1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esa1 protein
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
1YVOA 2B5GA 5CLSA 4EQQA 2R3SA 1J0RA 3KFWX 3DQVC 3CUQB 4AWXB 3LA7A 2CYYA 2I79A 4HLYA 5K5QA 5IT9K 3FF5A 2K86A 1ZRCA 2MC3A 4L9NA 4KFCA 2Z10A 2MD5A 1O3TA 4ZBGA 3KZYA 4XLNF 1EH7A 4KN4X 3E6CC 4FT8A 3E3VA 5HS7A 4L9TA 5CVIA 2E7WA 2IL4A 1R22A 1YLEA 4I0BA 2QECA 2EFOA 1WWZA 5CNPA 2QYOA 2XGXA 1V3FA 3W6XA 2QMLA 1FBQA 2IA0A 2D1HA 2K4JA 4I7HA 1GHCA 2F5DA 5EBVA 2EFNA 2LNBA 1XCVA 2VODA 2ESNA 3LD2A 5FB2A 4GO1A 2ISZA 3I4PA 2PBIA 2FA5A 3GXOA 3RPQA 5LEKA 1XMTA 5HOOA 5E1ZB 5HLIA 5HMNA 5J8CA 4RB0A 3SXNA 1SFXA 2L54A 3QPTA 2JRTA 1XSVA 1W5TA 3K69A 4KA4A 3MGDA 1BIAA 4OIQF 1XCBA 1DUXC 1MKMA 2OZGA 1CGPA 4ESFA 2HKOA 5F47A 3WODF 3ZMZA 3RKYA 5D8LB 4F0YA 3H3ZA 1LB2A 3WR7A 1HQCA 2HTJA 5HS9A 5CVRA 4WF2A 2F5EA 4PV6A 1A04A 3ABUA 1KYWA 5D4RA 2NMTA 5ICEA 3F0AA 2YU3A 4ENJA 1R5GA 3ZJ0A 2IA1A 3E5QA 4RAYA 2B3VA 4M85A 2YR2A 1T6SA 1FPQA 5F49A 2IW5A 3PGPA 3DEUA 3HUGA 4O6JA 3T90A 2ELHA 1WI9A 2IT0A 1XGMA 4I01A 1W4MA 1SAXA 3DFGA 3VOEA 1KZFA 1QNTA 3DDDA 1HKQA 2YX7A 3TDZC 2D45A 1XN7A 1QZYA 4EGYA 2HYFA 4KORA 2D1VA 3WU1B 5ILVA 4P5OA 1ZG1A 5D8KB 1RZ4A 1ZRFA 1J7KA 1LDDA 2V1DA 3BJAA 2W85A 3IWGA 5ISVA 4UVBA 2JDDA 2Z33A 1IB1E 4FD5A 4H6ZA 3SHFA 2XAHA 2WWYA 1KU3A 5H20A 1REPC 3MZHA 2FE7A 1F4KA 4U9ZA 4A5NA 3K1NA 5CVJA 2VC0A 3TGNA 4ZH4F 1I12A 1BO4A 4PK3A 3W6SA 2PR1A 2NAZA 3GFLA 1P4AA 2LF7A 3R96A 4HLXA 3TKYA 3ZPLA 2DK5A 2XUBA 1WQ2A 5DCMB 2KCWA 3V7RA 2VT3A 3BOQA 4NB5A 4S05A 3PQJA 2J5OA 4CDGA 3HRUA 3F23A 3FWEA 4B5PA 2UXXA 2D4OA 1IAWA 3FX3A 1XF8A 4MHDA 4XLPF 1C0WA 3SFZA 1P6RA 1PDNC 5JI6A 3EYYA 1S6LA 1S7OA 1W7PD 4BYYA 3I5UA 1UB9A 2WC2A 4ESJA 3R61A 1J2XA 2ARHA 2KKOA 4YRHA 1YG2A 3L00A 1O3SA 4AIHA 1ZHFA 3R95A 1MJ9A 1ZAOA 5TJJA 4FD4A 5ED4A 5DYMA 2EA4A 2V1XA 2ZW4A 4OMYA 2Z99A 2XRNA 3GFIA 5HLHA 1S3ZA 1IN6A 4XRFA 5HLGA 1WK4A 3BDDA 1P4NA 3FM3A 3QU3A 3RYOA 1QSMA 4KICA 1BI2A 1M4GA 2Q04A 3GWZA 2XV4S 1K78B 2VN2A 2JPBA 3M9AA 1Q2DA 4KIGA 2JPCA 2FRHA 1TQIA 4B8XA 5D6FA 3LAPA 1F1ZA 2JSCA 1UFMA 3RYRA 2W57A 5JHUA 2B58A 2BBYA 2COMA 2F5CA 3F72A 1QSOA 3EFAA 1LNWA 4HNXB 3T8RA 2JZYA 3EDPA 5CYVA 4HOBA 5FLXK 4MY3A 2A5YB 2DU9A 4KOTA 3QOPA 1AOYA 1Y7RA 3VFZA 2PDOA 4R57A 4M6YA 4IUSA 3J81K 1ZLKA 3S6FA 4IHTA 3B8GA 2ZW7A 1HSJA 1U6GA 3NQOA 3GVAA 3JSOA 3BWGA 3IRRA 1SD5A 3U9GA 1M1DA 3D3SA 1YK3A 3CTAA 1L3LA 3F3XA 3TE4A 2DQLA 1UHWA 4FX0A 3Q5FA 1KU9A 3AAFA 3MEXA 5LGTA 3HOTA 4LD5A 2FOKA 4P9UA 1SMTA 4HF2A 4L89A 2GXGA 1RUNA 4HZFA 4B09A 3SXOA 1V0CA 5FD6A 3QP6A 3E0KA 3FMSA 2MH9A 4PCQA 1Z7UA 2OQGA 2ZJ2A 1OZPA 2AJ6A 2M5WA 4QB9A 2D2WA 1LRZA 2OA4A 5F46A 1YVKA 1ZGAA 3S6KA 4QWQA 2ZMEB 1SFUA 3I9SA 4IRGA 2AS5F 2DPDA 4L5JA 4HQMA 4Y49C 2RN7A 4RS8A 1XSDA 6PAXA 1B4AA 5AIPA 3I71A 2VXZA 1BI1A 1SD6A 3T5XA 1M4IA 4MGRA 2O3FA 1FZPB 2KIUA 4YFJA 3GO5A 1W7PA 2VZYA 5FLXZ 2R8VA 3OV8A 2V9VA 4LG0A 1RI7A 4CAVA 4LJZF 4A0ZA 3R4KA 1XB4A 1BN5A 2O8XA 4JBAA 2K7LA 2BV6A 3J81Z 2P0WA 1QSRA 1Q1HA 3FYNA 2GXBA 3GY9A 2A6EF 2P5VA 4UUVA 2XAGA 2NNNA 1XD7A 3LSTA 1ZYRF 2EJRA 2BL1A 1OKRA 1R36A 3C3WA 3DNSA 4YFNF 2C27A 5KVRA 1MDMB 2DLLA 2OZHA 2M87A 2M45A 4KIBA 2KRFA 4BNCA 2HOEA 5KTCA 3HYIA 4UWJA 3C18A 1TIQA 3IGRA 4RB3C 3KP7A 1HW2A 3TCVA 3KP2A 5DEQA 1ZH5A 2BSWA 2K27A 1FYMA 2HGCA 1H9GA 1J5YA 4DNCA 2B4DA 4EJWA 3L2CA 1Z4EA 2STWA 2XAFA 2RKHA 4NSQA 2P4WA 3ZN0A 3RKXA 3K9UA 5IV0A 4A0XA 5ERIA 4CYDA 2FBIA 1USSA 2KJCA 2GWRA 3L09A 2LKPA 4BHPA 2ISYA 1BJAA 3IHUA 4BXUA 4XPDB 4M3SA 4KLVA 4CO8A 4KUAA 1G6NA 1X3UA 3J80Z 2O61A 2P6FA 2FQ3A 1M44A 3FM5A 3B02A 3CXPA 2Z5UA 1NSLA 1GXPA 3R0JA 1L0OC 4KOXA 1YTYA 4CRYB 3R9GA 2Q2EA 5L3EA 3F6VA 3W6KB 3ZMUA 2CNSA 3GUDA 4U5YA 3EUHA 4EJOA 2VOOA 3GFMA 1FLIA 4KOSA 4LMYA 4UXNA 1QBJA 1VTNC 2QENA 1FSEA 3REOA 3WGGA 1XIXA 4KOWA 1I21A 1UFHA 5BPDA 4IXAA 3RIRA 2VQYA 3TDUC 4LFUA 2P5KA 3KEOA 1R1VA 2FEZA 3KZZA 2EVNA 1EH8A 3BJOA 1R23A 1YIOA 2DW4A 4M9XA 1N71A 2A3SA 2EV6A 2LSOA 3KP3A 4EGZA 4KZTA 1QQIA 1KU7A 5JR3A 2HKXA 5IX3A 4OIRF 1JE8A 1G3TA 2ZO4A 5DWMA 4ASNA 1S60A 4PSXA 4ZYDA 2G3AA 4LUAA 3E6MA 5L3DA 1FY7A 4OIOF 1IYKA 3P9CA 2MH2A 2O28A 5ILUA 2OAZA 3KP4A 3ZMDA 3FMQA 2B4BA 2KIMA 2BEIA 1Y0UA 5FO5A 3TFYA 4Q47A 3PFIA 1ZN2A 3WGIA 3TOBA 2FXAA 3R6SA 4EJUA 2MA3A 1KUVA 2ZFWA 3WE3A 1OYIA 4ON0A 2JLMA 3HIFA 4HF1A 5HDGA 3C1DA 4UVCA 5JQ4A 2VBZA 4K30A 3D5LA 5ICFA 2Z3YA 1FP2A 2EV0A 3LAJA 3IWFA 5IB0A 3GZ6A 3UY5A 5DD8A 2XKOA 4WXCA 2HZTA 2UXNA 1T39A 3HTSB 3G73A 1ZG5A 4HA8A 2XKPA 3JW4A 1T38A 1KUYA 4R1HA 1E2XA 5C88A 2QQAA 1RO5A 3I58A 2W24A 4L9VA 1O3RA 2IPQX 2Z9OA 2P6TA 2RDPA 4UHTA 4UV8A 3KKWA 1YW7A 3WTTC 2ZKZA 1IXCA 2VT2A 3JAMK 4MY0A 1FP1D 1RNLA 1TNTA 4G94A 1YLFA 4R79A 1MZBA 4N0BA 2QZ8A 2HYGD 3HRMA 4HNWB 3EY5A 2EFPA 3G3ZA 4Y17A 3O6BB 3HRTA 1GXQA 3QU6A 3IL2A 2IJLA 3MWMA 2Q8KA 3IKTA 3Q9VA 4HV5A 2MLGA 3P2FA 2H27A 2EB7A 2RNJA 3BROA 2Y0MA 4EJTA 3JSPA 3CLOA 2PSWA 3BZ6A 1B9MA 3KE2A 4R9MA 2P6SA 3GKRA 2HFHA 4M73A 1XMKA 4QC6A 4I2OA 2BYVE 3E97A 5DDGA 2VEZA 3ELKA 1P92A 3T9YA 1USTA 1M4DA 2ZNYA 3I3GA 4MQVA 3HTUA 3L7WA 2Z0ZA 3M7GA 3ZZIA 4S04A 1BOAA 