1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Esa1 protein
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
2LSOA 1NSLA 1IB1E 4QC6A 3FRMA 2QVOA 4MEYF 1Q2CA 3HRUA 4M73A 1OPCA 4FHTA 1ZH5A 1FSHA 4U5YA 3IHUA 1QNTA 2CWEA 4P9FA 2UXNA 2IJLA 1USTA 5FFZA 2OZGA 1UHWA 3IWFA 1KU7A 1HW2A 1UHMA 4RB3C 4KFCA 2KKOA 3PP9A 4HX4A 2M30A 2R3SA 3L7WA 3S6FA 1FYKA 1MD0A 2XAJA 3GWZA 5F6FA 2PN6A 3V4GA 1YYVA 1YW8A 4LG0A 1SAXA 1J2XA 4M85A 1G4DA 4L8AA 2HV2A 3L2CA 5DWNA 2RN7A 2ZNZA 5IX3A 1WQ2A 3KZZA 2HKXA 4RAZA 4JXQA 5F49A 4FD7A 4MNUA 2XKPA 1T0FA 3M7GA 4CXFA 2CQKA 2P6TA 3ZJ0A 2JRTA 2B5GA 1ONVA 4BYYA 1HQCA 1B87A 5ILVA 1CGPA 2D45A 1O7LA 4EM1A 2FF4A 4U9ZA 4Y17A 3FM5A 2K5TA 5HS9A 1UFMA 2EFPA 1HSTA 1U8RA 3COAC 4PCQA 4KOWA 4KOTA 5JHUA 2V1UA 5D5VB 1HSJA 3WU1B 5KK1A 3WTZA 5HDKA 4LD5A 1XD7A 2QM3A 3P7NA 4U9YA 2OQRA 1XE4A 4ZBGA 4HNXB 1MGTA 1USSA 2EK5A 3D0SA 1TLHB 2H27A 3DR6A 3IC7A 1T39A 2O6GE 1XSDA 2LF8A 2I79A 1KQ0A 1BC7C 4KN7X 4UA3A 4EJVA 1XGMA 2G9WA 2M87A 2BUEA 4TV7A 1BC8C 4UWIA 4KIGA 2Z99A 2FMYA 3ZMSA 5CVUA 3KETA 1ZGAA 3CUQC 4NQWA 5FFXA 2B4BA 1B9NA 4I01A 2P6EA 3RTRA 3L09A 1QSTA 4K30A 2EV6A 4LK0F 2JEVA 5D5XB 3GYHX 3F8FA 2DXQA 4D0PA 1CF7B 4R79A 2L02A 3R9EA 1LQ1A 2HTSA 4G6DA 3R61A 1HBXG 3GEZA 5BPIA 4OIPF 3FHZA 1M4DA 5D4SA 3LA3A 2DI3A 2EJRA 3ERED 3ISPA 2Z11A 3RI4A 2QMLA 4HW0A 4OIOF 1J75A 2V9VA 5EEHA 1GXPA 2B0LA 1TW3A 1MDMA 3GVAA 4LFUA 1R5HA 3SXOA 1JXSA 3I54A 2VONA 3IRRA 5F1RA 3K2ZA 1SD5A 1PP7U 3S6HA 4AIHA 5E96A 3FB3A 4EV0A 3J80K 3S6KA 2LKPA 2Q04A 2R98A 2W25A 2ZW7A 4ONUA 4KA4A 5ED4A 2R1IA 1ZHFA 4H6UA 2R7DA 2X7BA 4HLYA 1YQAA 1XSXA 2DFIA 4F7ZA 2CW0F 2JPCA 2OZUA 3CXQA 4M72A 4KUBA 1SFEA 3V7RA 3I5UA 4M9XA 1YK3A 1U6GA 2VEZA 4AVCA 3PGPA 5L3FA 4CAVA 3KP3A 1OYWA 3WTSC 3SXYA 4U0YA 3BLNA 2P6GA 1A04A 1KUXA 2QQ9A 3CXPA 2HQYA 3P2HA 2DK5A 2LDUA 3NEUA 1XF8A 1QPMA 2OH1A 4H89A 1YR0A 2G3TA 2G7UA 4HAMA 2YPRA 1B9MA 2STTA 2HWVA 5H6QA 4M71A 5TRDA 2FT0A 3T1BA 3BWGA 2DPDA 3C26A 1R1TA 2XAGA 1T98A 2V1XA 4AVPA 2VOOA 3RYPA 3V7CA 3JTGA 4BXUA 4U0VA 3C1DA 5ISVA 2VXZA 3JW4A 1I1GA 2PBIA 1S3JA 1I21A 1KA8A 3V8IA 3EY5A 1KU2A 2E7WA 2YX7A 1RXTA 5AIQA 1Q2YA 3R95A 2FNPA 1VKCA 1O57A 4G7HF 5L3GA 3L9FA 1U5TB 4I49A 3E3VA 2Y48A 3HHGA 3EO4A 1S8NA 2NAZA 4MI4A 1XDSA 3HUGA 4OIQF 1GXQA 4ENJA 3TGNA 3LQQA 2FCKA 3T8RA 1IXSB 1Y7RA 5LGNA 4MBUA 4B5PA 4LK1F 3DR8A 2ZJ2A 2OA4A 3SXNA 4M9ZA 1GVJA 1ZRCA 5HH1A 5LLQA 1YX0A 3WTVC 1OYIA 1X3UA 3HOTA 2VBZA 1QQIA 4II9A 5DUKA 1T38A 5IB0A 3F6OA 2H6CA 2O3FA 4HNWB 4ENMA 3FZVA 3H92A 1S60A 2R8VA 1B6BA 2Q7BA 4A0YA 3E6DA 4DQ2A 5EC4A 3R4KA 3G3ZA 4ZZLA 2Y0MA 1STZA 3DP7A 3I53A 2QENA 4UBRA 1W7PB 2WV0A 2L4MA 1MK4A 4AVBA 4HA8A 2HKOA 5L3DA 2J8RA 4MY3A 2XAQA 1LJ9A 2HQRA 4CYDA 1LNWA 4PK2A 2ISYA 4BQAA 2K4BA 5DV5A 2WPWA 2AJ6A 3MZHA 3PFIA 2DLLA 5CVJA 1Z7UA 2MLKA 