1Y1BA

Solution structure of anemonia elastase inhibitor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
48
structure length
48
Chain Sequence
KPDCPLICTMQYDPVCGSDGITYGNACMLLGASCRSDTPIELVHKGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase inhibitor
publication title Structural and Functional Study of an Anemonia Elastase Inhibitor, a "Nonclassical" Kazal-Type Inhibitor from Anemonia sulcata
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 8
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y1bA00
1CT0I 4GI3C 1UVGA 2SGPI 1Z7KB 2B0UC 2BUSA 2JYYA 2ERWA 1YTPA 1KMAA 1SGPI 2SGDI 5JHWC 2JXDA 1PCEA 4OVOA 1M8CA 1CHOI 1TBQR 1TGSI 1SGQI 2NU3I 1CT4I 1IY6A 2XRCA 1M8BA 2NU0I 1SGYI 3SEKC 2QQDA 2NU4I 1H0ZA 2KMRA 1IW4A 1HDLA 1LR9A 2WCYA 1SGDI 1LR8A 2JZMA 1OYVI 1TURA 2LEOA 1CSOI 2V53A 1TIHA 3QTLD 2QQCA 4SGBI 1PJUA 1TUSA 1BUSA 2KMOA 1UUCA 1SGRI 2SGQI 1LR7A 1BMOA 1Y1CA 2KMQA 1UVFA 2F3CI 2SGFI 1OMUA 1PPFI 1TBRR 2KCXA 3TJQA 1SGNI 1DS2I 4HGUA 1HJAI 2GKTI 1SGEI 5DAEA 1AN1I 3SGQI 1NUBA 2KMPA 1YU6C 1OMTA 1CGJI 1CE3A 1CGII 1DS3I 1IY5A 2ARPF 2OVOA 3HH2C 1FYBA 1R0RI 2SGEI 2NU1I 2NU2I 2P6AC 3SGBI 2GKVA 3B4VC 1CT2I 2N17A 2N71A 1MT1A 1OVOA 2N52A 2GKRI 1Y1BA 2M5XA 1HPTA 3OVOA 1N13A
chains in the Genus database with same CATH superfamily
2E73A 1CT0I 4E1RA 4GI3C 2RC4A 1MJBA 1UVGA 4FKDA 2ENNA 2SGPI 1PTQA 1Z7KB 2B0UC 2BUSA 3TOBA 3QAHA 2JYYA 2ERWA 1YTPA 1KMAA 2QQEA 3OXGA 3QWPA 3E2IA 1SGPI 3UEJA 3VE5A 1XX6A 2SGDI 2RIJA 5JHWC 2E5RA 2JXDA 2OU2A 4UXJA 5FUWA 4UXIA 5CCLA 4L9MA 1PCEA 3TO9A 1Z2IA 2ELIA 1VDDA 4OVOA 1CHOI 1M8CA 1MJAA 1X74A 1W4RA 3D00A 1TBQR 3FSXA 4UXHA 1TGSI 2J87A 1SGQI 2N1AB 5FUVA 1CT4I 1TBOA 2NU3I 3UFFA 2ORWA 1IY6A 2X52A 1WKXA 2XRCA 3R5DA 1M8BA 2CWHA 2DIPA 2NU0I 3UGIA 3GOXA 3UGLA 1SGYI 1ULKA 3OXLA 3SEKC 2QQDA 1IY5A 2NU4I 2YUUA 1H0ZA 2KMRA 2OZUA 1IW4A 2LUYA 1HDLA 1LR9A 2Y0MA 3BJIA 3UOEA 2WCYA 4A24A 1WTJA 1SGDI 2GIVA 1FARA 1LR8A 1MJ9A 3FC3A 2JZMA 1W3SA 1ULMA 3OL0A 1OYVI 3R5BA 1XA6A 1TURA 2LEOA 1CSOI 2V53A 1TIHA 3MEKA 2W0TA 3QTLD 2QQCA 4SGBI 2WVJA 3R5CA 1PJUA 