2PQ8A 1LEAA 2NRAC 4KVXA 2QWWA 2BE5F 5LBQA 2REFA 4ZYHA 2ZBKA 1U5TC 2AE6A 1YX0A 4LLGF 5H84A 4B5PB 4UNOA 3VB2A 2EWNA 4MTEA 4BHCA 3WTXC 1YGHA 3V4GA 3ECOA 5J6XA 3S6HA 2VBXA 4G7ZF 4U0YA 3JAMZ 2M1BA 4JXQA 4UA3A 3LQRA 1P4XA 1PUAA 5IT3A 3CO6C 3PZJA 2FBHA 1TW3A 4OOIA 2J8MA 4BHBA 2OBPA 4F6AA 1SQHA 4HBLA 2CY2A 2QBYA 1K4JA 3J7AO 4KDPA 1TQMA 5D5WB 3KCCA 2H6CA 2FIWA 4BAYA 2FSWA 5E1XA 3ERED 5LLQA 2V79A 1S7NA 1YS6A 2CQKA 4UWIA 4L0ZB 4R87A 1IYLA 5D5UB 2HQYA 4AIJA 4XNHC 3KP5A 2RC4A 2Y48A 2V1UA 1BI3A 1G3YA 3WG9A 4CHUA 5C82A 4LK1F 4HKFA 2RQPA 4XPLA 3S6GA 5E17F 3WTWC 1XSXA 4YFXF 1FYKA 4RAZA 2O0YA 1I1GA 4AG9A 5CVUA 2ADUA 4J3GA 4XPKA 1Z1DA 1LJ9A 2NS0A 3VODA 1B6BA 4YFKF 2QUFA 2YPRA 4RB2C 2E1CA 3I64A 1QSNA 2A69F 1K79A 1FX7A 2L02A 1MGTA 3V8JA 2DBBA 3RDIA 2GZWA 3BPXA 3KEQA 3ECHA 2ZCWA 4E70A 2VXKA 4JWPA 4IHSA 1Y9KA 2Q7BA 4E2AA 3GF2A 2HS5A 3C26A 1J59A 4UV9A 4HV6A 1TQPA 3BJ8A 4PZJA 1LQ1A 2Y75A 1O7LA 4E0AA 1FBSA 2PN6A 4A0YA 3IWZA 1MD0A 5LGNA 3VWEA 3KETA 3HSRA 2B3UA 4QLCU 2R1IA 4GS4A 1O7FA 3R1KA 1P0HA 1V4RA 4KVOE 3ULQB 1IRGA 1KA8A 4AD9A 1Q2YA 4CAWA 4WWCA 1JGSA 1IZ1A 1UHMA 1ZGJA 3H3UA 4I0AA 1STZA 3P2HA 3GYAA 1ONVA 4N9HA 4ZYEA 4H0EA 4KIFA 5L3GA 2HUZA 3QRFF 4RS2A 2ZW6A 3NEUA 2PFBA 2FL4A 2W84A 1FT9A 4JLYA 4Y13A 2J8NA 1QSTA 4ESBA 3I59A 2ZPAA 2W25A 3M8EA 2FCKA 5LHIA 4AVAA 3BJ6A 2F5FA 3LQQA 2ESHA 2HTSA 2WPWA 1B59A 5LEJA 1IICA 3R9FA 3WTYC 4MI4A 1DP7P 3BP8A 2HEOA 1EH6A 1IXRC 4KUBA 1HKSA 2GAUA 3R60A 3E5XA 3H4QA 1QZZA 2PRBA 4EM0B 2O6GE 3P9KA 1R1TA 4LG0B 3TO6A 3LODA 4P96A 3OWCA 4A6EA 4IRHA 3G8WA 1Z05A 2RV8A 2XAJA 2OU2A 1WKMA 1DPUA 5H86A 1IRFA 4HX7A 3U2RA 1OPCA 1PUEE 2P6EA 1I27A 3WU0A 3J80K 4FX4A 3L9FA 2Q0OA 2DQRA 4IVNA 1ZARA 3CO7C 4XBFA 1S8NA 5H6QA 1SD4A 1S5KA 4O5VA 4JXRA 4U7BA 5HVQC 4AVCA 3KLNA 4KMFA 2FXFA 2KJBA 1PU9A 3K2ZA 2PMUA 3B73A 2HDCA 2PJPA 1XGSA 1J75A 2HQRA 3BY6A 1R58A 4AVPA 3G3SA 4WX9A 1HW1A 1I5ZA 4HW0A 5DCFA 2QVOA 2C6YA 1YR0A 4H6UA 4BQAA 2GA1A 2P7VB 5L3FA 4OAEA 1SMYF 3GLXA 2XHKA 3MCZA 5FVJA 4IF5A 5ILSA 2UWMA 1U3EM 3W6JB 2L01A 3DR6A 2DT5A 1O3QA 1S7LA 4IPAA 3SZTA 4HNYB 1U78A 4IJAA 2V6CA 2FT0A 2ZMEA 1S7FA 3V8KA 1CJWA 4JQFA 5J8FA 3R0AA 2FMLA 4PSWA 4RI1A 5KK1A 2L4MA 4R3KA 2JDCA 2HV2A 3U1DA 2OZUA 3SQNA 4CICA 5L3CA 1CF7A 2NNYA 4HX8A 1IN5A 2BEOA 5D4SA 1BBYA 5EEGA 1R1UA 2XROA 3K1MA 4GXOA 2VONA 3FIXA 4RGXA 3GFJA 1HXDA 1B9NA 1NHAA 1TW2A 1G3SA 3FXQA 3RYPA 3V7CA 1BM9A 4Q48A 1BIBA 1JHHA 1G3WA 1ON2A 1E17A 4II9A 1LDJA 4BH9A 1U5TA 4LB5A 1T0FA 3EYIA 2R7DA 1Z4RA 2IA2A 2B5GB 3N7ZA 2TDXA 3MAJA 4M74A 4EM1A 2RVCA 1ZG3A 2XAQA 3V7SA 3IRQA 4G6QA 1WWXA 2YSRA 4KOYA 4A12A 4PGHA 4D0PA 2VE9A 4RGSA 1KYZA 3VWDA 5E18F 2VZZA 1D3YA 1IN4A 2GQQA 2DI3A 5E20A 1J4JA 4EJVA 4CXFA 3LFKA 1IF1A 1LVAA 4OINF 4M9SA 1I1DA 5JVTA 4U88A 4UBRA 2FNPA 4NF1A 4BMHA 2FNAA 3M8FA 1DDNA 4B5OA 4EMSA 2L3DA 1FOKA 5BOXA 5TRDA 1Y9WA 3F22A 2JT1A 3SHPA 2X0LA 3CJNA 3JUWA 3FNCA 4LGWA 5HH1A 1D8KA 2OB0A 1G4DA 4ZZDA 3WTSC 1YW9A 2DTRA 5DUIA 3BLNA 4KOVA 1IUYA 3FHZA 5DV5A 1KQ9A 4A5MA 1SD7A 1J9IA 2P6GA 2FF4A 3GYHX 3HRSA 3LWFA 5BMZA 1U8RA 4F7ZA 4TV7A 4KYWA 1MK4A 2Q44A 2EFQA 4CS0B 4Z2YA 2QQBA 4K2EA 1PP7U 1R00A 3E6BA 3D2PA 3FXUA 3MZYA 4GYGA 2FS5A 1H0MA 3F8NA 2VOPA 1YQAA 1TBXA 3N4MA 3EQLF 4M72A 2VE8A 3FXTA 3CUQA 2DPUA 2CFXA 2G7UA 3TQNA 2EUIA 2EA2A 1RIOH 5A2QZ 2G3TA 1XDUA 4RB1A 2BGCA 3K9TA 4MTDA 2QM3A 2EK5A 3COAC 2E7XA 4PK2A 4PDKA 2DAOA 1U2WA 1NE9A 5F64A 2FE3A 3TOAA 5DD4A 1K6OA 1DPRA 3MQ0A 2CNMA 3GZ5A 4EVIA 3N97A 4G9YA 4G7HF 1CM0A 3NRVA 2H94A 4XSXF 3KP6A 1S29A 1KU2A 5BQTA 4HX4A 1R7JA 3P7NA 4GCVA 1LEBA 4LK0F 5KTAA 2PR8A 1OMIA 3F8MA 4OU0A 3F8CA 4NQWA 2PEXA 3EXNA 2L4AA 3LA2A 4WXHA 3ZMTA 2Q0YA 3BJ7A 4Y49B 2I00A 1D8JA 4MJ8A 4DQ2A 4FD6A 3HHGA 4KOUA 1FC3A 2CSOA 2QBYB 3F8FA 2XASA 5IT9Z 1QGPA 3DSBA 4A2UA 5CJ9A 5LHHA 4L0YB 2EV5A 4ONUA 3ZMSA 3FMRA 1TTYA 2WV0A 2H5MA 1T2KA 1D5VA 3OOPA 4L9JA 1FSHA 4OIPF 1R57A 5E8GA 1PP8F 5K1YA 3DF8A 1IXSB 1O57A 2MLKA 4OADA 3F5BA 2DO7A 4U9YA 1BC7C 5DWNA 1B6AA 3ZN1A 2QLZA 1ZLJA 1FWZA 2GANA 4MEYF 3W91A 2ATRA 1YFHA 1ODDA 1TLHB 1L0CA 1QPMA 2K4BA 1F9NA 4N9IA 2A68F 3QPHA 4NCZA 1OYWA 4XPDC 5FD5A 3JVNA 1XGNA 4HQEA 2E1NA 3T0YA 1UCRA 3EETA 1Q2CA 2H6BA 2R98A 3V8IA 4ZYGA 4E8OA 2CW0F 3JTGA 4RGRA 1IN8A 4R8HA 3C7JA 3ZMVA 3T1BA 5JFRA 4RGUA 4X5KA 3SZPA 2VBQA 2EFWA 2J8RA 4I02A 2ZXJA 1RXTA 2Q4YA 4OMZA 2F5IA 1KQ0A 4CRZB 3K1PA 4Q4ZF 4WXDA 5H6RA 1IN7A 3EO4A 3ML6A 4OLLA 5E8IA 4PGGA 1U6MA 2BUEA 5AIQA 3FBUA 2QIRA 1ON1A 3PQKA 3H92A 3DPLC 4M9ZA 5ICGA 2M30A 2DXQA 2JTVA 4KT5C 1Z9CA 2AXLA 4ENNA 1S3JA 4Q5SF 2PI0A 3SXYA 4XSZF 2CNTA 1I6XA 5HS8A 2H09A 1P4WA 4CZZA 5DCMA 3I59B 4IF4A 2FIAA 2HR3A 5LGUA 1I1SA 3CXQA 1MJBA 3CUQC 4L18B 5DUKA 4JD6A 4A6DA 3FB3A 4JJXA 2CWEA 4KMUX 1WRJA 2ZW5A 4EM2A 4YG2F 1WSUA 1BI0A 3KLOA 4KVME 1NMTA 1OYYA 3QAHA 2B0LA 1BOBA 3O3KA 3F21A 1TNSA 2GA2A 1SFEA 1P2FA 4M71A 4U0VA 2XVCA 3D2MA 2R7FA 5FGMA 1KGSA 2DFIA 3ISPA 4HDUA 1GHEA 3I53A 5F6FA 5HDNA 2ACJA 2K02A 3F8BA 3E6DA 4P55A 3V8LA 4M6XA 1Z9UA 3RKWA 2QQ9A 4QUSA 4ZZLA 4NEXA 3TO9A 2OH1A 5BS6A 1FYLA 4ETSA 3RI4A 4AVBA 4MEXF 3JTHA 4LLLA 3S2WA 