4EJTA 2PDOA 1TTYA 1FBSA 2W85A 3J81Z 4UVCA 5DEQA 1Z6RA 5CVRA 4Q47A 1FBQA 4WF2A 2HQNA 2DQRA 3HSEA 1I1DA 3KE2A 3EUHA 4ESFA 1S7FA 2REEA 1GHCA 2CG4A 3HTSB 3IRQA 1YFHA 1F9NA 2WTEA 2O61A 1M4GA 1BO4A 2CFXA 5J6XA 3K1NA 2NRAC 5GCNA 1KZFA 3TTHA 1FX7A 3GF2A 1FNNA 4UV8A 4A6EA 1J9IA 4NCZA 2FNAA 1P2FA 4LB5A 2PRBA 2DK8A 4G7ZF 2G3AA 4G9YA 1BI2A 1I12A 1E17A 2XROA 4S04A 1YREA 5K5OA 1G3SA 4FX0A 4AD9A 1W5TA 2RKHA 4Z2YA 4IRGA 3BOQA 2FIAA 4AG9A 3KP5A 1Q1HA 4E70A 4HLXA 4YFNF 1F5TA 4MJ8A 4AB7A 2VXKA 5HS7A 2HYFA 4ENKA 2NYXA 4L9JA 2FSWA 4Y49C 4YGOA 1BJAA 3BJAA 2VC0A 5DD8A 2G0BA 5LGTA 4MTEA 4PGHA 1S7AA 4HX7A 2EA2A 2VZYA 5D8LB 5E17F 4KZTA 4L89A 3DF8A 3V8KA 4H6ZA 4JQFA 2FXAA 5TJJA 4E0AA 4I0BA 1RI7A 1LDJA 2IP2A 4J3GA 1J0RA 2FBIA 1SD7A 4HZFA 2ARHA 3G73A 1J7KA 4KLVA 1FBUA 3BDDA 1S7LA 1QZYA 1ZAOA 1MKMA 2BGCA 2AS5F 1ZG3A 2UZKA 3LWFA 3G8WA 5HDGA 3HHHA 2ZBKA 4BH9A 2H09A 2QZ8A 1BI1A 3W6JB 5C88A 5FB2A 2HR3A 3GX4X 3DNSA 3F8NA 1YS6A 3N7ZA 3FMSA 4PV6A 1TNSA 4L9TA 4E8OA 1CM0A 1B6AA 1HKQA 2ZW4A 4OINF 2ZKZA 2D2WA 3F23A 4R1HA 4LLGF 4AIKA 2PSWA 4PSWA 4U0WA 3DPLC 1Z4EA 3FYNA 3F6VA 1R22A 4ZYGA 1WWXA 3CXSA 1BN5A 4FX4A 1R7JA 4ON0A 4QB9A 2QBYB 4IHSA 4RGXA 4WXCA 5F64A 4MQVA 3D5LA 3BJ8A 4I7HA 4FT8A 3ABUA 1I1SA 3T0YA 4ETSA 1XGSA 2VBYA 2EFQA 1NMTA 5F47A 3TO7A 1J4JA 3ZN0A 3C18A 3B73A 4E2AA 5L3BA 3R9GA 3D3SA 5FLXZ 4KIFA 5D6FA 1CF7A 1O7FA 2FE7A 5E1ZB 4AWXB 3I4PA 3VB2A 2MA3A 1QZZA 3JAMZ 4XPKA 2A5YB 3E5XA 3TFYA 1J5YA 1HKTA 2Y75A 4KYWA 2YX4A 1OR7A 1SFXA 3P9KA 4HBLA 3S6GA 1FLIA 3MFKA 2HEOA 2J8NA 3DPTA 4OLLA 3F8KA 3I59B 3MAJA 4FD5A 3JUWA 3RYOA 1PP8F 3B02A 5H20A 2LF7A 1KUYA 2RC4A 2F5EA 2QQBA 4HF2A 4A5MA 4GYGA 4N9IA 4OAEA 2GA2A 3KP4A 2IA0A 1FYLA 2P7VB 4RGRA 3EXNA 2AXLA 3V8JA 2G7HA 1R23A 4EJWA 3F72A 1D5VA 1K78B 1SFUA 2ESHA 1IUYA 1FYMA 2R7HA 2ADUA 3WTTC 3KZYA 2MH2A 1F4KA 1V0CA 2VOPA 2DW4A 4ASNA 3TO9A 1LEAA 4HDUA 1P92A 3D2MA 1M4IA 2OBPA 2L01A 3KP6A 3KLOA 4YG2F 3LAPA 2IT0A 3WE3A 1BM9A 3ZMVA 1T2KA 1REPC 1WI9A 3BJ7A 2DBBA 2VE9A 2RGVA 1WSUA 1O3QA 4NF1A 2ZW6A 5HLIA 4IHTA 1EV7A 1TQIA 1YVOA 2JZYA 3O3KA 4EJUA 3T5XA 3G3SA 3RKWA 3QU3A 4O5VA 3TT2A 4WWCA 3R60A 1IW7F 2LNBA 4B8XA 3GO5A 1BI0A 1RUNA 1UFHA 2D4PA 1WK4A 3E0KA 1S29A 1KGSA 2QYOA 3K1PA 2P0WA 2C27A 2V6CA 4JXRA 1EH7A 2VC1A 4Q4ZF 3CTAA 2FXFA 4JBAA 1VHSA 2Z3YA 1JHFA 3EFAA 1ZLKA 4L9NA 1D8JA 3R96A 4EQQA 4LX9A 2FOKA 3JSOA 1Y9WA 1PDNC 4LLNA 2EB7A 2CO5A 1ZREA 1KU3A 4GS4A 1R57A 3W6KB 3MWMA 2D1VA 1H9TA 3CLOA 2B3VA 4KVXA 2VE8A 1YVKA 4IVNA 2EFOA 4G8XA 1ZRDA 1QSRA 4HQEA 5DUIA 5A2QZ 1IN8A 1U5TA 1JHHA 3FNCA 3W91A 3FXTA 3SHFA 4HOBA 4N9HA 5HOOA 3F22A 1SMTA 2EFWA 2E1CA 1SD4A 1QBJA 4XRFA 4B5OA 4R3LA 3TCVA 2KIUA 5ICGA 1YS7A 2IA2A 2DPUA 1QSNA 1JE8A 4P96A 2P5VA 3K9TA 1R00A 2F5CA 2XVCA 1YLFA 3O6BB 4KN4X 4MGRA 5LRRA 4RGUA 1GHEA 3GFIA 3QB8A 