1Y1BA

Solution structure of anemonia elastase inhibitor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
48
structure length
48
Chain Sequence
KPDCPLICTMQYDPVCGSDGITYGNACMLLGASCRSDTPIELVHKGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Elastase inhibitor
publication title Structural and Functional Study of an Anemonia Elastase Inhibitor, a "Nonclassical" Kazal-Type Inhibitor from Anemonia sulcata
pubmed doi rcsb
total genus 8
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y1bA00
2QQDA 1CGII 2NU0I 1UUCA 3SEKC 2GKVA 2KCXA 1HDLA 3HH2C 1TGSI 2ERWA 2KMQA 2GKRI 1NUBA 1OVOA 1TBQR 1SGDI 3TJQA 3SGQI 1M8CA 1DS2I 2SGEI 5JHWC 1HPTA 2NU2I 3SGBI 1CT2I 1PCEA 2V53A 1R0RI 1BUSA 1CGJI 1UVFA 1IY5A 2P6AC 2KMOA 3OVOA 1MT1A 2OVOA 2B0UC 4GI3C 1Y1CA 2KMPA 1LR7A 1TUSA 1SGRI 2NU3I 1PJUA 1YTPA 2NU4I 2SGFI 1CSOI 1LR9A 1N13A 1OMTA 1BMOA 1IW4A 1CE3A 2XRCA 2KMRA 2N71A 1SGPI 2N17A 1M8BA 2SGQI 2LEOA 1H0ZA 1SGYI 1KMAA 1PPFI 1OYVI 2GKTI 1TURA 2N52A 1FYBA 1TIHA 2JZMA 1IY6A 1SGNI 1UVGA 1Y1BA 1CT4I 2JXDA 2SGDI 4HGUA 1YU6C 5DAEA 1OMUA 1SGQI 2NU1I 4SGBI 1SGEI 2BUSA 4OVOA 1HJAI 1CHOI 3QTLD 2JYYA 2SGPI 2F3CI 1Z7KB 1AN1I 1DS3I 3B4VC 1LR8A 2QQCA 1TBRR 1CT0I 2WCYA 2M5XA 2ARPF
chains in the Genus database with same CATH superfamily
3E2IA 2QQDA 3QAHA 1CGII 2NU0I 4L9MA 2OD1A 1UUCA 1WGTA 1K7VA 3SEKC 1TBNA 2YQPA 2L8EA 2GKVA 2ROWA 2KCXA 1TOTA 1Y8FA 1HDLA 3HH2C 4UXIA 1TGSI 1WTJA 2ERWA 2LUYA 2QPOA 3UOEA 2WGCA 2KMQA 1P9GA 2GKRI 3TO6A 1NUBA 1OVOA 3RU0A 5CCMA 1TBQR 2OZUA 1SGDI 2X3TA 3TJQA 2CWHA 1MJAA 3CXLA 3SGQI 1M8CA 2ORWA 3FSYA 2M5XA 2ENZA 2K9HA 1X4SA 2RIJA 1ULNA 2W0TA 3UEYA 3UGIA 3UGDA 1V1HA 1DS2I 2SGEI 2VRWB 2ELIA 3FC3A 5FUYA 5JHWC 1TBOA 1HPTA 2UVOA 2NU2I 3SGBI 5CCLA 3OXLA 1Z2IA 1RFHA 1CT2I 1PCEA 1R0RI 2V53A 1PTQA 4FKDA 3OL0A 3PDNA 3VDPA 1CGJI 1BUSA 2N1AB 2DIPA 1UVFA 3E59A 1S20A 2V1CA 1IY5A 2P6AC 3D00A 2KMOA 3UGLA 2B8TA 5EX3A 3OVOA 1MT1A 1P9ZA 2OVOA 3MEKA 2B0UC 1KBEA 4GI3C 1U5KA 1Y1CA 2DB6A 2RC4A 2A20A 2KMPA 3TOBA 1W4RA 3FSXA 1LR7A 1TUSA 1SGRI 2E73A 2NU3I 1PJUA 2V1CC 1YTPA 1WGCA 