4ORFA 4KNYA 2MBFA 3FRMA 2O03A 1Z6TA 4QVTA 1K78A 1LDKB 3EC4A 3F6OA 4HAMA 4G8XA 4ENMA 1BC8C 5K5RA 4WK8F 3NE7A 4YIFA 1FBUA 1W7PB 1YO5C 5HDKA 4LLNA 2PLYA 2P7CB 3WTZA 2P5LC 4NHJA 4YIIA 5I0CA 5K5OA 2IVMA 2FSRA 4LB6B 4H89A 2X4HA 5FFXA 2A4NA 4FHTA 1XDSA 5D5XB 1KUXA 2X7BA 3F8KA 2VBYA 2ZXVA 3T8TA 1H9TA 5F48A 1VKCA 5JPHA 4YGOA 3RJPA 1IW7F 3E5UA 1HBXG 5L3BA 2OZ6A 3ROUA 4KLWA 3QP5A 5E96A 1EV7A 2FMYA 4ENKA 3CXSA 4NXYA 1Z6RA 5D6EA 2WPXA 1YYVA 3WE2A 2B4DB 1XGOA 1OR7A 3IKVA 4KN7X 2A07F 4I98B 5D5VB 2ETHA 2CO5A 3VEPA 3I0TA 2PMHA 3HSFA 1AWCA 2IRFG 5LRSA 2PC1A 1CF7B 4CGZA 4QBJA 2FU4A 2KIFA 2IP2A 4GGGA 3FZVA 1B1BA 2Z11A 3ABTA 4FD7A 2PG4A 2VBWA 3LA3A 1YS7A 1KQ8A 2LDUA 1S7AA 3GX4X 2JEVA 1FNNA 4MBUA 2P8TA 1S7KA 3DPTA 4HF0A 5LRRA 5LHGA 3O2PE 2XIGA 1ZREA 4MNUA 5E1WA 2CG4A 4P9FA 2OQRA 4AB7A 3HOSA 3GW2A 1U5TB 3HSEA 5FFZA 2LF8A 1W5SA 3DV8A 1RUOA 1IIDA 3M1EA 3DR8A 3FXRA 3Q9SA 4MQ9F 2A6HF 3CDHA 3PP9A 4UVAA 3WTUC 2DK8A 1B87A 1HSTA 2G0BA 3GEZA 2CGPA 3TTHA 4JK1X 4LX9A 4G6DA 2Q4VA 4L8AA 2STTA 4EVYA 1XEBA 1K7AA 2R7HA 2VI7A 4U7DA 4GYIA 1JHFA 3RPUA 5EEHA 1HKTA 2ZNZA 4HYEA 1MDMA 1ZRDA 2VC1A 3CUOA 2GE3A 4IRIA 3R9EA 2J5PA 1ON0A 2F2EA 3ZQ7A 3RTRA 3K0LA 2UZKA 2G7HA 4I49A 1T98A 2WTEA 5AONA 1JXSA 4L5IA 4XNHB 4AG7A 2HQNA 4G7OF 2FBKA 1YW8A 3TO7A 5CVVA 4I09A 4WCGA 3WTVC 4AIKA 4O3MA 3WGHA 5A2QK 1XMAA 4MHGA 1GVJA 3D8PA 2A61A 1R5HA 2OD5A 2HWVA 3IC7A 1F5TA 5KTDA 2GIVA 3DKWA 3HHHA 1Z91A 3QB8A 1QO0D 3D0SA 4Y15A 1YREA 5F1RA 5ICCA 3DXJF 2YX4A 2D4PA 2G9WA 1VHSA 2REEA 2M8EA 4KUMA 5GCNA 3ZP5A 4R3LA 2K5TA 4U0WA 3P9IA 5BPIA 4CAXA 1MJAA 3TT2A 1XE4A 3BPVA 5EC4A 3MFKA 3DP7A 3I54A 2RGVA 4HDVA 1ULYA 2NYXA 1HW5A 4EV0A
chains in the Genus database with same CATH superfamily
1YVOA 2B5GA 5CLSA 3CQZJ 4EQQA 2GFQA 2R3SA 1J0RA 3KFWX 3DQVC 2LEOA 3FEDA 3Q0VA 4F92B 3CUQB 3PSFA 4AWXB 1BMOA 4C2TA 3KQXA 3LA7A 3SYTA 2CYYA 2I79A 4HLYA 3TX8A 4E7JA 5K5QA 5IT9K 5AGEA 1SAUA 2K86A 3FF5A 4NUBA 4PJLA 1ZRCA 2MC3A 4L9NA 4A38A 4KFCA 2Z10A 4A3KJ 2DYSH 2MD5A 1O3TA 2OTJI 1LOKA 1YU6C 1R9TJ 1Z67A 3NFZA 4FQGA 3KZYA 4C3JJ 4ZBGA 5KHDA 4B6ZA 3PSIA 1EH7A 4XLNF 2R7WA 1P7JA 2GOMA 3KHXA 4KN4X 3E6CC 3JRFA 2AFWA 4FT8A 3E3VA 5HS7A 4L9TA 3QPSA 5CVIA 3K10A 2E7WA 2IL4A 1R22A 1TBRR 2E34A 2JA2A 3FXMA 3ERMA 3NARA 2N8GA 1YLEA 1WCMJ 4I0BA 1A2ZA 5FKKA 4A32A 2QECA 2EFOA 1WWZA 2JJ7A 5CNPA 1MSEC 2QYOA 2XGXA 5AG4A 1V3FA 3W6XA 2QMLA 1DTDA 1FBQA 2IA0A 2D1HA 2K4JA 4PJJA 1U5KA 5AG6A 1ZQ3P 4B10A 4I7HA 1GHCA 2F5DA 4X6AJ 5EBVA 4LOCA 1B72B 2EFNA 3CCMI 3CZXA 2LNBA 3CZ6A 1XCVA 4NQWB 1HEVA 3QWLA 2VODA 1WVRA 2AQFA 2ESNA 5FB2A 4UXIA 4GO1A 3I56I 4E7IA 3LD2A 1SVOA 2ISZA 1FEXA 3SJGA 4ZYAA 2ZEEA 4MFDA 4N4NB 3I4PA 2PBIA 3PBEA 1NG6A 2FA5A 2LY1A 1K83J 3GXOA 3RPQA 1X2NA 5LEKA 3WG7H 5HOOA 5E1ZB 2ORWA 4GFBA 2W0TA 5HLIA 2XEGA 5CQEA 3MKLA 5J8CA 4RB0A 4MFLA 5HMNA 3GTLJ 5JHWC 3SXNA 1SFXA 2L54A 3QPTA 2JRTA 1XSVA 1W5TA 3K69A 4KA4A 3MGDA 1BIAA 1VF9A 4OIQF 2PJ9A 4CH7A 2J9RA 1XCBA 3OY9A 1DUXC 1ZLIA 1IDYA 1MKMA 2WY8Q 5KCMA 2OZGA 1CGPA 4BKXA 2HKOA 4MFEA 4ESFA 1G2HA 4MHNA 1LR8A 4P6YA 5F47A 3WODF 3ZMZA 5JLXA 3RKYA 2LREA 5D8LB 2XC7A 2EO8A 1CT0I 4A3FJ 3I55I 1IRZA 3H3ZA 1LB2A 4P4JA 3WR7A 4F0YA 1HQCA 2HTJA 5HS9A 1O4XA 3B3CA 1BW6A 2PJRA 3GMEA 1UWYA 5CVRA 2DA2A 2VQCA 4WF2A 2F5EA 1K7UA 4PV6A 1A04A 4UFVA 3ABUA 1KYWA 1TL8A 5D4RA 1SFKA 4DYOA 2NMTA 5ICEA 3F0AA 2NVTJ 3NWSA 2L9VA 2YU3A 4ENJA 2F7VA 3FSXA 2MFZA 1FIPA 1R5GA 2LYCA 2VKHA 3ZJ0A 1UELB 2IA1A 1RR8C 2KLOA 3E5QA 4RAYA 4UXHA 3HOVJ 2B3VA 5HVHA 4M85A 2IGKA 2YR2A 4UCMA 4C2YA 1TGSI 1ULNA 1T6SA 2KRCA 1FPQA 3CF2A 3OYNA 5F49A 2IW5A 3PGPA 4FUUA 4Z65A 1TT0A 3UKGA 1TBNA 1TF9A 2RFHA 3DEWA 3CP2A 3QOEA 2KP6A 4XKCA 3SJEA 3DEUA 3HUGA 4O6JA 3T90A 3OIQA 1APLC 4FTHA 4YWYA 2ELHA 1GLNA 1WI9A 2IT0A 2OPTA 1XGMA 4I01A 3RZOJ 1AMPA 1YLOA 2OF7A 5J1RA 1W4MA 1SAXA 3DFGA 3VOEA 2UUZA 2QKMB 4M3BA 4DBRA 3BR5A 1KZFA 3A0BC 2K9HA 1QNTA 2HQ5A 1HKQA 3S8PA 2QSHX 3DDDA 2RQQA 1LFBA 2YX7A 5DAEA 5GADJ 4OC4A 3TDZC 4YELA 2D45A 3HM5A 1XN7A 1QZYA 4EGYA 3RBUA 2BZTA 2HYFA 1YW4A 2X6XA 2GKVA 2MYSA 4KORA 2D1VA 3A03A 3EUHC 3CCEI 2VPLA 3ASOH 5AG7A 4AXVA 3LSRA 3WU1B 2LBFA 5ILVA 5EG0B 4P5OA 1ZG1A 4BBSJ 4NNJA 4DGWB 4DYRA 4Y52J 4RDUA 1OBRA 2ZOFA 5D8KB 1RZ4A 1ZRFA 1SGPI 4A3LJ 1J7KA 2NU3I 3RO0A 1LDDA 3E2IA 1XBUA 1WHUA 2V1DA 2VASA 3OR2C 1FARA 1V5FA 3KPHA 3BJAA 2NS7A 2KL4A 2W85A 2LY2A 3IWGA 5ISVA 4UVBA 1XPXA 4QTRA 2JDDA 1FMWA 3TMOA 5CPAA 3I4NJ 2Z33A 1IB1E 4FD5A 4H6ZA 1IRXA 3L1PA 3SHFA 2ICWG 3PEIA 2PJ4A 1MH3A 5C44J 3WC5A 2XAHA 2WWYA 1KU3A 5H20A 1REPC 3MZHA 2FE7A 1MMNA 1F4KA 4W9YA 4CSWA 4IHYA 1JJ6C 4A5NA 3K1NA 5CVJA 4U9ZA 2VC0A 3M8JA 3TGNA 4ZH4F 1I12A 2YGWA 3NH4A 2V1NA 1BO4A 2HVRA 4PK3A 3UEYA 5F09A 2GU2A 3W6SA 2PR1A 2NAZA 3GFLA 2CQQA 1P4AA 2DT6A 1H8AC 1AKHB 1FTZA 1K7VA 2PJ7A 2I10A 3FHNA 4FAIA 2LF7A 4KSAA 3R96A 4ZTFA 4HLXA 3TKYA 3ZPLA 2DK5A 2XUBA 3BR3A 3BZCA 1WQ2A 1TC3C 2X48A 1R71A 5DCMB 2PJCA 2KCWA 3V7RA 2VT3A 2FVGA 2YNEA 2E73A 3BOQA 3N05A 4NB5A 3PQJA 4S05A 2Y2ZA 2BOLA 2J5OA 3HRUA 4CDGA 4CUGA 3F23A 1FLIA 3E0JB 3FWEA 3PB4X 4B5PA 1ENHA 2UXXA 1JJ8C 3DU6A 