1YIOA 4M74A 4BHBA 3ECOA 5KTCA 1KQ8A 1XSVA 4KNYA 3QP6A 2VN2A 4KORA 4AVAA 2Q8KA 4JLYA 4L0ZB 1S7NA 4XNHC 3C3WA 1ZN2A 4KOYA 4N0BA 4ZZDA 1ZG5A 4Q48A 4HKFA 4KOVA 1LB2A 2JLMA 2IRFG 4G94A 1PUAA 2GANA 4RS8A 3ZN1A 3TDUC 4F6AA 4NXYA 2Q2EA 1FP2A 2UWMA 4Y13A 4OU0A 1V4RA 1W7PA 5ILUA 5LEKA 4QVTA 2ZMEB 2HGCA 1U6MA 2A69F 4MY0A 5H84A 4L5IA 2REFA 4G6QA 3QPHA 3CUQB 1PUEE 2PI0A 4BHPA 5LRSA 3JSPA 2VI7A 4I02A 1MJ9A 1OMIA 2K7LA 4WXHA 1NHAA 4PDKA 3R9FA 4UHTA 5DD4A 2XASA 3GW2A 4OIRF 3V7SA 1MJBA 3JTHA 4WXDA 4HDVA 2JDCA 5D6EA 3RIRA 2CGPA 2B4DB 1P0HA 2GE3A 4XPDC 5E18F 2Z10A 3ZQ7A 1Z9CA 1XMTA 3EDPA 3TOAA 4YIFA 1Z1DA 3K0LA 3ZPLA 5ICFA 3VWDA 2IL4A 3I58A 1ZARA 2IW5A 2W57A 4IRHA 5E1XA 4HNYB 2JPBA 4RB0A 4EJOA 4BMHA 4B09A 1AOYA 1TQPA 5EEGA 1BIBA 3MQ0A 1VTNC 3WGIA 1WRJA 3WE2A 3OWCA 4MTDA 5DCFA 3FIXA 3E97A 2CNSA 4YRHA 4M6YA 4FD4A 2B3UA 2CNMA 3CDHA 2CNTA 4CRYB 1PU9A 2BYVE 1RO5A 3H3ZA 3MEXA 4UUVA 3SZPA 2PMUA 5E20A 2BEOA 3IL2A 2DTRA 3HSFA 3H4QA 2HFHA 2PR8A 1FOKA 2KIFA 3KP7A 3MZYA 1U2WA 2O8XA 3FWEA 2FE3A 2QUFA 3GUDA 5ILSA 1YO5C 3GKRA 4KICA 4MHGA 1YW7A 1I6XA 2TDXA 5K5QA 2FBKA 4I0AA 2FMLA 4HV5A 4WX9A 5JFRA 5LHIA 2P6SA 5I0CA 4ESBA 3RPUA 3BPVA 3SZTA 3KP2A 5IV0A 5C82A 2XHKA 2HTJA 4A5NA 1F1ZA 3DV8A 1R36A 4YFXF 4K2EA 2I00A 2PQ8A 1TIQA 2R7FA 1XGOA 4IF5A 3KKWA 5CVVA 5DCMB 1ZYRF 4BAYA 2HYGD 3BROA 5LHGA 5LEJA 1DP7P 2CYYA 4NHJA 5H6RA 5DYMA 2RQPA 2O28A 2P8TA 2H5MA 1WKMA 4CAWA 1Z6TA 4KMUX 2EV5A 1KYWA 1G3YA 2E7XA 4EVIA 3M8FA 2BV6A 3WODF 4KUAA 4KIBA 3IKVA 3KEOA 2A3SA 2P5KA 2W84A 4XSXF 2RVCA 1D3YA 3VOEA 3SFZA 1R58A 1B4AA 1K6OA 4R57A 2QBYA 4ZYEA 4JJXA 4G7OF 1KYZA 3WTWC 4OMYA 5KVRA 1XEBA 3FXRA 2ZPAA 4MHDA 4NSQA 2JSCA 2Q0OA 2VODA 4KOSA 1Z9UA 3MCZA 5L3CA 2EFNA 2PC1A 2YR2A 2BEIA 2Q44A 1P4XA 5FGMA 4I09A 3ULQB 4EM0B 2MBFA 4HF0A 3F3XA 2D1HA 2W24A 5KTDA 2MLGA 3KFWX 3QAHA 2C6YA 1YTYA 1QO0D 2P5LC 3EYIA 4PSXA 5CJ9A 3F5BA 3DQVC 3I59A 3KLNA 3FF5A 1S7OA 1Q2DA 4R87A 1MJAA 5F48A 2ATRA 1IRFA 4DNCA 2Q4VA 2EA4A 2Z33A 2FEZA 3HRSA 3RKXA 2Z9OA 3GFLA 3GZ5A 2X0LA 1ZLJA 4QUSA 1IYLA 3GFJA 1K78A 2FS5A 4OOIA 3UY5A 2CY2A 3SHPA 5LBQA 4ORFA 3PQKA 5BPDA 4YFKF 5KTAA 3J80Z 1FWZA 5BOXA 4LMYA 3L00A 2BBYA 3PQJA 3FMRA 4CZZA 1H0MA 1TW2A 2H94A 2P4WA 3M9AA 2RDPA 5CYVA 4KLWA 3REOA 3U1DA 3WGGA 3D8PA 4A0XA 1XN7A 5ICCA 2ZXJA 3RKYA 3P2FA 1BBYA 4QWQA 2ZO4A 2VT3A 4HV6A 2PJPA 3O2PE 2FL4A 4FD6A 2XKOA 5FD5A 2H6BA 1UCRA 4R8HA 4GO1A 1CJWA 2JDDA 2HS5A 5D8KB 3Q9VA 4IRIA 1R1UA 5E8IA 2XUBA 1P4AA 4NB5A 5JQ4A 2PR1A 1G6NA 1W4MA 3BP8A 1FY7A 2FQ3A 3LA7A 4JK1X 2A68F 3LSTA 2Z0ZA 2ETHA 1S5KA 2MD5A 4XLPF 1FZPB 4A6DA 5CLSA 4KT5C 4Y49B 5HDNA 2K4JA 2K27A 5AIPA 1U78A 4IPAA 3WR7A 3E6CC 4BHCA 1LDDA 3ABTA 1Z4RA 2OB0A 3JVNA 2HZTA 2ACJA 1XDUA 3M8EA 5JPHA 2FBHA 3EYYA 5IT9K 2M8EA 3AAFA 3DEUA 3DFGA 2VQYA 2FSRA 2EV0A 1QSMA 3ZZIA 