2GIVA 2NU4I 2QQEA 2Y0MA 3R5CA 5J8FA 2SGFI 1CSOI 1LR9A 1N13A 1OMTA 1BMOA 2OU2A 3OXFA 1IW4A 5J8CA 1V1IA 1CE3A 9WGAA 2XRCA 2KMRA 1WKXA 2N71A 2UZ3A 1SGPI 1Q9BA 2CJSC 2N17A 1M8BA 2X52A 2SGQI 2ODDA 2LEOA 1PTRA 1XX6A 4B6DA 1H0ZA 1SGYI 1KMAA 1PPFI 3TOAA 4WP4A 2J87A 3UFFA 2DKVA 1OYVI 5E3PA 2JW6A 2PQ8A 2GKTI 1TURA 5FUXA 1UHAA 2E5RA 2N52A 3QWPA 1MJBA 4UXHA 1TIHA 1FYBA 2JZMA 1IY6A 1ULKA 2ENNA 3TO9A 3OXGA 1MJ9A 1SGNI 1UVGA 1Y1BA 4MPIA 1R79A 1CT4I 1KBFA 2JXDA 3VDUA 2SGDI 2JA1A 4HGUA 1YU6C 3BJIA 2ORVA 1W3SA 1ULMA 3VE5A 5DAEA 1OMUA 4DNCA 1SGQI 5HI7A 1FY7A 2NU1I 4UXJA 3R5AA 3TO7A 5E3RA 1NXUA 4SGBI 2L7XA 5E3QA 5HQ8A 4AMLA 7WGAA 1SGEI 3R5DA 2BUSA 5FUWA 1K7TA 1X74A 2CWGA 4OVOA 1HJAI 2J9RA 2FNFX 1XBTA 2WVJA 3UEJA 1CHOI 2LB7A 4JCVE 1XA6A 1K7UA 4E1RA 1VDDA 2YUUA 2JYYA 3QTLD 2SGPI 4E1PA 3GOXA 2F3CI 1FAQA 1Z7KB 1AN1I 2GVIA 5FUVA 1DS3I 4A24A 2QQ0A 3B4VC 1LR8A 2QQCA 1TBRR 3KY9A 3R5BA 1FARA 1HEVA 1CT0I 2WCYA 5EX0A 2CWFA 2ARPF
chains in the Genus database with same CATH topology
3E2IA 2QQDA 1CGII 2NU0I 4L9MA 2OD1A 1UUCA 3SEKC 1TBNA 2YQPA 2L8EA 2GKVA 2ROWA 2KCXA 1TOTA 1Y8FA 1HDLA 3HH2C 4UXIA 1TGSI 2LUYA 2ERWA 2QPOA 2KMQA 2GKRI 1NUBA 1OVOA 3RU0A 5CCMA 1TBQR 1SGDI 3TJQA 3SGQI 3CXLA 1M8CA 2ORWA 2ENZA 2K9HA 1X4SA 2W0TA 3UEYA 3UGDA 3UGIA 1V1HA 1DS2I 2SGEI 2VRWB 2ELIA 3FC3A 5FUYA 5JHWC 1TBOA 1HPTA 2NU2I 3SGBI 5CCLA 3OXLA 1RFHA 1CT2I 1PCEA 1R0RI 2V53A 1PTQA 4FKDA 3OL0A 3PDNA 3VDPA 1CGJI 1BUSA 2N1AB 2DIPA 1UVFA 3E59A 2V1CA 1IY5A 2P6AC 3D00A 2KMOA 3UGLA 2B8TA 5EX3A 3OVOA 1MT1A 2OVOA 3MEKA 2B0UC 1KBEA 4GI3C 1U5KA 1Y1CA 2DB6A 2A20A 2KMPA 1W4RA 1LR7A 1TUSA 1SGRI 2E73A 2NU3I 1PJUA 2V1CC 1YTPA 2QQEA 1FAQA 2NU4I 2SGFI 1CSOI 1LR9A 1N13A 1OMTA 1BMOA 1IW4A 3OXFA 1V1IA 1CE3A 2XRCA 2KMRA 2N71A 2UZ3A 1SGPI 2CJSC 2N17A 1M8BA 2SGQI 2ODDA 2LEOA 1PTRA 1XX6A 4B6DA 1H0ZA 1SGYI 1KMAA 1PPFI 2J87A 3UFFA 1OYVI 2JW6A 2GKTI 1TURA 5FUXA 2E5RA 2N52A 3QWPA 4UXHA 1FYBA 1TIHA 2JZMA 1IY6A 2ENNA 3OXGA 1SGNI 1UVGA 1Y1BA 1R79A 1CT4I 1KBFA 2JXDA 3VDUA 2SGDI 2JA1A 4HGUA 1YU6C 3BJIA 2ORVA 1W3SA 3VE5A 5DAEA 1OMUA 1SGQI 