3K4BA 2D4OA 2PIYA 1R0RI 2WZNA 1IAWA 3FX3A 1QMUA 2DJNA 4F8ZA 1XF8A 4MHDA 2PMZN 4JZ0A 2M34A 1BUSA 4XLPF 3U21A 5BNGA 2JMWA 1C0WA 3SFZA 2LKXA 1P6RA 5IP7J 3JR9A 3VDPA 3G1OA 3H0DA 1PDNC 5JI6A 4OC0A 3EYYA 3UGIA 1S6LA 1S7OA 1VHEA 1W7PD 4BYYA 3I5UA 1TBQR 5DS0A 1UB9A 2WC2A 4ESJA 3KYLA 2DB6A 3AG3H 3R61A 1J2XA 2ARHA 2KKOA 2PVWA 4YRHA 1YG2A 2IGOA 3AFHA 3L00A 5HODA 1O3SA 1HF0A 4CYOA 1DS3I 1K4SA 4AIHA 1ZHFA 4RMNA 1UVFA 1MJ9A 3R95A 1U9NA 1K7TA 1ZAOA 2DMNA 5TJJA 3K70D 3CT9A 4FD4A 5ED4A 1MSFC 5DYMA 1XC5A 2DEAA 2XRLA 2EA4A 2QVPA 2V1XA 2ZW4A 4OMYA 2Z99A 1ETYA 3FXKA 5THWA 1MMAA 2FQ4A 2XRNA 3ZQQA 1JKOC 1N13A 3S15J 3GFIA 1RC9A 5HLHA 3G71I 3G6EI 2EWBA 3GIUA 2QQ8A 5E3RA 1S3ZA 1IN6A 4XRFA 3KX2A 2AQEA 3CESA 3CMMA 1ZK8A 2HOAA 5HLGA 1FOXA 2CH0A 1WK4A 4LIUA 3BDDA 1P4NA 2E60A 3FM3A 5EEAA 3QU3A 3PIOF 3RYOA 1QSMA 2J87A 4KICA 1BI2A 3OYJA 1GT0C 1M4GA 3D67A 2PE3A 3R5DA 2Q04A 3GWZA 3I1UA 1UZCA 5IP6A 5EX0A 2XV4S 1K78B 3ZQLA 2VN2A 2R7XA 1MW7A 2JPBA 3BCAA 1Y7EA 3M9AA 1Q2DA 4KIGA 3OSGA 2JPCA 4X3RA 2FRHA 1TQIA 4NC7A 4B8XA 5D6FA 3LAPA 1F1ZA 4HG2A 1HLVA 2WGCA 1P9ZA 2JSCA 1WGTA 1UFMA 3T8WA 3RYRA 2W57A 4J00A 5JHUA 5FRMA 1D1AA 2IS6A 2B58A 2BBYA 2COMA 2F5CA 4P1WA 4IHMA 1ELMP 2VJ4A 3F72A 1I50J 1QSOA 2JA7J 3EFAA 1SANA 1LNWA 1MBFA 4D7MA 3B3VA 4HNXB 3ASNH 2DYRH 3T8RA 1S7EA 2DMTA 2JZYA 3EDPA 5CYVA 5J1UA 3RNZA 4HOBA 4I99C 4BQNA 5FLXK 1QQ9A 4NC6A 4OAZA 1TIHA 4MY3A 1XA6A 2A5YB 3BR0A 2DU9A 4KOTA 3QOPA 4GDFA 1TWHJ 4OP4A 5EZGA 3KIOA 1AOYA 1Y7RA 2AFSA 3VFZA 3HOUJ 2PDOA 3ONQA 3IWWA 4Q38A 4R57A 4E7KA 4M6YA 2ZFUA 1FOYA 2PJAA 3HUVA 4IUSA 3J81K 1ZLKA 3S6FA 2RREA 3OS1A 4IHTA 2ECBA 2JSPA 2QPOA 2ZW7A 3B8GA 1HSJA 4LG3A 2WCYA 2KIQA 2DFEA 4XOTA 1WGCA 3WHBA 4BE0A 1U6GA 3NQOA 4AMLA 4DYCA 2DT7B 3GVAA 2M0CA 2KMUA 3JSOA 1BA5A 1YMEA 3OYGA 2WAFA 3BWGA 2H1LA 1SD5A 3U9GA 3IRRA 1W3SA 4A24A 2NOGA 1M1DA 2V8HA 1WJDA 1W36C 3D3SA 1YK3A 3CTAA 1L3LA 3F3XA 3TE4A 4MCQA 3UR3C 2DQLA 1UHWA 1NSAA 4FX0A 3FXOA 5C4JJ 1HDUA 3Q5FA 1KU9A 3AAFA 3MEXA 4LITA 5LGTA 3HOTA 2EZKA 4LD5A 4A93J 2FOKA 4P9UA 1SMTA 3IP4B 2BOAA 1IUFA 3PB6X 3KL9A 2CWHA 4HF2A 2HPMA 6CPAA 3KZIC 4L89A 4FE4A 4NGTA 2IBDA 2GXGA 1RUNA 1Z5RA 3SJXA 1IJWC 3BG7A 2ECCA 3GTJJ 1IY5A 4HZFA 5EMIA 2CMPA 4B09A 1OCPA 4D5CA 3SXOA 1PPFI 1V0CA 3DBHB 5FD6A 1R79A 5ELYA 3QP6A 3E0KA 3FMSA 2MH9A 4PCQA 3HKZN 1Z7UA 4UUSA 2ERWA 2OQGA 2ZJ2A 1OZPA 2FOWA 3A01A 2AJ6A 1WJCA 2M5WA 2VKVA 5JM6A 2ZB9A 2ZC2A 4E4HA 2DPTA 1VQPI 4QB9A 2RAEA 2D2WA 1LRZA 4PXCA 3KZWA 2OA4A 4QIWN 1KBEA 5F46A 3PNTA 2Z3OA 1YVKA 1ZGAA 1YX5A 4P10A 4M3GA 3S6KA 4KSIA 3FIWA 4QWQA 1CSOI 2ZMEB 1IOIA 1J09A 4A3IJ 4A33A 1SFUA 3LSJA 3I9SA 5F1JA 4XRSA 1IO2A 4IRGA 2JQ7A 2LOOA 2AS5F 2DPDA 4L5JA 3JTKA 4HQMA 4Y49C 4HSRA 2RN7A 5D29A 4RS8A 3DWLE 1MT1A 2Q7SA 4BDYA 2EBJA 1XSDA 3P5JA 6PAXA 4F93B 3CD6I 2K9SA 1B4AA 5AIPA 5K7HA 5K8PA 5EGOA 3I71A 4C30A 2VXZA 1BI1A 2XGDA 1S20A 1SD6A 1Z8XA 3T5XA 1W4RA 1M4IA 4MGRA 2R7ZJ 2O3FA 4N4OB 5J47A 1OCRH 5IYDJ 1Y6IA 1FZPB 2LG4A 2KIUA 4YFJA 3GO5A 1ARMA 2M0MA 2XAUA 3MRUA 4C2XA 3F9KA 2L9SA 3IFEA 1W7PA 1YX3A 2VZYA 5FLXZ 2R5ZB 3CXLA 2R8VA 3DGVA 3OV8A 5H2FC 1W0UA 2V9VA 4LG0A 1RI7A 1HDDC 2H8RA 2R92J 2A5WA 2NS8A 2R7SA 4CAVA 4LJZF 4A0ZA 2L9NA 4ZTJA 4E7HA 3S16J 3R4KA 2X85A 1XB4A 4A94A 1BN5A 3C2BA 2L7FP 2O8XA 4JBAA 1D5YA 1TWGJ 2K7LA 2BV6A 5FKMA 3J81Z 3HPGA 3HJEA 3S17J 2LUYA 2P0WA 5J1QA 5F0FA 1QSRA 1Q1HA 1XS9A 3FYNA 2GXBA 3GY9A 2A6EF 4F3QA 2P5VA 4UUVA 2BY3A 2XAGA 2NNNA 1XD7A 3LSTA 4ZDPA 1HCRA 1N77A 3SZGA 1ZYRF 3HH2C 1WFXA 1MNDA 3W6VA 2Z2SB 1JT6A 2EJRA 1VQ5I 1OKRA 1R36A 2DFHA 3C3WA 1SGYI 2YUUA 4YFNF 2BL1A 5TGTA 3SEKC 2C27A 5KVRA 1MDMB 2DLLA 1HA8A 3K4CA 4KISA 2OZHA 2M87A 4CCMA 1N78A 3OYMA 2E1OA 2M45A 4KIBA 3J7YJ 2KRFA 4BNCA 2HOEA 1P9GA 4BQQA 5KTCA 4XORA 3PJRA 3HYIA 4UWJA 4PJMA 1YIJI 3C18A 1TIQA 1Z8LA 2SGEI 3IGRA 4RB3C 2JUCA 3KP7A 3GOXA 1HW2A 3TCVA 3KP2A 5DEQA 1WTJA 1ZH5A 2BSWA 4HRIA 3TJQA 2K27A 1FYMA 2HGCA 1H9GA 1J5YA 4DNCA 2B4DA 4EJWA 4R76A 2OUMA 1CGJI 1RTQA 2C6GA 3L2CA 2F4MB 5HLTA 1Y1CA 2STWA 1AN1I 1XX6A 1YQEA 1Z4EA 2IS2A 2XAFA 2RKHA 1FTTA 1OVOA 2GKTI 4NSQA 2P4WA 3ZN0A 3RKXA 2KDZA 3K9UA 2KZVA 4A0XA 5IV0A 1E3OC 3CPAA 3K4MA 1TBOA 2VRWB 1YITI 5ERIA 3PB9X 4CYDA 2FBIA 1USSA 4BBRJ 2WUUA 1OJLA 2KJCA 1WJAA 4FE7A 5KAIC 4QPOA 2GWRA 1UHSA 3JCUC 2LKPA 3L09A 3M4OJ 3FC3A 3HBLA 4BHPA 4PFPA 2R93J 4IHXA 2ISYA 1BJAA 3IHUA 4BXUA 4XPDB 5M5XJ 2KMOA 4M3SA 2ANPA 4KLVA 2BVLA 4CO8A 2DXIA 4KUAA 1G6NA 3QYEA 2OTLI 4MHPA 4R6TA 4AU7A 1PJRA 4OIWA 2TCTA 2PIZA 1X3UA 2DA4A 3J80Z 1ZR2A 2CQXA 2KDOA 3K7AJ 2YS9A 2I5UA 4ZJZA 2XDVA 2O61A 2R7TA 2JYYA 2ZJQF 2LB7A 1CP6A 4MFPA 2FQ3A 1X4OA 1M44A 3G2BA 3I3LA 3FM5A 2DTZA 3HC7A 3B02A 2Z3PA 2HPIA 3CXPA 2Z5UA 3RQ4A 4IOAF 3G1LA 1GXPA 1Q7LA 4IK2A 1NSLA 3R0JA 1L0OC 4IQ4A 1YTYA 4KOXA 3R9GA 2Q2EA 3W6KB 3F6VA 3ZMUA 5L3EA 1CE3A 2CNSA 3MMYB 1WJFA 4ABZA 3GUDA 1IY7A 2NYQA 4U5YA 3EUHA 2FD5A 4EJOA 2XB5A 2Y30A 3GFMA 3CCYA 4LMYA 4UXNA 1VQOI 4D9JA 3OIOA 1QBJA 1BLLE 2X3TA 1VTNC 2QENA 1FSEA 3REOA 3WGGA 4E1RA 1XIXA 2ZEGA 4KOWA 1I21A 4X8IA 3UGDA 1UFHA 1Q9BA 3BZKA 3OYLA 1H88C 5BPDA 4IXAA 