1R79A 2GVIA 2JA1A 1TUSA 1BUSA 2KMOA 1UUCA 1SGRI 2SGQI 5CCMA 1LR7A 1BMOA 3UEYA 2YQPA 1Y1CA 1TOTA 2PQ8A 1K7UA 2KMQA 1UVFA 2F3CI 1FAQA 1X4SA 4B6DA 2SGFI 1OMUA 2V1CC 3E59A 1PPFI 1TBRR 1XBTA 2KCXA 1SGNI 2J9RA 2OD1A 2QQ0A 2ENZA 3TJQA 5J8FA 1DS2I 1Q9BA 2ROWA 4HGUA 9WGAA 1HJAI 2GKTI 5E3PA 5FUXA 4AMLA 1KBFA 1SGEI 1U5KA 5HI7A 5DAEA 5E3RA 5HQ8A 1KBEA 1AN1I 2ODDA 3PDNA 3SGQI 1NUBA 2KMPA 1YU6C 2DB6A 1P9ZA 1OMTA 3FSYA 1CGJI 1FY7A 1V1IA 2VRWB 1CE3A 5EX0A 1CGII 2UVOA 1DS3I 1TBNA 1UHAA 1V1HA 2ARPF 2FNFX 2LB7A 2OVOA 2UZ3A 3HH2C 1P9GA 5FUYA 3TO7A 3VDUA 1PTRA 2ORVA 4JCVE 1FYBA 1R0RI 5E3QA 2SGEI 3OXFA 2NU1I 1Y8FA 3VDPA 2NU2I 3TOAA 2CWGA 2L7XA 4WP4A 1WGTA 3R5AA 1WGCA 1S20A 2P6AC 1K7VA 3SGBI 2GKVA 3KY9A 2A20A 3B4VC 2B8TA 3TO6A 2QPOA 1CT2I 7WGAA 2WGCA 2N17A 1NXUA 1RFHA 1HEVA 1ULNA 2CWFA 4DNCA 3UGDA 4E1PA 1K7TA 4MPIA 2N71A 2X3TA 1MT1A 1OVOA 2N52A 2GKRI 3CXLA 2CJSC 1Y1BA 2L8EA 3RU0A 2K9HA 2JW6A 5EX3A 2M5XA 1HPTA 3OVOA 1N13A 5J8CA 2V1CA 2DKVA
chains in the Genus database with same CATH topology
2E73A 1CT0I 4E1RA 4GI3C 1UVGA 4FKDA 2ENNA 2SGPI 1PTQA 1Z7KB 2B0UC 2BUSA 2JYYA 2ERWA 1YTPA 1KMAA 2QQEA 3OXGA 3QWPA 3E2IA 1SGPI 3UEJA 3VE5A 1XX6A 2SGDI 5JHWC 2E5RA 2JXDA 5CCLA 4UXJA 5FUWA 4UXIA 4L9MA 1PCEA 2ELIA 1VDDA 4OVOA 1M8CA 1CHOI 1X74A 1W4RA 3D00A 1TBQR 4UXHA 1TGSI 2J87A 1SGQI 2N1AB 5FUVA 1CT4I 1TBOA 2NU3I 3UFFA 2ORWA 1IY6A 2XRCA 1M8BA 2NU0I 2DIPA 3GOXA 3UGIA 3UGLA 1SGYI 3SEKC 3OXLA 2QQDA 2NU4I 2YUUA 1H0ZA 2KMRA 1IW4A 2LUYA 1HDLA 1LR9A 3BJIA 2WCYA 4A24A 1SGDI 1FARA 1LR8A 3FC3A 2JZMA 1W3SA 3OL0A 1OYVI 1XA6A 1TURA 2LEOA 1CSOI 2V53A 1TIHA 3MEKA 2W0TA 3QTLD 2QQCA 4SGBI 2WVJA 1PJUA 1R79A 2GVIA 2JA1A 1TUSA 1BUSA 2KMOA 1UUCA 1SGRI 2SGQI 5CCMA 1LR7A 1BMOA 3UEYA 2YQPA 1Y1CA 1TOTA 2KMQA 1UVFA 2F3CI 1FAQA 1X4SA 4B6DA 2SGFI 1OMUA 2V1CC 3E59A 1PPFI 1TBRR 1XBTA 2KCXA 1SGNI 2J9RA 2OD1A 2QQ0A 2ENZA 3TJQA 1DS2I 2ROWA 4HGUA 1HJAI 2GKTI 5FUXA 1KBFA 1SGEI 1U5KA 5HI7A 5DAEA 5HQ8A 1KBEA 1AN1I 2ODDA 3PDNA 3SGQI 1NUBA 2KMPA 1YU6C 2DB6A 1OMTA 1CGJI 2VRWB 1V1IA 1CE3A 5EX0A 1CGII 1DS3I 1TBNA 2ARPF 1V1HA 