1MZBA 1YLEA 2HUZA 2OAZA 3R0AA 1KUVA 5CNPA 3CJNA 1IAWA 1WWZA 4PK3A 1LEBA 3T90A 4JWPA 3S2WA 1HW1A 3HIFA 1IIDA 1M44A 2JTVA 3J81K 3WGHA 2A6EF 3HRMA 4MQ9F 4AG7A 1TBXA 2OD5A 4RB1A 5HLHA 4UWJA 1ZG1A 1LDKB 3BY6A 3F8CA 2BSWA 4JD6A 2HDCA 4P9UA 2O03A 2VBWA 2IVMA 3DXJF 2OU2A 5DWMA 1ODDA 2A4NA 2J5OA 3ECHA 2J8MA 1IYKA 4PZJA 3E6MA 3I71A 2VBQA 2PLYA 5L3EA 1XB4A 1DPUA 2GAUA 1K79A 3NE7A 1ZGJA 2CSOA 2DU9A 2ZMEA 4Q5SF 2KRFA 3T8TA 3RDIA 2IA1A 2GA1A 2V79A 2COMA 3IWGA 1W5SA 3MGDA 1HXDA 1FC3A 3CUQA 2ELHA 4IXAA 1RIOH 2F5FA 1XMAA 3R1KA 2FU4A 4LG0B 2OQGA 1K7AA 4L18B 1S7KA 1ON1A 3FM3A 1G3TA 3FMQA 2A6HF 2EVNA 3I3GA 3KCCA 4BNCA 1B1BA 1U5TC 2B4DA 4LGWA 4EVYA 1B59A 4U7BA 5H86A 2B5GB 4LJZF 1FP1D 4CO8A 1XCVA 1R1VA 3VWEA 1Y9KA 3VFZA 2XV4S 3EETA 3F0AA 4XPLA 3B8GA 2VT2A 5J8FA 3GFMA 3HTUA 1FT9A 2GIVA 2PEXA 5HS8A 3ZP5A 5FVJA 3NQOA 2L3DA 2Z5UA 3ZMDA 5HMNA 2STWA 3K1MA 1D8KA 4XLNF 4KUMA 1IN6A 3U9GA 2KJCA 4WCGA 2GXBA 3H3UA 3QOPA 1OKRA 4LUAA 2PG4A 4UNOA 4KOXA 2Q0YA 1R5GA 3OOPA 2KIMA 3J7AO 3T9YA 3P9CA 3OV8A 1YGHA 2XAHA 4RS2A 4ENNA 3DSBA 2BE5F 2GQQA 3EC4A 3BJOA 3TKYA 4IJAA 2L54A 4CRZB 3RJPA 3PZJA 1ULYA 3P9IA 3WTYC 2ZXVA 3TDZC 5LHHA 1UB9A 2GWRA 4A0ZA 3SQNA 3VEPA 2F5DA 1NE9A 1DDNA 3HYIA 1H9GA 4S05A 4EM2A 3WTUC 2DQLA 4UXNA 4EGYA 5BMZA 4LB6B 5FLXK 4R3KA 3E6BA 1LRZA 3U2RA 1HKSA 1L0OC 3GYAA 3JAMK 1ON0A 4R9MA 1P4NA 1BIAA 1XIXA 3HOSA 1P4WA 1ON2A 1W7PD 1O3TA 4KMFA 4M3SA 2BL1A 3F8BA 3WTXC 4HX8A 2A07F 3DDDA 1DPRA 4EGZA 2L4AA 3ML6A 5D5UB 1FSEA 2O0YA 1XCBA 3NRVA 4X5KA 3W6XA 3TE4A 2K86A 4P55A 1Z05A 5DCMA 1MDMB 1QGPA 2P6FA 3TO6A 3LA2A 4XSZF 3HSRA 2DO7A 3CO6C 3FXQA 3ROUA 5BS6A 3I0TA 2EUIA 3TQNA 3WU0A 5DDGA 4CAXA 2ISZA 4HYEA 1IN7A 4OMZA 4M6XA 4EMSA 3LODA 3ELKA 1OYYA 4PGGA 1IN4A 2ZCWA 3BZ6A 4CGZA 4RAYA 1G3WA 2F2EA 3IGRA 4GCVA 5D4RA 2B58A 1C0WA 2WC2A 3ZMTA 1XMKA 3V8LA 2QQAA 1SQHA 3RPQA 5E8GA 2P7CB 4CDGA 1AWCA 3FX3A 3Q9SA 1IRGA 1KQ9A 2VZZA 1S3ZA 4F0YA 3QU6A 1T6SA 2V1DA 5HLGA 2QIRA 2DAOA 4U88A 3E5UA 1KU9A 2MH9A 4A12A 4ZYHA 1IICA 3ZMUA 3IWZA 2X4HA 4RI1A 4MEXF 2QWWA 4ZH4F 2OZHA 2YU3A 2NNNA 1N71A 4XNHB 3C7JA 1DUXC 5E1WA 3WG9A 1U3EM 1K4JA 2FRHA 4CICA 2HOEA 1IN5A 1O3RA 3CO7C 2UXXA 2DT5A 4HF1A 3F8MA 1BOAA 1RUOA 1IZ1A 5IT9Z 2XAFA 4CS0B 2J5PA 3HRTA 3KEQA 5LGUA 2ZFWA 5ICEA 3W6SA 4O6JA 5J8CA 3QPTA 4OADA 4GYIA 4KDPA 1I5ZA 3IKTA 2D4OA 2GXGA 2KCWA 1BI3A 3GXOA 5D5WB 3I9SA 3M1EA 5K1YA 1J59A 1IXCA 1EH8A 3N4MA 4A2UA 1IF1A 2YSRA 3K9UA 3BJ6A 1YW9A 2NNYA 4Y15A 1Y0UA 3EQLF 4IUSA 5A2QK 1M1DA 5FO5A 5BQTA 2E1NA 4XPDB 2PFBA 1Z91A 3K69A 2MC3A 1RNLA 4WK8F 4HQMA 4AIJA 2F5IA 4GGGA 4UV9A 4P5OA 1SD6A 2K02A 4LLLA 1LVAA 1TQMA 2JT1A 4L0YB 4B5PB 3LD2A 4ESJA 2FA5A 5FD6A 2GZWA 4IF4A 2A61A 3R6SA 3ZMZA 4KOUA 1P6RA 4O3MA 2ZW5A 5IT3A 2XGXA 1L3LA 2PMHA 4I2OA 1JGSA 1HW5A 5EBVA 2XRNA 3GLXA 5JVTA 2WWYA 