3RIRA 2VQYA 2VQLA 3TDUC 1QVUA 3CDIA 2DA5A 2P5KA 4LFUA 3W2VA 3KEOA 4CYCB 1R1VA 1GDTA 4KOSA 2FEZA 3KZZA 3OYEA 2EVNA 1EH8A 3CJQB 2YU9J 3N5FA 3BJOA 1R23A 4H4KC 3ZRGA 1YIOA 2DW4A 2YUSA 4M9XA 2A3SA 1N71A 3BTCA 3OMYA 1BPNA 3A4CA 4M6HA 2EV6A 2DJIA 2LSOA 3KP3A 1Z3YA 1ARLA 3K4JA 4B48A 4CCKA 2W1OA 3S1QJ 4AYBN 4EGZA 1JGGA 4HGUA 1QQIA 3D66A 4KZTA 1KU7A 4C7IA 2BXYA 5JR3A 4FCYA 2HKXA 5IX3A 4OIRF 3SDGA 2V9PA 2ID6A 1G3TA 2ZO4A 5F0HA 1JE8A 1FMVA 3A9LA 5DWMA 3TL4X 4ASNA 3FISA 1S60A 2LP0A 4PSXA 4ZYDA 3IAM2 2G3AA 5M3FJ 2PJ3A 2XGCA 1TWAJ 5HNFA 3OYBA 4LUAA 1Y0YA 3E6MA 3D1NI 5L3DA 1FY7A 4OIOF 1HDPA 1XG1A 2M7BA 1IYKA 1FYBA 3P9CA 2MH2A 2O28A 5ILUA 2W82A 2OAZA 1LCPA 3KP4A 4JYWA 3AL0B 1MBEA 2X1EA 3W3CA 3OYKA 3J7AY 4D7NA 3ZMDA 3OXLA 2XB0X 2DCEA 1RESA 2BHZA 3FMQA 4XN3A 2LC2A 3VYUB 2B4BA 5AG5A 1RETA 1RRJA 2KIMA 5K8OA 3PUBA 2ARPF 4XLAA 2AFUA 1Y0UA 5FO5A 2HI3A 4Q47A 2V1CC 2BEIA 2Z3KA 4YU9A 3TFYA 3JRHA 2KHMA 3PFIA 1ZN2A 3WGIA 3TOBA 2QEXI 4FBEA 2XGEA 2FXAA 3R6SA 2JK3A 4EJUA 2MA3A 3DTIA 3KY9A 3RAMA 1NXUA 2DOFA 2W7NA 1KUVA 2ZFWA 3WE3A 1OYIA 4ON0A 2JLMA 3HIFA 4XKWA 5FKLA 5HDGA 4HF1A 3C1DA 4UVCA 2W48A 5JQ4A 2VBZA 4K30A 3D5LA 5ICFA 2Z3YA 2ELKA 9WGAA 2EILH 3GUXA 3KASA 3U1KA 3KR5A 1VNDA 2EV0A 1CPSA 3QNVA 2NVUB 3LAJA 3V7ZA 2Y69H 3IWFA 2QQ0A 5IB0A 3CLQA 3GZ6A 3S14J 1EJ9A 1TKHA 2GLJA 2XRCA 4HEA2 3UY5A 5HVGA 5DD8A 2XKOA 1JKQC 2C6PA 1OCCH 4WXCA 4DBQA 4H2KA 2HZTA 2EZLA 2UXNA 1T39A 3HTSB 3G73A 4IL6C 1ZG5A 4HA8A 3DBLB 2HDDA 2XKPA 3JW4A 1T38A 1KUYA 3AG1H 4R1HA 1E2XA 3GTMJ 2CWGA 5C88A 3MVPA 3OL4A 2QQAA 2CV2A 2PJRB 1HJAI 4P4IA 1RO5A 3I58A 2W24A 3IV5A 4L9VA 1O3RA 2X9DA 2IPQX 2Z9OA 3ZQHA 5HNHA 2P6TA 2RDPA 4I6ZA 2DN0A 4UHTA 4UV8A 4KITB 2ID3A 3KKWA 1TOTA 1YW7A 3WTTC 3HOXJ 2N52A 3K70C 3FSYA 3VPRA 3BR2A 2ZKZA 1IXCA 2VT2A 3JAMK 1D0YA 3VATA 1FT7A 4MY0A 4B13A 2E36A 1FIAA 1YSJA 1U0JA 2F3CI 4NGMA 1FP1D 1PVEA 1RNLA 1TNTA 5KNLA 3Q0UA 2CXAA 2B0UC 4C7HA 1D0XA 1WH7A 2HOTA 3E7LA 4G94A 1YLFA 3JRUA 1YHQI 1SFOJ 4BACA 3IUOA 4R79A 1VQKI 1MZBA 4BJTA 5C3EJ 4G6TB 3K4KA 4N0BA 2QZ8A 2HYGD 3TEDA 1AA7A 4CGPA 2V26A 2EBIA 3HRMA 4HNWB 3EY5A 2H1KA 2EFPA 2ELJA 2UZ3A 3G3ZA 2B63J 4Y17A 3OS2A 5CCLA 4A37A 3O6BB 5B1AH 2ENNA 4YRVA 3HRTA 1GXQA 4B47A 4RLQA 2JA1A 3QU6A 3FXJA 3IL2A 2IJLA 3MWMA 3QYFA 4EFDA 2LVSA 2Q8KA 3IKTA 1PUFA 3Q9VA 4HV5A 2MLGA 1F2PA 3PBBA 3P2FA 2DFFA 2H27A 2LBFB 2EB7A 2RNJA 3HGYA 2WAQN 5IY5H 3BCBA 3BROA 3PFEA 3GLJA 1YI2I 2PJ2A 3WT4A 2Y0MA 1TUSA 3B3TA 4RAGA 1YRNA 4EJTA 3JSPA 3CLOA 2PSWA 2OJED 3BZ6A 2R7OA 1B9MA 2HVQA 3KE2A 2IGMA 3DKYA 3VDUA 4R9MA 3H5NA 2P6SA 3GKRA 2HFHA 4M73A 2R7UA 5K8MA 1XMKA 4QC6A 2WAEA 2BYVE 3E97A 5DDGA 4I2OA 3GTPJ 1DU0A 4PUSA 4NDLA 2VEZA 3WC7A 3CMEI 3IEHA 3ELKA 1N25A 1P92A 1AYEA 2Z3NA 3T9YA 1XX5A 1USTA 1M4DA 3BHXA 1R6RA 3J7ZI 2ZNYA 2XSDC 3I3GA 4MQVA 4L5EA 2LLKA 4EV0A 3HTUA 3PDNA 4OC2A 3L7WA 2JVHA 3ZQIA 2Z0ZA 1U9OA 3H8EA 3M7GA 4GRIA 1VQ7I 3SDBA 1SGEI 1MNEA 1PJUA 1TF8A 1OFCX 4S04A 3ZZIA 1BOAA 2PQ8A 3IWEA 1LEAA 2NRAC 4KVXA 2V77A 2QWWA 1T56A 2JEWA 2E2HJ 1JTXA 1X1DA 3CCJI 3S1MJ 3D68A 2BE5F 2GLFA 2Z16A 5LBQA 3H5RA 3CCVI 3BG6A 1JUMA 2REFA 4ZYHA 2ZBKA 1ELLP 2X1CA 3JRCA 1U5TC 1VHOA 1T0FC 1BL0A 2AE6A 2LFBA 2FNFX 1XOVA 3LSHA 1YX0A 4DZPA 4LLGF 3CCLI 5H84A 5GAGJ 4UNOA 3MN8A 4AM3A 4B5PB 3VB2A 5A27A 3QPLA 1GV5A 2EWNA 3H9GA 4XM3A 4EWTA 4MTEA 4BHCA 3SEZA 3WTXC 1OISA 1VDDA 1YGHA 4XQFA 3V4GA 3ECOA 5J6XA 1HC8A 1A35A 5KAFC 3B3WA 4CGLA 3OS0A 2CS3A 3S6HA 2VBXA 3I9V2 4XONA 2GVIA 1MBKA 4G7ZF 1KMAA 4U0YA 2K5CA 3JAMZ 1V54H 2WBMA 2M1BA 1DS2I 3MKWB 4JXQA 5B66C 3LQRA 1VQ9I 4UA3A 1KZHA 1P4XA 3OXFA 1PUAA 5IT3A 3LL7A 2YNCA 2CUFA 1A6IA 3CO6C 1PCAA 2XEJA 3PZJA 2FBHA 2CW8A 1TW3A 4OOIA 3WC6A 2J8MA 4BHBA 2OBPA 4F6AA 1POGA 3VWBA 1SQHA 1ERDA 4HBLA 2DA3A 2CY2A 5IP9J 1VQNI 1PTRA 2QBYA 1F57A 1K4JA 4OWRB 1XMTA 3TC8A 3TW7A 3OYHA 3L2VA 3MN2A 3J7AO 1MMSA 2EQRA 3IO1A 4PXEA 4KDPA 2QQDA 1TQMA 2PMZA 3TBIA 5D5WB 1ZGWA 1CBXA 4CAEA 3KCCA 4M3DA 2H6CA 2FIWA 1M8BA 3WABA 1RKTA 3B7IA 4BAYA 2NU2I 2FSWA 5E1XA 3ERED 5LLQA 2V79A 4ZC3A 2NU4I 1S7NA 1YS6A 2CQKA 4BY7J 4MFJA 3FBIB 1Y1BA 2X6OA 2JBJA 3H5ZA 3BI0A 4UWIA 1I6HJ 4L0ZB 4DJAA 4R87A 1IYLA 4A3BJ 2JZMA 3O8HA 5D5UB 1ZG8A 2HQYA 4AIJA 1SGQI 5J1YA 4XNHC 2ZEDA 1RR7A 3KP5A 2RC4A 4JCVE 2Y48A 2V1UA 1BI3A 1G3YA 5B1BH 3WG9A 4CHUA 1WH5A 4LK1F 4HKFA 3GTQJ 2R7QA 5C82A 1BR2A 4L9MA 4NGPA 2RQPA 4XPLA 3S6GA 5E17F 3WTWC 1XSXA 2ME6A 4YFXF 1FYKA 4RAZA 2O0YA 3VARA 5IYBJ 1I1GA 1JQGA 5CVUA 2ADUA 4AG9A 4DZJA 4NGNA 5G21A 2ABZA 1JWQA 2HOSA 5EF6A 3VYTB 1Z1DA 4GI3C 4J3GA 3OYIA 1LJ9A 4XPKA 2NS0A 3FK7A 4CGMA 4ZY0A 4BEHA 3I4MJ 4FISA 2JA8J 3CCQI 3VODA 1FAQA 4YFKF 1B6BA 1IU8A 2QUFA 2BXZA 2YPRA 4RB2C 2E1CA 2HVSA 1EE3P 1QRYA 4B3XA 3I64A 2ROWA 1QSNA 2A69F 1K79A 1FX7A 2L02A 1MGTA 3V8JA 1HOMA 2Q51A 2DBBA 3RDIA 2E5ZA 2GZWA 3BPXA 3H36A 3KEQA 1XBTA 3ECHA 1I3QJ 1OMTA 4P45A 1Z21A 2ZCWA 3H1CA 4E70A 2VXKA 5M5WJ 4JWPA 4IAVA 4IHSA 1Y9KA 2Q7BA 4E2AA 3GF2A 2HS5A 3C26A 3L2UA 1J59A 4UV9A 1QHGA 4HV6A 1HDLA 1TQPA 3BJ8A 4PZJA 1LQ1A 4MFQA 1LFPA 2DMQA 2Y75A 1O7LA 4E0AA 1XMBA 1FBSA 2PN6A 4A0YA 3IWZA 