2FNFX 2OVOA 5FUYA 2UZ3A 3HH2C 1IY5A 3VDUA 1PTRA 2ORVA 4JCVE 1FYBA 1R0RI 2SGEI 3OXFA 2NU1I 1Y8FA 3VDPA 2NU2I 2L7XA 2P6AC 3SGBI 2GKVA 3KY9A 2A20A 3B4VC 2B8TA 2QPOA 1CT2I 2N17A 1RFHA 4E1PA 3UGDA 2N71A 1MT1A 1OVOA 2N52A 2GKRI 3CXLA 2CJSC 1Y1BA 2L8EA 3RU0A 2K9HA 2JW6A 5EX3A 2M5XA 1HPTA 3OVOA 1N13A 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT0 I;  4GI3 C;  1UVG A;  2SGP I;  1Z7K B;  2B0U C;  2BUS A;  2JYY A;  2ERW A;  1YTP A;  1KMA A;  1SGP I;  2SGD I;  5JHW C;  2JXD A;  1PCE A;  4OVO A;  1M8C A;  1CHO I;  1TBQ R;  1TGS I;  1SGQ I;  2NU3 I;  1CT4 I;  1IY6 A;  2XRC A;  1M8B A;  2NU0 I;  1SGY I;  3SEK C;  2QQD A;  2NU4 I;  1H0Z A;  2KMR A;  1IW4 A;  1HDL A;  1LR9 A;  2WCY A;  1SGD I;  1LR8 A;  2JZM A;  1OYV I;  1TUR A;  2LEO A;  1CSO I;  2V53 A;  1TIH A;  3QTL D;  2QQC A;  4SGB I;  1PJU A;  1TUS A;  1BUS A;  2KMO A;  1UUC A;  1SGR I;  2SGQ I;  1LR7 A;  1BMO A;  1Y1C A;  2KMQ A;  1UVF A;  2F3C I;  2SGF I;  1OMU A;  1PPF I;  1TBR R;  2KCX A;  3TJQ A;  1SGN I;  1DS2 I;  4HGU A;  1HJA I;  2GKT I;  1SGE I;  5DAE A;  1AN1 I;  3SGQ I;  1NUB A;  2KMP A;  1YU6 C;  1OMT A;  1CGJ I;  1CE3 A;  1CGI I;  1DS3 I;  1IY5 A;  2ARP F;  2OVO A;  3HH2 C;  1FYB A;  1R0R I;  2SGE I;  2NU1 I;  2NU2 I;  2P6A C;  3SGB I;  2GKV A;  3B4V C;  1CT2 I;  2N17 A;  2N71 A;  1MT1 A;  1OVO A;  2N52 A;  2GKR I;  1Y1B A;  2M5X A;  1HPT A;  3OVO A;  1N13 A; 
#chains in the Genus database with same CATH topology
 2E73 A;  1CT0 I;  4E1R A;  4GI3 C;  2RC4 A;  1MJB A;  1UVG A;  4FKD A;  2ENN A;  2SGP I;  1PTQ A;  1Z7K B;  2B0U C;  2BUS A;  3TOB A;  3QAH A;  2JYY A;  2ERW A;  1YTP A;  1KMA A;  2QQE A;  3OXG A;  3QWP A;  3E2I A;  1SGP I;  3UEJ A;  3VE5 A;  1XX6 A;  2SGD I;  2RIJ A;  5JHW C;  2E5R A;  2JXD A;  2OU2 A;  4UXJ A;  5FUW A;  4UXI A;  5CCL A;  4L9M A;  1PCE A;  3TO9 A;  1Z2I A;  2ELI A;  1VDD A;  4OVO A;  1CHO I;  1M8C A;  1MJA A;  1X74 A;  1W4R A;  3D00 A;  1TBQ R;  3FSX A;  4UXH A;  1TGS I;  2J87 A;  1SGQ I;  2N1A B;  5FUV A;  1CT4 I;  1TBO A;  2NU3 I;  3UFF A;  2ORW A;  1IY6 