2Q4YA 4KVOE 2VBXA 3LAJA 2QECA 4U7DA 2ESNA 2QLZA 1S6LA 1IXRC 4YIIA 2NS0A 5F46A 2KJBA 2XIGA 1XGNA 4XBFA 5HVQC 4UVBA 3TOBA 4GXOA 4UVAA 5JI6A 2M1BA 1E2XA 1YG2A 2EWNA 4ZYDA 1FPQA 4I98B 4NEXA 5AONA 1I27A 4YFJA 1BOBA 2NMTA 3R0JA 4KVME 4M9SA 2OZ6A 4L9VA 3D2PA 2M45A 4RGSA 2RNJA 2AE6A 2FIWA 2M5WA 1OZPA 3LFKA 3F21A 3N97A 3I64A 2RV8A 3RYRA 3BPXA 4QLCU 3QRFF 1O3SA 1V3FA 3CUOA 3FBUA 2ZNYA 1L0CA 3Q5FA 1QSOA 6PAXA 4RB2C 3GY9A 3FXUA 4QBJA 3E5QA 1SMYF 4H0EA 3DKWA 5K5RA 3LQRA 3QP5A 5JR3A 1EH6A 1ZRFA 3GZ6A 5ERIA 5CVIA 3VODA 2IPQX 1TNTA 1RZ4A 4CHUA 4L5JA 2WPXA
chains in the Genus database with same CATH superfamily
2H1LA 2LSOA 3BI1A 3IUOA 5B3SH 1NSLA 3ERMA 1IB1E 3OYLA 4QC6A 3FRMA 2QVOA 4MHPA 4MEYF 3JRAA 1Q2CA 1XFOA 3HRUA 4M73A 1OPCA 1QQ9A 2DFFA 2VB6A 1Z3XA 4FHTA 1ZH5A 1FSHA 4U5YA 2CUEA 4DYQA 3AG1H 3IHUA 1QNTA 2K85A 2CWEA 4P9FA 3HLPA 2UXNA 2IJLA 1M1EB 1Q9BA 1XX5A 1SAUA 3CCYA 3S3MA 3W2AA 1GV5A 3H8EA 4W9YA 4G12A 1USTA 5IYBJ 4XN3A 1U5KA 4KOXA 5FFZA 3MKZA 1Y0RA 2OZGA 2DA3A 4BD9A 1QRYA 1UHWA 3IWFA 1KU7A 1IY7A 4E2AA 1HW2A 1XA6A 2HU9A 5J47A 1D1BA 1UHMA 4RB3C 3BZKA 4KFCA 2KKOA 3E7LA 3PP9A 2JUGA 4HX4A 2M30A 2IGNA 1Z21A 5BWAB 1DS2I 2R3SA 4PJ0C 5EGOA 5K7HA 3L7WA 3CF5F 3S6FA 2L7FP 1BR4A 1MD0A 2XPWA 1FYKA 2OTLI 5EZHA 2XAJA 3GWZA 5F6FA 1TWHJ 2PN6A 3S93A 3V4GA 2YNDA 5AG6A 1YYVA 5GAHJ 1AN1I 1YW8A 4LG0A 1SAXA 3BG7A 1J2XA 4M85A 2HNHA 1G4DA 1PTRA 1H0ZA 4L8AA 2HV2A 3L2CA 1HCRA 1VQ5I 3HOWJ 5DWNA 2RN7A 2ZNZA 5IX3A 4ZTFA 1H8AC 2ZEGA 3KR4A 3B6AA 1WQ2A 3KZZA 2HKXA 4RAZA 4JXQA 1WH7A 5F49A 4FD7A 4BY1J 3D5RC 1QVUA 3ASNH 3B35A 3BR0A 4MNUA 2XKPA 1T0FA 3M7GA 4CXFA 2CQKA 2EZKA 2P6TA 3ZJ0A 3QAYA 4XL9A 3JRFA 4M6VA 1UVGA 1JTYA 2JRTA 2B5GA 1SVMA 2O4HA 4GM5A 1ONVA 4BYYA 3IJ3A 2A5WA 2O5RA 1HQCA 4BDYA 1Y39A 4UUSB 3GOXA 3S9MA 1B87A 5ILVA 1CGPA 1OVOA 2LBFB 2D45A 1O7LA 2BHYA 4EM1A 4OKOA 2FF4A 4K30A 3PIOF 4M3DA 5C3EJ 2QA4I 2DXIA 2ZEHA 3H5NA 1D5YA 2AFOA 4U9ZA 4Y17A 3FM5A 2K5TA 4CGNA 5HS9A 2F4IA 4XOPA 1UFMA 4I99C 3ZQFA 2CU7A 3JREA 2CWFA 2OV7A 2EFPA 1HSTA 2F4MB 5E79C 1U8RA 3BXMA 3COAC 3LL7A 4PCQA 5M5WJ 2V1CC 4KOWA 3CMAI 2EZIA 4KOTA 5JHUA 4C3HJ 2V1UA 3FEDA 1Y1WJ 4CA0A 3CCVI 5D5VB 3A9LA 1O4XA 3R5CA 1HSJA 5GTHC 5KK1A 3WU1B 2BW3A 3WTZA 4BE1A 5HDKA 1MMGA 3L2VA 4LD5A 2R5YA 1XD7A 2QM3A 3O8HA 3JRHA 1PJUA 3FSXA 4IX7A 3P7NA 4U9YA 4ZDOA 2OQRA 1XE4A 1U9OA 4ZBGA 5LRGA 3UGIA 3LMSA 4HNXB 5DAEA 1GYTA 1MGTA 4JYKA 1USSA 3VYSB 2VPLA 2EK5A 3D0SA 3MKWB 3VSLA 3Q0WA 1TLHB 5DS9A 2H27A 4A3BJ 1LANA 3DR6A 3IC7A 2RFHA 2WY7Q 1T39A 3PNVA 4MHNA 2O6GE 1XSDA 2LF8A 2I79A 1KQ0A 4MHYA 4B6ZA 3A03A 3OYJA 4PJMA 5F0CA 4H4KC 5IOZA 4KN7X 1BC7C 2QQ0A 2ZMEC 1WJ5A 4UA3A 1AHDP 3QYEA 4UFVA 1X1AA 4E1PA 4EJVA 3OYDA 1IC8A 1XGMA 2G9WA 2M87A 2UUZA 1R3NA 2BUEA 4TV7A 1BC8C 4UWIA 4KIGA 2Z99A 2FMYA 3ZMSA 5CVUA 3KETA 