5HI7A 2NU1I 4UXJA 4SGBI 2L7XA 5HQ8A 1SGEI 5FUWA 2BUSA 1X74A 4OVOA 1HJAI 2J9RA 2FNFX 1XBTA 2WVJA 3UEJA 1CHOI 4JCVE 1XA6A 4E1RA 1VDDA 2YUUA 2JYYA 3QTLD 2SGPI 4E1PA 3GOXA 2F3CI 1Z7KB 1AN1I 2GVIA 5FUVA 1DS3I 4A24A 2QQ0A 3B4VC 1LR8A 2QQCA 1TBRR 3KY9A 1FARA 1CT0I 2WCYA 5EX0A 2M5XA 2ARPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQD A;  1CGI I;  2NU0 I;  1UUC A;  3SEK C;  2GKV A;  2KCX A;  1HDL A;  3HH2 C;  1TGS I;  2ERW A;  2KMQ A;  2GKR I;  1NUB A;  1OVO A;  1TBQ R;  1SGD I;  3TJQ A;  3SGQ I;  1M8C A;  1DS2 I;  2SGE I;  5JHW C;  1HPT A;  2NU2 I;  3SGB I;  1CT2 I;  1PCE A;  2V53 A;  1R0R I;  1BUS A;  1CGJ I;  1UVF A;  1IY5 A;  2P6A C;  2KMO A;  3OVO A;  1MT1 A;  2OVO A;  2B0U C;  4GI3 C;  1Y1C A;  2KMP A;  1LR7 A;  1TUS A;  1SGR I;  2NU3 I;  1PJU A;  1YTP A;  2NU4 I;  2SGF I;  1CSO I;  1LR9 A;  1N13 A;  1OMT A;  1BMO A;  1IW4 A;  1CE3 A;  2XRC A;  2KMR A;  2N71 A;  1SGP I;  2N17 A;  1M8B A;  2SGQ I;  2LEO A;  1H0Z A;  1SGY I;  1KMA A;  1PPF I;  1OYV I;  2GKT I;  1TUR A;  2N52 A;  1FYB A;  1TIH A;  2JZM A;  1IY6 A;  1SGN I;  1UVG A;  1Y1B A;  1CT4 I;  2JXD A;  2SGD I;  4HGU A;  1YU6 C;  5DAE A;  1OMU A;  1SGQ I;  2NU1 I;  4SGB I;  1SGE I;  2BUS A;  4OVO A;  1HJA I;  1CHO I;  3QTL D;  2JYY A;  2SGP I;  2F3C I;  1Z7K B;  1AN1 I;  1DS3 I;  3B4V C;  1LR8 A;  2QQC A;  1TBR R;  1CT0 I;  2WCY A;  2M5X A;  2ARP F; 
#chains in the Genus database with same CATH topology
 3E2I A;  2QQD A;  3QAH A;  1CGI I;  2NU0 I;  4L9M A;  2OD1 A;  1UUC A;  1WGT A;  1K7V A;  3SEK C;  1TBN A;  2YQP A;  2L8E A;  2GKV A;  2ROW A;  2KCX A;  1TOT A;  1Y8F A;  1HDL A;  3HH2 C;  4UXI A;  1TGS I;  1WTJ A;  2ERW A;  2LUY A;  2QPO A;  3UOE A;  2WGC A;  2KMQ A;  1P9G A;  2GKR I;  3TO6 A;  1NUB A;  1OVO A;  3RU0 A;  5CCM A;  1TBQ R;  2OZU A;  1SGD I;  2X3T A;  3TJQ A;  2CWH A;  1MJA A;  3CXL A;  3SGQ I;  1M8C A;  2ORW A;  3FSY A;  2M5X A;  2ENZ A;  2K9H A;  1X4S A;  2RIJ A;  1ULN A;  2W0T A;  3UEY A;  3UGI A;  3UGD A;  1V1H A;  1DS2 I;  2SGE I;  2VRW B;  2ELI A;  3FC3 A;  5FUY A;  