A;  2X52 A;  1WKX A;  2XRC A;  3R5D A;  1M8B A;  2CWH A;  2DIP A;  2NU0 I;  3UGI A;  3GOX A;  3UGL A;  1SGY I;  1ULK A;  3OXL A;  3SEK C;  2QQD A;  1IY5 A;  2NU4 I;  2YUU A;  1H0Z A;  2KMR A;  2OZU A;  1IW4 A;  2LUY A;  1HDL A;  1LR9 A;  2Y0M A;  3BJI A;  3UOE A;  2WCY A;  4A24 A;  1WTJ A;  1SGD I;  2GIV A;  1FAR A;  1LR8 A;  1MJ9 A;  3FC3 A;  2JZM A;  1W3S A;  1ULM A;  3OL0 A;  1OYV I;  3R5B A;  1XA6 A;  1TUR A;  2LEO A;  1CSO I;  2V53 A;  1TIH A;  3MEK A;  2W0T A;  3QTL D;  2QQC A;  4SGB I;  2WVJ A;  3R5C A;  1PJU A;  1R79 A;  2GVI A;  2JA1 A;  1TUS A;  1BUS A;  2KMO A;  1UUC A;  1SGR I;  2SGQ I;  5CCM A;  1LR7 A;  1BMO A;  3UEY A;  2YQP A;  1Y1C A;  1TOT A;  2PQ8 A;  1K7U A;  2KMQ A;  1UVF A;  2F3C I;  1FAQ A;  1X4S A;  4B6D A;  2SGF I;  1OMU A;  2V1C C;  3E59 A;  1PPF I;  1TBR R;  1XBT A;  2KCX A;  1SGN I;  2J9R A;  2OD1 A;  2QQ0 A;  2ENZ A;  3TJQ A;  5J8F A;  1DS2 I;  1Q9B A;  2ROW A;  4HGU A;  9WGA A;  1HJA I;  2GKT I;  5E3P A;  5FUX A;  4AML A;  1KBF A;  1SGE I;  1U5K A;  5HI7 A;  5DAE A;  5E3R A;  5HQ8 A;  1KBE A;  1AN1 I;  2ODD A;  3PDN A;  3SGQ I;  1NUB A;  2KMP A;  1YU6 C;  2DB6 A;  1P9Z A;  1OMT A;  3FSY A;  1CGJ I;  1FY7 A;  1V1I A;  2VRW B;  1CE3 A;  5EX0 A;  1CGI I;  2UVO A;  1DS3 I;  1TBN A;  1UHA A;  1V1H A;  2ARP F;  2FNF X;  2LB7 A;  2OVO A;  2UZ3 A;  3HH2 C;  1P9G A;  5FUY A;  3TO7 A;  3VDU A;  1PTR A;  2ORV A;  4JCV E;  1FYB A;  1R0R I;  5E3Q A;  2SGE I;  3OXF A;  2NU1 I;  1Y8F A;  3VDP A;  2NU2 I;  3TOA A;  2CWG A;  2L7X A;  4WP4 A;  1WGT A;  3R5A A;  1WGC A;  1S20 A;  2P6A C;  1K7V A;  3SGB I;  2GKV A;  3KY9 A;  2A20 A;  3B4V C;  2B8T A;  3TO6 A;  2QPO A;  1CT2 I;  7WGA A;  2WGC A;  2N17 A;  1NXU A;  1RFH A;  1HEV A;  1ULN A;  2CWF A;  4DNC A;  3UGD A;  4E1P A;  1K7T A;  4MPI A;  2N71 A;  2X3T A;  1MT1 A;  1OVO A;  2N52 A;  2GKR I;  3CXL A;  2CJS C;  1Y1B A;  2L8E A;  3RU0 A;  2K9H A;  2JW6 A;  5EX3 A;  2M5X A;  1HPT A;  3OVO A;  1N13 A;  5J8C A;  2V1C A;  2DKV A; 
#chains in the Genus database with same CATH homology