3S3MA 1MD0A 2IS4A 1IW4A 5LGNA 4NJQA 3VWEA 2DOAA 5DM7F 1R43A 3BTJA 3HLPA 2KFDA 2KPMA 3HSRA 4XNFA 4B4CA 4QLCU 3KETA 2B3UA 2R1IA 5E3MA 2Z3LA 4GS4A 2F48A 1O7FA 5HXDA 3CMAI 1M8CA 2O5RA 1EA3A 3UOEA 3R1KA 2CTCA 1P0HA 4HNTA 1V4RA 2AFXA 5B5EC 2ODFA 2FUG2 3ULQB 4KVOE 5JVGF 1IRGA 1KA8A 4AD9A 1Q2YA 1UG0A 2BHYA 2CV0A 3O8GA 3BQZA 2KRHA 2XEFA 4WWCA 4CAWA 4EMEA 1JGSA 1IZ1A 1UHMA 1ZGJA 3H3UA 4I0AA 5JLWA 3FKIJ 1STZA 4A3EJ 2B9SA 3P2HA 2F6CA 5J3LA 3GYAA 1ONVA 3G1MA 2P6FA 3B6AA 4MO7A 4FWUA 4N9HA 2L5QA 4ZYEA 4H0EA 4KIFA 3QODA 5L3GA 3BG9A 3UFFA 2HUZA 4UIBA 1MNMC 4UUSB 3QRFF 1Y39A 2MD0A 2ZJPF 1X74A 4RS2A 2ZW6A 3NEUA 1Q1VA 2PFBA 3IC1A 2MG4A 2BW3A 2FL4A 2W84A 4Q36A 2ZEPA 1FT9A 4JLYA 3RPUD 4Y13A 5IYCJ 1QSTA 2J8NA 2EK9A 4TNUA 4ESBA 3I59A 2ZPAA 2W25A 3M8EA 1TP4A 4KT6A 3GZNB 2FCKA 4F55A 5LHIA 3FBNB 3K6GA 2M4KA 3LNQA 4AVAA 2OCCH 3QWPA 3BJ6A 3HOYJ 3OIPA 5E3QA 2F5FA 3LQQA 2XPWA 4XK4A 2JA5J 1QU3A 3DPUA 4IQJA 2CRGA 3PFOA 1Z77A 2XF5A 2MGQA 2ESHA 2HTSA 1ETOA 1B59A 2WPWA 4X1EA 3HKZA 5LEJA 1SEUA 2K9QA 5EGOB 1T33A 2DA6A 1IICA 3R9FA 2RNGA 1TKFA 3WTYC 2IGNA 4W97A 3OL3A 2RIJA 4MI4A 1SVMA 1DP7P 5CQGA 3BP8A 1CGII 2L9RA 2HEOA 4RN7A 1WJ5A 1EH6A 2KT0A 2K85A 1IXRC 2XF6A 2BCOA 3FJUA 4KUBA 2DMUA 1HKSA 2GAUA 3R60A 3E5XA 3H4QA 1QZZA 2PRBA 3TP0A 4J19A 4EM0B 3LSPA 3RU0A 2O6GE 2XSJC 1BW5A 1LKXA 2LK2A 5EZHA 3P9KA 2Q1ZB 1R1TA 4LG0B 3TO6A 3LODA 3FMCA 1DU6A 4P96A 3OWCA 3JRBA 1VFCA 3FDYA 2V1CA 4W1UA 4M6GA 5G20A 2DDBA 4MLOA 4IRHA 3ZCOA 4A6EA 4IHVA 3E59A 3G8WA 1Z05A 2RV8A 2XAJA 2POKA 2OU2A 4M3FA 4KSFA 5JH9A 4LQ6A 2VL8A 4BU2A 1WKMA 1DPUA 2JBKA 5H86A 3OR1C 1IRFA 2EPFA 4HX7A 1OPCA 3U2RA 5IPAA 3JRIA 2ZJRF 1PUEE 2P6EA 1I27A 1LFWA 3WU0A 3J80K 4FX4A 2Y9YA 3L9FA 2Q0OA 2DQRA 4IVNA 2OD1A 1ZARA 1MBGA 2ZEHA 3CDXA 1EKEA 3S3OA 3CO7C 2L7ZA 2H8WA 2YNCC 2F8HA 4P4FA 4X2TA 3SJMA 4XBFA 4UCNA 1S8NA 4FETA 5H6QA 2ZOGA 3KGQA 4UB6C 1SD4A 1S5KA 4O5VA 5HI7A 4JXRA 1WJEA 3BLYA 4U7BA 5HVQC 5CCMA 3RZAA 4PJ0C 3HL2A 2SGFI 4AVCA 4XRMA 3KLNA 4KMFA 2FXFA 4ZX9A 2KJBA 1PU9A 2PJ0A 3FK6A 3W2WA 3K2ZA 3S3NA 2PMUA 3B73A 5K8NA 3HZJA 2HDCA 2LRDA 2PJPA 2JW6A 1Z7KB 1YW6A 1XGSA 3CMYA 1WJBA 1J75A 1YTPA 2HQRA 2R5YB 3BY6A 3EUAA 4XLHA 1R58A 4AVPA 2IEKA 1ACIA 3G3SA 4BUPA 2VQHA 4WX9A 1HW1A 1I5ZA 4B14A 4HW0A 5DCFA 1ZKGA 2DODA 3BR1A 2QVOA 2C6YA 2SGQI 1YR0A 4UEEA 4H6UA 4BQAA 2GA1A 4M6VA 2P7VB 3ABMH 4GM5A 2O8KA 4BJ5C 5L3FA 4II2A 4OAEA 1KONA 1SMYF 3CP8A 4XLEA 5FUYA 3GLXA 2GIZA 2XHKA 2PJ8A 4B44A 3DLLF 3MCZA 1T8IA 2COBA 3GBGA 4C3IJ 4NGSA 1VQMI 2I8DA 5LYDA 5FVJA 1YJ9I 4IF5A 1D1CA 1ETXA 5ILSA 5JGFA 2UWMA 4IHWA 2V8VA 1U3EM 1F2OA 1Z3XA 3W6JB 5G1ZA 2L01A 4XICA 3DR6A 2DT5A 2CUEA 3A1YA 1O3QA 2XF7A 4IPAA 1S7LA 3SZTA 4HNYB 1U78A 2MABA 5FUVA 4IJAA 4C68A 5LYLA 1RPWA 2V6CA 2ZMEA 2NOJB 2FT0A 3CC2I 3CJRB 1S7FA 1ZELA 4BBHA 3V8KA 2HU9A 3ESWB 1CJWA 5E3PA 3EPZA 2UV1A 3GCMA 2L7XA 2Q43A 2IJZA 4JQFA 2Q2EB 1YJNI 3BJIA 3AKZA 3Q0WA 4PK4A 4DW6A 1IV8A 3A0HC 5J8FA 3R0AA 2FMLA 1LFUP 4PSWA 4RI1A 5KK1A 3EUKL 3S9NA 2GBYA 1I39A 2L4MA 9ANTA 3UGLA 1CT2I 3PM1A 3HOZJ 1ZLHA 4R3KA 2WA0A 2JWTA 4PXBA 2JDCA 2HV2A 3U1DA 2M5XA 2OZUA 3SQNA 1ZG7A 4CICA 3A2KA 4A95A 4B11A 3PNYA 3RZDJ 4K3NA 5L3CA 1CF7A 1GV2A 2XPVA 1ZO0A 2W00A 1X1BA 2NNYA 4HX8A 2V8DA 2M2EA 4OC1A 2DOEA 4XLFA 2ZEMA 1IN5A 1KWMA 2ME0A 2HQAA 2BEOA 4RM2A 1Y8RB 4YEJA 2VJ5A 5D4SA 1BBYA 1T95A 5EEGA 1IV6A 3C2GA 1X58A 1R1UA 1TURA 3UEJA 2XROA 2JN6A 2JXDA 3K1MA 4GXOA 2VONA 3FIXA 4II3A 4RGXA 3CJTB 3BTLA 3GFJA 2ZEFA 4MCRA 4XIDA 3M3YJ 3RKQA 4A69C 3H8FA 1HXDA 1B9NA 1NHAA 2AXTC 1TW2A 2ZXHA 3SI1A 1G3SA 2VIXA 3D00A 5FRNA 5GPCA 3D5SC 3FXQA 3RYPA 5C4XJ 4AC0A 3V7CA 1BM9A 4Q48A 4A2ZA 1BIBA 1JHHA 1G3WA 1ON2A 2CQNA 1E17A 5F27A 1LDJA 4II9A 5EYRA 4BH9A 1U5TA 4LB5A 4JP0A 1T0FA 3SFIA 4GXHA 1X19A 3EYIA 2R7DA 1Z4RA 4MIMA 1HDQA 2IA2A 2VB6A 2B5GB 3N7ZA 2CJSC 2L2OA 2TDXA 2L7MP 3LSKA 3MAJA 4M74A 3CCSI 1ITYA 4AYBA 1B8IA 4I76A 3IAS2 4EM1A 4Y7NJ 4Y4RA 1MBHA 2GOXB 4Y33A 2RVCA 2LY9A 3GTOJ 2WSAA 1ZG3A 4BE1A 4A3GJ 1XFOA 4UFXA 3OYDA 2WB1A 2XAQA 2PJBA 3V7SA 1MMDA 4G6QA 3IRQA 1WWXA 2YSRA 5E3NA 4KOYA 4A12A 4DYQA 1V5EA 4XL9A 4PGHA 4D0PA 2VE9A 4RGSA 1KYZA 2CJJA 2N1AB 5J4VA 5E18F 2VZZA 3VWDA 4B1RA 1D3YA 1IN4A 2Q4ZA 1LUJB 2GQQA 4V2FA 3S1RJ 1W0TA 2DI3A 5E20A 2F4OB 1J4JA 4EJVA 4CXFA 3LFKA 2O4HA 2WB1N 2EINH 2NXNB 1QZEA 1IF1A 3R5CA 1LVAA 2I3CA 4OINF 2LTPA 4M9SA 5E79C 1AUGA 1I1DA 5JVTA 4U88A 2OOTA 4UBRA 2FNPA 8CPAA 4NF1A 4BMHA 3BTIA 2FNAA 3M8FA 4MXUA 1DDNA 3G4SI 4B5OA 3L2RA 4EMSA 2K3PA 2IQ6A 2BY0A 2L3DA 1FOKA 2V53A 3DKXA 5BOXA 2EIJH 3DLAA 1X4PA 1OCTC 4ZDOA 2NU1I 3KEYA 3DTEA 5TRDA 1OMUA 1Z2LA 1LPQA 3PO3J 1Y9WA 1MH4A 3F22A 2JT1A 4IX7A 4E7SA 5B3SH 3V42A 1SGDI 2HYJA 4BXXJ 4LQGA 1ORKA 3SHPA 2X0LA 2MW8A 3CJNA 2Y9ZA 4HPSA 3JUWA 4KS9A 3FNCA 1IGNA 4LGWA 4CPAA 1A6QA 3FECA 5HH1A 2X6WA 1D8KA 2OB0A 4OKOA 3QQAA 1S9HA 1G4DA 3SEQA 4ZZDA 3RSNA 3WTSC 1YW9A 3H5AA 1HPTA 2DTRA 3IU1A 5DUIA 3KR4A 4MRIA 3S9LA 3BLNA 4G12A 1DP3A 4KOVA 4Z6YA 1S72I 1X1AA 5J40A 1IUYA 3FHZA 2P6AC 4CYCA 3VYRB 1ETQA 5DV5A 2NVQJ 3DTKA 1KQ9A 4PPZA 1GVDA 1M4LA 4A5MA 1SD7A 1J9IA 2SGPI 