2JMWA 1ZGAA 2ECBA 2XDVA 2WA0A 3O8GA 1X4OA 3CUQC 3RQ4A 4PK4A 4NQWA 2X9DA 5FFXA 2XGEA 3S9LA 3ABLH 2B4BA 2AFUA 1B9NA 4I01A 4JX5A 2P6EA 3RTRA 3L09A 1QSTA 2GREA 2JZMA 2EV6A 4LK0F 4HNTA 1U8BA 4OAYA 1HEVA 2JEVA 2SGPI 2ANPA 5D5XB 4KITB 3F8FA 4LG3A 3GYHX 2E2HJ 2DXQA 1JTXA 2O9LA 4C3JJ 3M8JA 4D0PA 4A3EJ 1CF7B 4R79A 2L02A 3R9EA 3OR2C 1LQ1A 1F36A 2HTSA 1MMSA 3KL9A 1GLNA 4G6DA 1VHOA 3R61A 1HBXG 1NTCA 3GEZA 3SI0A 5BPIA 2DA7A 3GBGA 2JRMA 4OIPF 3FHZA 1M4DA 4P4IA 5JM6A 4BQQA 3CZ6A 5D4SA 3LA3A 3I9V2 2DI3A 4RDUA 2EJRA 3ERED 1TBOA 2ZEPA 2K9NA 3ISPA 3BJIA 4A33A 4EWTA 2EZHA 2ZSIB 2JVGA 5IP7J 3BG6A 3RI4A 3BT9A 3G2BA 1WPKA 1TGSI 2Z11A 2QMLA 1CBXA 3BG9A 2PJAA 4HW0A 1DE4C 1WJFA 2BXYA 4OIOF 5K8NA 2HC9A 1ZG8A 4GI3C 3QYFA 2Z3PA 3FH4A 3OIOA 1EF4A 1J75A 2RAEA 3RBUA 1P9QC 2V9VA 5EEHA 4MO7A 2B0LA 1TW3A 4PJLA 4XRSA 1GXPA 1MDMA 3GVAA 2ZEEA 2N52A 2MFZA 4LFUA 5TISC 1YRNA 4CZCA 2KDOA 2W0TA 2DF5A 1R5HA 4CAEA 3SXOA 1JXSA 1WH5A 3I54A 2VONA 3OL0A 3IRRA 2OCCH 1XRYA 5F1RA 3K2ZA 1SD5A 5EG0A 1PP7U 4AIHA 3S6HA 3K4MA 4OC2A 2AFMA 5E96A 1KZHA 3FB3A 1NK3P 4UFXA 1N13A 4EV0A 3AG3H 3J80K 1TUSA 4MFEA 2R5YB 1RESA 4KISA 8CPAA 1LFPA 3S6KA 4B3AA 2LKPA 2Q04A 3OYNA 3CCUI 2Y9ZA 5AGEA 1ULNA 1V1IA 3S16J 2R98A 2R7OA 2W25A 3H5AA 2ZW7A 4KA4A 4ONUA 3QODA 3FEEA 1VFCA 5ED4A 1OJLA 3ZQLA 1X1CA 1CSOI 1ZHFA 2DMQA 2R1IA 2R7DA 4H6UA 2PE3A 2X7BA 3DBHB 4HLYA 1YQAA 2E5NA 1XSXA 1FJLA 2DFIA 2CUZA 4F7ZA 1ETOA 2CW0F 3MKLA 5IP9J 2JPCA 2OZUA 1A35A 1SGDI 3CXQA 2NVYJ 4M72A 2ODDA 2PJBA 3ZR8X 4KUBA 1POGA 1SFEA 5GADJ 1ARMA 4RMNA 1MMDA 1BMOA 3V7RA 5CCMA 3A2KA 4UEFA 1MBFA 3I5UA 1IY6A 4M9XA 1YK3A 1U6GA 2VEZA 4AVCA 3PGPA 3DKYA 1PYTB 4CGOA 2M8GX 5L3FA 4CAVA 1K7VA 5CKTA 3KP3A 1OYWA 3IP4B 3WTSC 1BW5A 2K9HA 3SXYA 4U0YA 4UEZA 1I50J 2Y0SA 4QSHA 3BLNA 2ZB9A 3V42A 2P6GA 1A04A 3AL0B 1KUXA 2PJRB 4NGNA 2QQ9A 3CXPA 3KX2A 2HQYA 1BAVA 3P2HA 2DK5A 1KWMA 2LDUA 3NEUA 1XF8A 2Z16A 3HB9A 1QPMA 2OH1A 3H9QA 3CMEI 2QSFX 2N8GA 4H89A 1YR0A 2G3TA 2G7UA 2MYSA 4HAMA 1VQNI 2YPRA 1B9MA 2STTA 1JI8A 2HWVA 5H6QA 4M71A 5TRDA 1KUYA 3PFOA 3DCFA 1OMTA 2FT0A 3T1BA 1TBQR 3BWGA 2DPDA 2LC2A 2M7AA 2F7VA 1LUJB 2DFEA 4NDLA 2R7ZJ 3C26A 1R1TA 4C2ZA 2XAGA 2ZJRF 2KMUA 4FWUA 1T98A 2V1XA 4AVPA 4PFOA 2VOOA 3RYPA 1FT7A 4I6ZA 3V7CA 3JTGA 4NGPA 4BXUA 1IDYA 2FX0A 4U0VA 1CGII 3C1DA 3SI2A 5ISVA 3F0CA 2VXZA 2TCTA 2R7TA 3JW4A 1I1GA 2BCOA 3PB6X 2PBIA 3SJEA 5GTIC 1A5JA 1S3JA 1I21A 1KA8A 4TNUA 3V8IA 3EY5A 4R8FA 1KU2A 2E7WA 2L9RA 2YX7A 3OSGA 3G1MA 1RXTA 3DLAA 3IWEA 4PPZA 3WC6A 5AIQA 1Q2YA 2V4JC 3R95A 4CCMA 2CQQA 3IIBA 1ETYA 2FNPA 9ANTA 3LSMA 1O57A 4HG2A 4F3QA 4G7HF 1VKCA 5L3GA 4XORA 3L9FA 2XB5A 1U5TB 4C2UA 4I49A 3E3VA 2Y48A 3HHGA 3EO4A 1S8NA 2NAZA 4LOCA 3R5AA 4MI4A 3V7ZA 4F55A 2RQQA 5HI7A 1XDSA 1SVLA 2XEIA 2PJ9A 1TF8A 3HUGA 5JHFA 2BY0A 4OIQF 1GXQA 