 2E73 A;  1CT0 I;  4E1R A;  4GI3 C;  1UVG A;  4FKD A;  2ENN A;  2SGP I;  1PTQ A;  1Z7K B;  2B0U C;  2BUS A;  2JYY A;  2ERW A;  1YTP A;  1KMA A;  2QQE A;  3OXG A;  3QWP A;  3E2I A;  1SGP I;  3UEJ A;  3VE5 A;  1XX6 A;  2SGD I;  5JHW C;  2E5R A;  2JXD A;  5CCL A;  4UXJ A;  5FUW A;  4UXI A;  4L9M A;  1PCE A;  2ELI A;  1VDD A;  4OVO A;  1M8C A;  1CHO I;  1X74 A;  1W4R A;  3D00 A;  1TBQ R;  4UXH A;  1TGS I;  2J87 A;  1SGQ I;  2N1A B;  5FUV A;  1CT4 I;  1TBO A;  2NU3 I;  3UFF A;  2ORW A;  1IY6 A;  2XRC A;  1M8B A;  2NU0 I;  2DIP A;  3GOX A;  3UGI A;  3UGL A;  1SGY I;  3SEK C;  3OXL A;  2QQD A;  2NU4 I;  2YUU A;  1H0Z A;  2KMR A;  1IW4 A;  2LUY A;  1HDL A;  1LR9 A;  3BJI A;  2WCY A;  4A24 A;  1SGD I;  1FAR A;  1LR8 A;  3FC3 A;  2JZM A;  1W3S A;  3OL0 A;  1OYV I;  1XA6 A;  1TUR A;  2LEO A;  1CSO I;  2V53 A;  1TIH A;  3MEK A;  2W0T A;  3QTL D;  2QQC A;  4SGB I;  2WVJ A;  1PJU A;  1R79 A;  2GVI A;  2JA1 A;  1TUS A;  1BUS A;  2KMO A;  1UUC A;  1SGR I;  2SGQ I;  5CCM A;  1LR7 A;  1BMO A;  3UEY A;  2YQP A;  1Y1C A;  1TOT A;  2KMQ A;  1UVF A;  2F3C I;  1FAQ A;  1X4S A;  4B6D A;  2SGF I;  1OMU A;  2V1C C;  3E59 A;  1PPF I;  1TBR R;  1XBT A;  2KCX A;  1SGN I;  2J9R A;  2OD1 A;  2QQ0 A;  2ENZ A;  3TJQ A;  1DS2 I;  2ROW A;  4HGU A;  1HJA I;  2GKT I;  5FUX A;  1KBF A;  1SGE I;  1U5K A;  5HI7 A;  5DAE A;  5HQ8 A;  1KBE A;  1AN1 I;  2ODD A;  3PDN A;  3SGQ I;  1NUB A;  2KMP A;  1YU6 C;  2DB6 A;  1OMT A;  1CGJ I;  2VRW B;  1V1I A;  1CE3 A;  5EX0 A;  1CGI I;  1DS3 I;  1TBN A;  2ARP F;  1V1H A;  2FNF X;  2OVO A;  5FUY A;  2UZ3 A;  3HH2 C;  1IY5 A;  3VDU A;  1PTR A;  2ORV A;  4JCV E;  1FYB A;  1R0R I;  2SGE I;  3OXF A;  2NU1 I;  1Y8F A;  3VDP A;  2NU2 I;  2L7X A;  2P6A C;  3SGB I;  2GKV A;  3KY9 A;  2A20 A;  3B4V C;  2B8T A;  2QPO A;  1CT2 I;  2N17 A;  1RFH A;  4E1P A;  3UGD A;  2N71 A;  1MT1 A;  1OVO A;  2N52 A;  2GKR I;  3CXL A;  2CJS C;  1Y1B A;  2L8E A;  3RU0 A;  2K9H A;  2JW6 A;  5EX3 A;  2M5X A;  1HPT A;  3OVO A;  1N13 A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...