5JHW C;  1TBO A;  1HPT A;  2UVO A;  2NU2 I;  3SGB I;  5CCL A;  3OXL A;  1Z2I A;  1RFH A;  1CT2 I;  1PCE A;  1R0R I;  2V53 A;  1PTQ A;  4FKD A;  3OL0 A;  3PDN A;  3VDP A;  1CGJ I;  1BUS A;  2N1A B;  2DIP A;  1UVF A;  3E59 A;  1S20 A;  2V1C A;  1IY5 A;  2P6A C;  3D00 A;  2KMO A;  3UGL A;  2B8T A;  5EX3 A;  3OVO A;  1MT1 A;  1P9Z A;  2OVO A;  3MEK A;  2B0U C;  1KBE A;  4GI3 C;  1U5K A;  1Y1C A;  2DB6 A;  2RC4 A;  2A20 A;  2KMP A;  3TOB A;  1W4R A;  3FSX A;  1LR7 A;  1TUS A;  1SGR I;  2E73 A;  2NU3 I;  1PJU A;  2V1C C;  1YTP A;  1WGC A;  2GIV A;  2NU4 I;  2QQE A;  2Y0M A;  3R5C A;  5J8F A;  2SGF I;  1CSO I;  1LR9 A;  1N13 A;  1OMT A;  1BMO A;  2OU2 A;  3OXF A;  1IW4 A;  5J8C A;  1V1I A;  1CE3 A;  9WGA A;  2XRC A;  2KMR A;  1WKX A;  2N71 A;  2UZ3 A;  1SGP I;  1Q9B A;  2CJS C;  2N17 A;  1M8B A;  2X52 A;  2SGQ I;  2ODD A;  2LEO A;  1PTR A;  1XX6 A;  4B6D A;  1H0Z A;  1SGY I;  1KMA A;  1PPF I;  3TOA A;  4WP4 A;  2J87 A;  3UFF A;  2DKV A;  1OYV I;  5E3P A;  2JW6 A;  2PQ8 A;  2GKT I;  1TUR A;  5FUX A;  1UHA A;  2E5R A;  2N52 A;  3QWP A;  1MJB A;  4UXH A;  1TIH A;  1FYB A;  2JZM A;  1IY6 A;  1ULK A;  2ENN A;  3TO9 A;  3OXG A;  1MJ9 A;  1SGN I;  1UVG A;  1Y1B A;  4MPI A;  1R79 A;  1CT4 I;  1KBF A;  2JXD A;  3VDU A;  2SGD I;  2JA1 A;  4HGU A;  1YU6 C;  3BJI A;  2ORV A;  1W3S A;  1ULM A;  3VE5 A;  5DAE A;  1OMU A;  4DNC A;  1SGQ I;  5HI7 A;  1FY7 A;  2NU1 I;  4UXJ A;  3R5A A;  3TO7 A;  5E3R A;  1NXU A;  4SGB I;  2L7X A;  5E3Q A;  5HQ8 A;  4AML A;  7WGA A;  1SGE I;  3R5D A;  2BUS A;  5FUW A;  1K7T A;  1X74 A;  2CWG A;  4OVO A;  1HJA I;  2J9R A;  2FNF X;  1XBT A;  2WVJ A;  3UEJ A;  1CHO I;  2LB7 A;  4JCV E;  1XA6 A;  1K7U A;  4E1R A;  1VDD A;  2YUU A;  2JYY A;  3QTL D;  2SGP I;  4E1P A;  3GOX A;  2F3C I;  1FAQ A;  1Z7K B;  1AN1 I;  2GVI A;  5FUV A;  1DS3 I;  4A24 A;  2QQ0 A;  3B4V C;  1LR8 A;  2QQC A;  1TBR R;  3KY9 A;  3R5B A;  1FAR A;  1HEV A;  1CT0 I;  2WCY A;  5EX0 A;  2CWF A;  2ARP F; 
#chains in the Genus database with same CATH homology