3I55I 2QPOA 4ENJA 1TT5B 1XMXA 3CQZJ 3TGNA 3VH9A 2ME6A 4BQNA 3B3WA 2QKMB 3LQQA 3BTLA 3PBBA 2FCKA 1ULMA 1SFOJ 3T8RA 1IXSB 1Y7RA 5LGNA 4MBUA 3QYBA 4ZJZA 4B5PA 4LK1F 3DR8A 2ZJ2A 2OA4A 2XC7A 3SXNA 4M9ZA 1GVJA 1TBNA 4H2KA 1ZRCA 1IW4A 3S3NA 5HH1A 5LLQA 1F2OA 1YX0A 1HEEA 3FHNA 4UEEA 2EWBA 3C2HA 3WTVC 3D7HA 5CCLA 1OYIA 1X3UA 5B66C 2VBZA 3HOTA 1QQIA 1LKXA 1CHOI 4II9A 2YGWA 5A28A 3WU2C 3M07A 3TJQA 5DUKA 1T38A 5IB0A 1S7EA 3F6OA 2H6CA 3PM1A 2V6EA 1OFCX 1XS9A 2O3FA 1UAAA 4XKVA 4HNWB 2BY1A 3GMEA 2I5UA 2PMZA 2XPUA 4RUHA 2KFDA 1Q7LA 4ENMA 3EPZA 3FZVA 3H92A 1S60A 4CYCB 2R8VA 1SGQI 3I1UA 1B6BA 2Q7BA 3HGGA 2EBIA 1LAMA 4P4BA 1YTPA 1ZG7A 1UZCA 2BVMA 1SGPI 4A0YA 5G21A 1ETKA 3E6DA 4DQ2A 5EC4A 3R4KA 3G3ZA 4ZZLA 2Y0MA 1Z8LA 1K7TA 1STZA 3DP7A 1G2HA 3I53A 2MSYA 2DOFA 2Q2EB 2C6PA 4HPQA 2QENA 4UBRA 1W7PB 3CCJI 2JA7J 2WV0A 2L4MA 1MK4A 4AVBA 3D7GA 3ZQIA 4Z65A 4HRIA 4X0GA 2J9RA 4HA8A 3VSKA 5G22A 2W1OA 1NG7A 2HKOA 5L3DA 1B8IA 2J8RA 3GLLA 4Y7NJ 2DYRH 2NU3I 4MY3A 2XAQA 2EH3A 2CRGA 1A6QA 1LJ9A 3E2IA 2HQRA 4CYDA 5GPCA 3MD2A 2YQPA 3D67A 1FOYA 2I8DA 4A95A 1PCEA 1LNWA 1LFBA 3BCBA 4FTHA 3SI1A 4PK2A 2ISYA 1K4SA 4AVZA 4BQAA 2K4BA 4MCSA 5DV5A 2WPWA 3GCMA 2DJNA 1RTQA 3AG4H 3D66A 2AJ6A 2AFXA 1MNMC 1X10A 3PB4X 4YWYA 1KBEA 3MZHA 3PFIA 3L1PA 4G1PA 2DLLA 5CVJA 5EJCA 4CUGA 1Z7UA 2MLKA 4CGMA 4EJTA 2F4OB 2PDOA 4UCMA 1I3QJ 3S1RJ 2L0KA 4XM3A 2LD5A 1TTYA 2VKHA 3BG5A 1FBSA 2W85A 3J81Z 4IHXA 3VDPA 1TKHA 4UVCA 5DEQA 1Z6RA 5CVRA 4Q47A 3BR3A 5F04A 1YX5A 1FBQA 4WF2A 4P4FA 2HQNA 3OWTA 2G9DA 3IH2A 2DQRA 1K4TA 4UIAA 2Q51A 2KMQA 3HSEA 1ELMP 3KE2A 3EUHA 1I1DA 4ZY2A 4ESFA 2V8DA 1A36A 2X6WA 1S7FA 2OJED 2HB6A 1GHCA 2REEA 2CG4A 3HTSB 3IRQA 1YFHA 2NU2I 2EK8A 4MFZA 1F9NA 1X74A 2WTEA 2O61A 1M4GA 4A3FJ 3HJEA 1Y8FA 1BO4A 2GU2A 4NJQA 2CFXA 5J6XA 3K1NA 5D8NA 2NRAC 5LRJA 3D00A 5GCNA 1KZFA 3TTHA 4OP4A 1FX7A 3UOEA 3GZNB 2PMZN 3GF2A 1FNNA 2L7MP 3HBLA 4E7JA 4PUSA 2XPVA 4UV8A 4A6EA 1J9IA 4NCZA 2FNAA 1P2FA 2J87A 4LB5A 4ZYQA 2BY2A 2PRBA 3PL8A 2DK8A 4G7ZF 2E5ZA 3H0GJ 2G3AA 4G9YA 1Z2IA 1BI2A 4BJ5C 1I12A 1E17A 2P81A 2XROA 4IQ4A 4S04A 1YREA 1IGBA 2DEAA 5K5OA 3NA6A 5LD2C 1G3SA 4FX0A 4RM3A 4AD9A 2GOMA 3AKZA 4GXHA 1W5TA 4FISA 3GTJJ 3IH3A 2RKHA 4XONA 4Z2YA 5CPAA 4IRGA 3BOQA 2FIAA 2KP6A 4AG9A 1ETQA 1TWFJ 3OL3A 2R0QC 3KP5A 2JA5J 1G8XA 1Q1HA 2YNCC 4E70A 3BI0A 4HLXA 4YFNF 2X6YA 1Y1VJ 1F5TA 4MJ8A 1V55H 4AB7A 4BEHB 4C2XA 2VXKA 4F0XA 5HS7A 2DYSH 2HYFA 2RB7A 4ENKA 2MW8A 2NYXA 2FSWA 3HZJA 4L9JA 2R4GA 2R7SA 3FC3A 1PCAA 2PJ4A 4Y49C 1BJAA 4YGOA 3BJAA 2NSMA 3LSGA 1YOVB 2VC0A 3ABMH 4X6AJ 4RM2A 2Q43A 3CDXA 1YX3A 3UEYA 5DD8A 4TWEA 2G0BA 5LGTA 4MTEA 3H9GA 2QSGX 1LE8B 4PGHA 3U1KA 3LSKA 1GDTA 2NYQA 3SGQI 2CV0A 1S7AA 3MEKA 1Z67A 4HX7A 2EA2A 2PCUA 2VZYA 5D8LB 3CP8A 3GTGJ 2JA2A 5E17F 1OCCH 2GBYA 2DIPA 4KZTA 