2P6GA 2FF4A 4ZYQA 1IDZA 3ZXSA 5LYIA 2C6CA 4PJNA 2A20A 3GYHX 2DA7A 1OCOH 3HRSA 3LWFA 4AIDA 5BMZA 1U8RA 2X6YA 4F7ZA 3PFYA 2VKEA 4JX4A 1JI8A 4CGOA 1LE8A 1QPIA 2G0EA 4TV7A 1CQTA 5FKOA 4KYWA 4V19K 2DMPA 2EFQA 3Q3SA 1PUFB 1MK4A 2Q44A 4P4BA 4Z2YA 4CS0B 2EH3A 2QQBA 4K2EA 1PP7U 1OR7C 4OVOA 1R00A 3E6BA 2G9DA 3D2PA 3FXUA 2HZDA 1LR7A 3OWTA 3SGQI 3NH5A 2Z1DA 4IEJA 1YRNB 1HEEA 3NH8A 1XTAA 1Z2IA 1WI3A 3MZYA 1Y8FA 4GYGA 2FS5A 1H0MA 3F8NA 3DEEA 2VOPA 2ORVA 4C3HJ 1YQAA 4BS9A 2P81A 3ABKH 1TBXA 3N4MA 3EQLF 3HOWJ 4C2MJ 3SI2A 4M72A 2VE8A 2K9NA 2ENZA 5F0CA 1FOWA 1BPMA 3L2QA 2D5VA 1UUCA 3FXTA 3HUGB 2CUZA 3CUQA 2QGUA 2E1MC 4E7ZA 2DPUA 2BO9A 2CFXA 2KMPA 2G7UA 3TQNA 4B3AA 2QYVA 4CGNA 1SGNI 2QCOA 4UCPA 2OVOA 1IY6A 2EUIA 2EA2A 1X4SA 1RIOH 3IH3A 1PCEA 1U8BA 5A2QZ 2G3TA 4MHZA 1E3PA 1XDUA 1GUUA 5FROA 4RB1A 2VKDA 2BGCA 4SGBI 3BI1A 3L2NA 3LMSA 2WAQA 3K9TA 4MTDA 2QM3A 5E3OA 2A05A 2ZMEC 2GXAA 2EK5A 3COAC 1LR9A 2E7XA 2B8TA 4PK2A 4RBOA 4TWEA 4PDKA 4BE2A 2DAOA 3DNSA 1U2WA 1NE9A 4NFRA 4DJLA 5F64A 2FE3A 3TOAA 5DD4A 5GTHC 1K6OA 1DPRA 3MQ0A 3TW6A 2OV7A 2WADA 2CNMA 2E2IJ 3GZ5A 4EVIA 3N97A 2O9LA 4IZZA 4G9YA 1UG2A 4G7HF 1CM0A 5LYFA 3NRVA 2H94A 1V55H 2CW7A 4XSXF 2C1CA 4ZY2A 2ZXWH 5HQ8A 3KP6A 1S29A 1VQ8I 1KU2A 4NGRA 5BQTA 4MHYA 1D1BA 4HX4A 4ONWA 1R7JA 3P7NA 4GCVA 1DQUA 1LEBA 4LK0F 5KTAA 2VI6A 1MIJA 2PR8A 1OMIA 2V8GA 3AG2H 3JREA 3BG5A 1VQ6I 3HGGA 3F8MA 1WPKA 2TRTA 2ZSIB 4OU0A 3F8CA 2VLAA 4IO9F 1B72A 2UVOA 2VXDA 4ZGYB 4WP4A 4NQWA 2PEXA 3EXNA 3H9QA 1X10A 2L4AA 3LA2A 4WXHA 3ZMTA 2Q0YA 4Q7AA 7CPAA 4IOCF 3BJ7A 4Y49B 2N17A 2I00A 4C2UA 4A3DJ 4OC5A 3SI0A 3LMMA 1H89C 1D8JA 2PJ6A 5CKTA 5CBMA 3BR6A 4MJ8A 4DQ2A 4FD6A 2DA1A 1Y1VJ 3HHGA 3W2AA 4KOUA 1FC3A 4RM3A 2CSOA 3MKZA 3F8FA 2XASA 2QBYB 5IT9Z 3X2QH 2BY2A 2M9HA 1QGPA 5FJ8J 3DSBA 4BDZA 4E1PA 3JRAA 4UEFA 4UIAA 2PX9A 4A2UA 2EZIA 2B7EA 5CJ9A 5LHHA 4L0YB 2EV5A 4ONUA 3ZMSA 1H8LA 3FMRA 3RCOA 1CP7A 1TTYA 2WV0A 2H5MA 1T2KA 1D5VA 3OOPA 3FKJA 4RLFA 4B12A 4L9JA 1TXRA 1FSHA 3VYSB 3PRTA 4OIPF 1R57A 1W1WE 2ZENA 2JA6J 2JRMA 3C2HA 3LACA 3TP3A 3CPXA 1PTQA 5E8GA 1PP8F 1OYVI 2DIPA 3ISXA 5K1YA 1CT4I 3DF8A 4CCNA 1DGRM 4XMYA 1IXSB 1O57A 2HDWA 2MLKA 4HNVA 4OADA 3F5BA 1VZ0A 5F04A 2DO7A 2ELIA 4U9YA 1BC7C 2BVMA 4P44A 4HPQA 1B6AA 5DWNA 3ZN1A 4R8FA 2QLZA 1ZLJA 1FWZA 2FJ1A 5K7FA 2GANA 4MEYF 3W91A 2ATRA 3RQIA 4UF4A 1YFHA 2Y31A 3IH2A 1ODDA 1TLHB 1L0CA 1QPMA 2K4BA 4BEHB 1F9NA 2AO9A 3BT9A 3ZQGA 1ZR4A 2Y0SA 4N9IA 2A68F 1GYTA 1R49A 3QPHA 4NCZA 2KMRA 1Z0XA 1OYWA 4XPDC 2VQGA 1I3AA 5FD5A 4EEFG 3JVNA 1K61A 1AHDP 1XGNA 2QJ8A 4EATA 1R4MB 1VQLI 3PB7X 1P9QC 4DUKA 4HQEA 3DLJA 2W4SA 2E1NA 3T0YA 4BY1J 2QA4I 3K4LA 1UCRA 3EETA 2Z3MA 1Q2CA 2H6BA 2R98A 2K9LA 3V8IA 4ZYGA 4E8OA 2CW0F 2Y0SN 2AFOA 5GPAA 3JTGA 1Y1WJ 2IMOA 4RGRA 1IN8A 4XKBA 1W5CC 3C7JA 2X1DA 4R8HA 1A31A 3ZMVA 3T1BA 2HNHA 3OVOA 3LWUA 1LVKA 5JFRA 4RGUA 1R3NA 3IJ3A 4X5KA 2V9KA 3SZPA 2VBQA 3HG9A 1TZLA 3VE5A 3BG3A 2EFWA 2GLOA 5EG0A 2J8RA 4I02A 2ZXJA 2KCXA 3R5AA 1RXTA 1UAAA 4YIRX 2O53A 2Q4YA 3PB8X 4OMZA 4XRSG 1TWCJ 4C9YA 4E7LA 1F36A 2VJJA 3KQZA 2F5IA 3H3VK 4A3CJ 5I4MA 1KQ0A 4CRZB 3K1PA 2K9MA 3KYDB 4Q4ZF 4WXDA 5H6RA 1IN7A 3EO4A 3H0GJ 2MC4A 4OIDA 1YOVB 5IB9A 3ML6A 4OLLA 5E8IA 3LSGA 4UXJA 4PGGA 1U6MA 2F4IA 2BUEA 5AIQA 4C2ZA 3FBUA 3ZR8X 4XOPA 5HVFA 2NU0I 2QIRA 1ON1A 5DTDA 3PQKA 3H92A 3DPLC 2QSFX 4M9ZA 5ICGA 1F43A 2M30A 2DXQA 1JKRC 2CWFA 2JTVA 4KT5C 1Z9CA 2AXLA 4ENNA 1S3JA 3WHCA 4Q5SF 3B4VC 3D7DA 4CYQA 5GP9A 2WV1A 4BXFA 2PI0A 1AKHA 3SXYA 1LANA 4MFZA 2QQEA 3MZ8A 4KJZA 2JVGA 3M1CA 4XSZF 2CNTA 1I6XA 5HS8A 2BW3B 2H09A 1P4WA 3V38A 2E2JJ 2WVJA 3FXLA 4CZZA 3BC8A 3OYCA 3CCRI 5DCMA 4PXDA 2GREA 1G8XA 3I59B 4J01A 7WGAA 3AL0C 4IF4A 3HB9A 1IGBA 4MFKA 2FIAA 2HR3A 5LGUA 2LMDA 2KQRA 1I1SA 3CXQA 3OYFA 1MJBA 2LR8A 3CUQC 4UEZA 4L18B 5DUKA 2K3FA 4JD6A 4ZI6A 1BR1A 4A6DA 5IOYA 2E5RA 3CDLA 3FB3A 4JJXA 4NC8A 2CWEA 2VL1A 2E19A 4A31A 4KMUX 1WRJA 2ZW5A 3PL8A 3K4NA 4EM2A 4YG2F 1WSUA 1BI0A 3KLOA 4XR6A 4A3MJ 1Y0RA 4KVME 3MEKA 1NMTA 1OYYA 3QAHA 4CYNA 2B0LA 1BOBA 3O3KA 4U0VA 1TNSA 2GA2A 1SFEA 1OCZH 1P2FA 2VJIA 4M71A 5J4YA 3F21A 2XVCA 3D2MA 2R7FA 3SGBI 2VOOA 5FGMA 1KGSA 4CYPA 2DFIA 4BJ6C 1NK3P 4ZDLA 3ISPA 2HC9A 1T08B 2DKVA 3A01B 4XLCA 3H35A 4HDUA 1GHEA 2XPUA 3I53A 5GAHJ 3E1SA 1ULMA 1TWFJ 5F6FA 5HDNA 3IIBA 2ACJA 2K02A 3F8BA 3S1NJ 1S5LC 2CQ7A 3E6DA 2R7VA 4P55A 5TISC 1ETWA 2NVXJ 3V8LA 4M6XA 1Z9UA 2PCUA 3RKWA 2QQ9A 1JT0A 1JKPC 4ZZLA 1K4TA 3TO9A 4NEXA 4QUSA 2OH1A 2EK8A 1DE4C 2E35A 5BS6A 1RKWA 2R0QC 1FYLA 1G59A 4ETSA 5FLVA 3JRDA 4MPIA 1TKJA 3DCFA 3RI4A 4AVBA 4O23A 4MEXF 1BJZA 1E3HA 2DDAA 2L7KA 5FLMJ 4RAFA 3JTHA 4LLLA 3S2WA 4ORFA 4KNYA 5EX3A 2MBFA 3CCUI 2O03A 4AVZA 3FRMA 1Z6TA 4QVTA 1K78A 4CRYB 1LDKB 1M1EB 3EC4A 4DOZA 2EIKH 3F6OA 4HAMA 1Y0NA 4G8XA 4ENMA 4B43A 1CG2A 4OAYA 3VSKA 2ZELA 4G1PA 1BC8C 5K5RA 1Z8TA 4WK8F 3NE7A 4YIFA 1IC8A 2XEIA 4D1QA 1XJOA 1FBUA 1OQYA 1QVTA 4FASD 1W7PB 1YO5C 2M3AA 5GTIC 1LAMA 5HDKA 4LLNA 1ZTRA 3VDXA 1NH3A 2P7CB 2PLYA 3D7FA 2KZGA 3B35A 3WTZA 5F08A 2P5LC 1JUPA 4NHJA 3S9MA 4CCLA 3OSFA 2PRQA 4NBQA 4YIIA 