZ A;  1UVF A;  1V1H A;  2E73 A;  3BJI A;  1PTR A;  3MEK A;  4HGU A;  5FUX A;  2L7X A;  2V1C A;  1CGI I;  4UXH A;  4A24 A;  2V53 A;  2QQE A;  1TBN A;  5HQ8 A;  1KBF A;  2ORW A;  4L9M A;  1PTQ A;  1IY5 A;  2GKT I;  2QQC A;  2NU0 I;  3KY9 A;  1OYV I;  1TUS A;  2QQD A;  2OD1 A;  1FAQ A;  2FNF X;  5CCM A;  3TJQ A;  5FUV A;  4E1R A;  1DS3 I;  4UXJ A;  1VDD A;  2QPO A;  2SGE I;  1H0Z A;  3OXL A;  2J9R A;  2GKR I;  1R0R I;  1BUS A;  1UVG A;  1U5K A;  1N13 A;  1XA6 A;  2N52 A;  2ORV A;  2ROW A;  2E5R A;  2JZM A;  1AN1 I;  3E59 A;  3VDU A;  1CGJ I;  1SGQ I;  2BUS A;  1TBQ R;  1RFH A;  1SGR I;  1Y1B A;  3E2I A;  1IY6 A;  2JW6 A;  1PPF I;  2WCY A;  1IW4 A;  1SGE I;  2SGD I;  3QTL D;  2ENN A;  2N1A B;  3OL0 A;  1CT2 I;  4E1P A;  1HDL A;  3UGD A;  2KMR A;  2NU2 I;  1FYB A;  1SGP I;  2NU3 I;  1MT1 A;  1CT4 I;  2GVI A;  3SGB I;  2A20 A;  1SGY I;  2CJS C;  2N71 A;  3UEY A;  1OMU A;  1Z7K B;  2DIP A;  1TOT A;  1PCE A;  3OVO A;  3FC3 A;  2JA1 A;  3SGQ I;  2ODD A;  3QWP A;  2NU1 I;  1PJU A;  1XBT A;  4B6D A;  3UGL A;  1LR7 A;  1SGN I;  2SGP I;  4FKD A;  1OMT A;  3GOX A;  2OVO A;  1LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...