 3E2I A;  2QQD A;  1CGI I;  2NU0 I;  4L9M A;  2OD1 A;  1UUC A;  3SEK C;  1TBN A;  2YQP A;  2L8E A;  2GKV A;  2ROW A;  2KCX A;  1TOT A;  1Y8F A;  1HDL A;  3HH2 C;  4UXI A;  1TGS I;  2LUY A;  2ERW A;  2QPO A;  2KMQ A;  2GKR I;  1NUB A;  1OVO A;  3RU0 A;  5CCM A;  1TBQ R;  1SGD I;  3TJQ A;  3SGQ I;  3CXL A;  1M8C A;  2ORW A;  2ENZ A;  2K9H A;  1X4S A;  2W0T A;  3UEY A;  3UGD A;  3UGI A;  1V1H A;  1DS2 I;  2SGE I;  2VRW B;  2ELI A;  3FC3 A;  5FUY A;  5JHW C;  1TBO A;  1HPT A;  2NU2 I;  3SGB I;  5CCL A;  3OXL A;  1RFH A;  1CT2 I;  1PCE A;  1R0R I;  2V53 A;  1PTQ A;  4FKD A;  3OL0 A;  3PDN A;  3VDP A;  1CGJ I;  1BUS A;  2N1A B;  2DIP A;  1UVF A;  3E59 A;  2V1C A;  1IY5 A;  2P6A C;  3D00 A;  2KMO A;  3UGL A;  2B8T A;  5EX3 A;  3OVO A;  1MT1 A;  2OVO A;  3MEK A;  2B0U C;  1KBE A;  4GI3 C;  1U5K A;  1Y1C A;  2DB6 A;  2A20 A;  2KMP A;  1W4R A;  1LR7 A;  1TUS A;  1SGR I;  2E73 A;  2NU3 I;  1PJU A;  2V1C C;  1YTP A;  2QQE A;  1FAQ A;  2NU4 I;  2SGF I;  1CSO I;  1LR9 A;  1N13 A;  1OMT A;  1BMO A;  1IW4 A;  3OXF A;  1V1I A;  1CE3 A;  2XRC A;  2KMR A;  2N71 A;  2UZ3 A;  1SGP I;  2CJS C;  2N17 A;  1M8B A;  2SGQ I;  2ODD A;  2LEO A;  1PTR A;  1XX6 A;  4B6D A;  1H0Z A;  1SGY I;  1KMA A;  1PPF I;  2J87 A;  3UFF A;  1OYV I;  2JW6 A;  2GKT I;  1TUR A;  5FUX A;  2E5R A;  2N52 A;  3QWP A;  4UXH A;  1FYB A;  1TIH A;  2JZM A;  1IY6 A;  2ENN A;  3OXG A;  1SGN I;  1UVG A;  1Y1B A;  1R79 A;  1CT4 I;  1KBF A;  2JXD A;  3VDU A;  2SGD I;  2JA1 A;  4HGU A;  1YU6 C;  3BJI A;  2ORV A;  1W3S A;  3VE5 A;  5DAE A;  1OMU A;  1SGQ I;  5HI7 A;  2NU1 I;  4UXJ A;  4SGB I;  2L7X A;  5HQ8 A;  1SGE I;  5FUW A;  2BUS A;  1X74 A;  4OVO A;  1HJA I;  2J9R A;  2FNF X;  1XBT A;  2WVJ A;  3UEJ A;  1CHO I;  4JCV E;  1XA6 A;  4E1R A;  1VDD A;  2YUU A;  2JYY A;  3QTL D;  2SGP I;  4E1P A;  3GOX A;  2F3C I;  1Z7K B;  1AN1 I;  2GVI A;  5FUV A;  1DS3 I;  4A24 A;  2QQ0 A;  3B4V C;  1LR8 A;  2QQC A;  1TBR R;  3KY9 A;  1FAR A;  1CT0 I;  2WCY A;  5EX0 A;  2M5X A;  2ARP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...