4NGQA 1VGYA 1X3WB 1WZ2A 5K5OA 5I0CA 4UB8C 1UJ8A 2X52A 1V5GA 2IVMA 2FSRA 4R7MA 4LB6B 4H89A 2X4HA 5FFXA 2A4NA 3GLLA 4FHTA 4QPQA 2PVVA 1XDSA 5D5XB 1R4NB 3NAUA 1KUXA 3ABLH 4U87A 2X7BA 3F8KA 2VBYA 3LOCA 2HXOA 2ZXVA 3T8TA 1H9TA 5F48A 2E1MB 4DIQA 1NK2P 1VKCA 3ISZA 3VH9A 5JPHA 4YGOA 3RJPA 2HXIA 2A6TA 1IW7F 3M07A 3E5UA 4JOMA 3H8GA 1DGWY 5LRGA 1HBXG 1ULKA 1Y56A 3ZQFA 4BQOA 5L3BA 2OZ6A 2ZXIA 3ROUA 4KLWA 3PIPF 5G22A 3QP5A 5E96A 3HPHA 3S93A 1EV7A 2FMYA 2RB7A 4ENKA 3F0CA 2KISA 1JTYA 2PJ5A 1X1PA 2E5NA 3CXSA 3QTLD 5IOZA 5M3MJ 4MMOA 1WGXA 3HEFA 1NTCA 2LKSA 4NXYA 1Z6RA 5D6EA 2WPXA 1SGRI 1YYVA 2FX0A 2QKLB 4ITVA 3WE2A 1D0ZA 1QA6A 3OYAA 4BD9A 2B4DB 1XGOA 3QAYA 1PYVA 4OC3A 1P7IA 1OR7A 3BQYA 1FNOA 2JUGA 4CZCA 5LFAA 3IKVA 4KN7X 2M4GA 2A07F 2MSYA 4I98B 4F9VA 2L0KA 5D5VB 2ETHA 3HDDA 2CO5A 4Y3OA 2R7RA 1ETKA 4RA2A 1FJLA 3VEPA 4WWVA 3D5RC 3I0TA 4JX5A 1IG7A 2VUMJ 1KBFA 2PMHA 3HSFA 1AWCA 2IRFG 1CPXA 5LRSA 2PC1A 1CF7B 3ZQCA 2M8GX 4CGZA 2AFMA 1PYTB 1NG7A 2YNDA 2O7OA 4QBJA 2HB6A 2FU4A 4RUHA 2KIFA 4CCOA 1X12A 5A28A 2IP2A 4GGGA 1A36A 3FZVA 3GTGJ 1XRYA 1B1BA 1YJWI 2Z11A 4XN0A 1R5ID 3ABTA 4FD7A 2PG4A 2VBWA 3LA3A 2PJ1A 1YS7A 1KQ8A 1A5JA 1TT5B 2E71A 1QHHD 2LDUA 4F9UA 3B2YA 4BL0B 1S7AA 1VI0A 4BGDA 3S2HJ 3GX4X 1Z8WA 2ZSHB 1FNNA 1X3ZB 4F52A 2JEVA 4MBUA 4MCSA 3S32A 2P8TA 1S7KA 3DPTA 4HF0A 5LRRA 3R5BA 3PUFA 5LHGA 3O2PE 4LIVA 2XIGA 3PNVA 3HXLA 3CC4I 1VQ4I 2X51A 4MNUA 2CFOA 5E1WA 1ZREA 2BUSA 1N75A 4HNUA 1NUBA 2CG4A 4P9FA 1BR4A 2OQRA 3IH4A 3NWTA 3HOSA 1E0EA 2IXSA 4AB7A 1SC7A 3GW2A 4M6IA 1U5TB 4V2GA 2M7AA 2GKRI 3HSEA 2CTBA 2V6EA 5FFZA 5M5YJ 2VPRA 5FUWA 2LF8A 1W5SA 1YE9A 4JX6A 3S2DJ 3DV8A 4S0HB 3D7GA 4M3EA 3IU2A 3PO2J 1B8IB 3BXMA 1RUOA 1MMGA 1IIDA 3M1EA 3B6CA 2IS1A 3DR8A 3FXRA 3Q9SA 2DPSA 1XMXA 4MQ9F 2A6HF 2OR4A 3GTKJ 2R5YA 3CDHA 2R5ZA 3NA6A 3PP9A 4UVAA 1BAVA 3WTUC 3UNGC 4QSHA 3H9JA 2DK8A 1UVGA 3OL0A 1B87A 4FKDA 3GB0A 1HSTA 2G0BA 1UMQA 3GEZA 3FEEA 2CGPA 3KI9A 5K7ZA 4JK1X 3VSLA 2GM4A 2K40A 3D4UA 3TTHA 4LX9A 4G6DA 2Q4VA 4L8AA 3MD2A 2STTA 1RFHA 4MCPA 4EVYA 4ZX8A 1XEBA 1K7AA 2R7HA 2J9AA 2VI7A 4U7DA 3D7HA 4F91B 2CIJA 1CX8A 2AHQA 4GYIA 4ZY1A 2CF4A 1JHFA 3A02A 3ZOBA 3RPUA 5EEHA 4B6DA 4OMEA 4P4DA 3L2WA 4A39A 1HKTA 4A30A 2V4JC 2CV1A 2ZNZA 4BINA 4HYEA 5CPRB 4CA0A 2L8EA 3B3SA 1MDMA 1ZRDA 5FKNA 2VC1A 3CUOA 3KHZA 2GE3A 4IRIA 3LSIA 1H0ZA 3R9EA 2J5PA 2EIMH 2EZHA 2F2EA 3ZQ7A 5JHFA 5EDNA 1ON0A 2DF5A 3RTRA 3K0LA 5BWAB 2UZKA 3CF5F 2G7HA 2CUJA 3WU2C 1AU7A 4X0GA 2AFZA 2ZEOA 5LD2C 2LD5A 4I49A 4UUTA 2WY7Q 1T98A 4UFWA 3AG4H 1VIXA 2WTEA 5AONA 1OLTA 1JXSA 5LRKA 4L5IA 4XNHB 5D8NA 4AG7A 1W36D 4AUXA 2IAIA 4D5FA 2HQNA 2BY1A 4G7OF 2FBKA 1YW8A 3TO7A 4IKFA 5CVVA 3JRGA 2N71A 1ETVA 4I09A 5DM6F 4WCGA 1SVLA 5LRJA 3WTVC 5EJCA 4AIKA 2CU7A 4O3MA 4NJRA 3CC7I 3WGHA 2OCEA 1XMAA 1JUSA 4MHGA 5A2QK 3SJFA 1GVJA 1LAPA 4PFOA 3D8PA 2A61A 1R5HA 2OD5A 4CAFA 2HWVA 2NVYJ 3K2AA 3IC7A 2YQPA 4F0XA 1F5TA 3FX6A 2F5VA 1UHAA 5KTDA 1ZG9A 2GIVA 2R4GA 3DKWA 3HHHA 5DS9A 1Z91A 3QB8A 1QO0D 3LFUA 4HSTA 1X1CA 1X2MA 3D0SA 4Y15A 2ODDA 3QYBA 1YREA 5F1RA 4P4EA 4E6KG 3DXJF 2YX4A 5ICCA 2KMQA 2LH9A 2G9WA 1VHSA 2D4PA 4XKVA 1LE8B 3KYCB 2REEA 2M8EA 3FF3A 2QF7A 1CHOI 3FVLA 4KUMA 1IOFA 5GCNA 3ZP5A 2NSMA 1V1HA 4R3LA 5FUXA 4UY8I 4U0WA 3P9IA 1EF4A 2K5TA 1WKXA 2SGDI 3NE8A 3MKYB 1K6YA 3OOUA 5BPIA 3LSMA 3ZGKA 4PQAA 4WJBA 4CAXA 3DU5A 1MJAA 3DBRB 1V1IA 4CCJA 3FH4A 3TT2A 1MBJA 1XE4A 1Y8QB 3BPVA 2OC6A 1Z7LA 2V7FA 5E3LA 2QQCA 5GAEJ 2WYRA 5EC4A 3MFKA 3DP7A 3I54A 3OXGA 2RGVA 4HDVA 4A3JJ 2QSGX 1ULYA 4ANJA 2NYXA 1HW5A 4JYKA 3K2KA 1FP2A
chains in the Genus database with same CATH topology
1YVOA 2B5GA 5CLSA 4EQQA 2R3SA 1J0RA 3KFWX 3DQVC 3CUQB 4AWXB 3LA7A 2CYYA 2I79A 4HLYA 5K5QA 5IT9K 5AGEA 3FF5A 2K86A 1ZRCA 2MC3A 4L9NA 4KFCA 2Z10A 2MD5A 1O3TA 4ZBGA 3KZYA 4XLNF 1EH7A 4KN4X 3E6CC 4FT8A 3E3VA 5HS7A 4L9TA 5CVIA 2E7WA 2IL4A 1R22A 1YLEA 4I0BA 4A32A 2QECA 2EFOA 1WWZA 5CNPA 2QYOA 2XGXA 5AG4A 1V3FA 3W6XA 2QMLA 1FBQA 2IA0A 2D1HA 2K4JA 4B10A 5AG6A 4I7HA 1GHCA 2F5DA 5EBVA 2EFNA 2LNBA 1XCVA 2VODA 2ESNA 3LD2A 5FB2A 4GO1A 2ISZA 3I4PA 2PBIA 2FA5A 3GXOA 3RPQA 5LEKA 1XMTA 5HOOA 5E1ZB 4MFLA 5HLIA 5HMNA 5J8CA 4RB0A 3SXNA 1SFXA 2L54A 3QPTA 2JRTA 1XSVA 1W5TA 3K69A 4KA4A 3MGDA 1BIAA 4OIQF 1XCBA 1DUXC 1MKMA 2OZGA 1CGPA 4ESFA 2HKOA 5F47A 3WODF 3ZMZA 3RKYA 5D8LB 4F0YA 3H3ZA 1LB2A 3WR7A 1HQCA 2HTJA 5HS9A 5CVRA 4WF2A 2F5EA 4PV6A 1A04A 4UFVA 3ABUA 1KYWA 5D4RA 2NMTA 5ICEA 3F0AA 2YU3A 4ENJA 1R5GA 3ZJ0A 2IA1A 3E5QA 4RAYA 2B3VA 4M85A 2YR2A 4UCMA 4C2YA 1T6SA 1FPQA 5F49A 2IW5A 3PGPA 3DEUA 3HUGA 4O6JA 3T90A 2ELHA 1WI9A 2IT0A 1XGMA 4I01A 1W4MA 1SAXA 3DFGA 3VOEA 1KZFA 1QNTA 3DDDA 1HKQA 2YX7A 3TDZC 2D45A 1XN7A 1QZYA 4EGYA 2HYFA 4KORA 2D1VA 5AG7A 3WU1B 5ILVA 4P5OA 1ZG1A 5D8KB 1RZ4A 1ZRFA 1J7KA 1LDDA 2V1DA 3BJAA 2W85A 3IWGA 5ISVA 4UVBA 2JDDA 2Z33A 1IB1E 4FD5A 4H6ZA 3SHFA 2XAHA 2WWYA 1KU3A 5H20A 1REPC 3MZHA 2FE7A 1F4KA 4U9ZA 4A5NA 3K1NA 5CVJA 2VC0A 2YGWA 3TGNA 4ZH4F 1I12A 1BO4A 4PK3A 3W6SA 2PR1A 2NAZA 3GFLA 1P4AA 2LF7A 4KSAA 3R96A 4HLXA 3TKYA 3ZPLA 2DK5A 2XUBA