3DF8A 1S72I 4IK2A 4L89A 3V8KA 2ID6A 1TP4A 1Z7LA 3BQYA 4H6ZA 3BTIA 4JQFA 2FXAA 5TJJA 2DDAA 4E0AA 4I0BA 1RI7A 2AFSA 4XK4A 1LDJA 1K83J 2IP2A 4J3GA 1J0RA 2FBIA 1SD7A 4HZFA 4C2MJ 4UUSA 2ARHA 3BZCA 3FXLA 3G73A 1J7KA 5HQ8A 4F91B 3FMCA 3QNVA 1FBUA 4KLVA 2LBFA 3BDDA 1OBRA 1S7LA 1QZYA 2VJ5A 3OIQA 3E59A 3B7IA 1ZAOA 2I10A 3TEDA 1MKMA 2BGCA 2EPFA 2AS5F 1ZG3A 1ULKA 2UZKA 2B9SA 2LLKA 2E1OA 5FKKA 1SC7A 2QQEA 1X3ZB 3LWFA 1CQTA 2ODFA 1ZELA 3C2BA 2CMPA 1WI3A 2PJCA 5HDGA 3G8WA 1FEXA 3GTOJ 3HHHA 2COBA 4R6TA 1UMQA 2ZBKA 4BH9A 4Q36A 4IHMA 1BA5A 2H09A 3CPXA 2QZ8A 1BI1A 2QYVA 3W6JB 5C88A 1VQKI 5FB2A 1YI2I 1V5FA 2HR3A 4HSTA 2EBJA 2V8VA 3GX4X 2YU9J 3DNSA 2R7UA 3F8NA 5IYCJ 3K7AJ 1YS6A 3OYGA 3HOXJ 2ZJQF 3N7ZA 2AFWA 3CC7I 1T56A 2VJ4A 3CLQA 1I39A 2CWHA 2X1CA 3WHCA 1XPXA 3FMSA 4PV6A 1ENHA 3D68A 1TNSA 4L9TA 4BDZA 1YMEA 4E8OA 2EK9A 1CM0A 4JCVE 1B6AA 1HKQA 2WY8Q 4A39A 2ZW4A 4OINF 2ZKZA 3KEYA 1WGXA 2DOAA 2WVJA 2D2WA 3F23A 4R1HA 4B1RA 1HDDC 4R76A 4LLGF 4AIKA 2PSWA 3SJXA 4PSWA 2VQCA 4E7IA 4U0WA 2AQFA 1ZR2A 3LSPA 1ACIA 4OC0A 1R6RA 3DPLC 1Z4EA 1J09A 1Y8RB 3F6VA 4WP4A 3FYNA 1R22A 4ZYGA 1WWXA 1Z8WA 4F92B 3CXSA 1BN5A 4FX4A 1R7JA 1VI0A 1TIHA 4FCYA 2GFQA 3D1NI 2ARPF 4ON0A 4QB9A 2QBYB 4XLCA 5DM6F 4IHSA 4SGBI 1ZLIA 4LQ6A 4NGMA 4RGXA 2DMPA 4WXCA 3TX8A 1YIJI 5F64A 5KAFC 4MQVA 5F1JA 2FQ4A 3D5LA 3BJ8A 2AQEA 5FKLA 4I7HA 4FT8A 4DOZA 3ABUA 1I1SA 2MG4A 3T0YA 4B43A 1XGSA 2VBYA 2EFQA 3Q3SA 4ETSA 1P7IA 3ZCOA 3B3SA 3KGQA 3S2HJ 1NMTA 2XF5A 4XRSG 5F47A 3TO7A 3PRTA 3S8PA 1J4JA 3ZN0A 3H8GA 3B3VA 2E60A 3HKZA 2V26A 3B73A 3C18A 1JT6A 3OY9A 1G59A 3M4OJ 1N78A 4UXJA 1BW6A 5L3BA 3RZDJ 1XJOA 3D3SA 5FLXZ 3R9GA 3RO0A 4KIFA 5D6FA 4N4OB 5KAIC 1CF7A 1O7FA 4M3BA 5E1ZB 2FE7A 3T8WA 1R43A 4AWXB 1T0FC 3I4PA 3VB2A 4C7IA 4FUUA 2MA3A 1QZZA 3JAMZ 4YRVA 2A5YB 1OCZH 3E5XA 4CCLA 4XPKA 3RKQA 3JTKA 3TFYA 1J5YA 4XICA 1HKTA 1LFUP 2Y75A 4Q7AA 4A3MJ 1VQ8I 2XF7A 3UKGA 4KYWA 2YX4A 1XBUA 4X3RA 2IXSA 4NGQA 1OR7A 1SFXA 9WGAA 3GIUA 3NWTA 3P9KA 4HBLA 4ZDLA 3NE8A 3S6GA 1FLIA 3MFKA 2XSDC 2HEOA 3DPTA 2J8NA 4OLLA 3QWPA 2PJ3A 2F8HA 3F8KA 3I59B 2K40A 2X6OA 3MAJA 5F08A 1YLOA 5B1AH 2Z3MA 3JUWA 4FD5A 3RYOA 1PP8F 3N05A 5M5YJ 2X3TA 5FUWA 3B02A 5H20A 3TL4X 1NK2P 2LF7A 1MBKA 3DTIA 1CPXA 2RC4A 2VQHA 2A05A 3EUAA 2F5EA 2CW7A 2MD0A 2QQBA 3CCQI 1B72B 4HF2A 4A5MA 2HQ5A 4GYGA 2QKLB 4N9IA 4OAEA 2GA2A 3PIPF 1TWAJ 4J19A 3FSYA 2R7VA 3KP4A 2IA0A 1FYLA 2P7VB 2R5ZB 4RGRA 4E7LA 1X19A 3ZOBA 3EXNA 2AXLA 3V8JA 4YU9A 1Z2LA 4CGPA 2LUYA 2G7HA 1R23A 4EJWA 4L5EA 4R7MA 3F72A 1D5VA 3HL2A 4FE4A 1K78B 4U87A 1SFUA 2ESHA 2YUUA 1IUYA 2LREA 1FYMA 2R7HA 2ADUA 2E19A 3BC8A 3WTTC 3KZYA 2MH2A 1X12A 1F4KA 1QU3A 5IYDJ 4FBEA 1V0CA 2VOPA 4J01A 3S9NA 2DW4A 4ASNA 5EMIA 1XBTA 1PUFB 3TO9A 2P6AC 2KCXA 1LEAA 4EEFG 4HDUA 2ORVA 1I6HJ 1X4PA 4DGWB 1P92A 2GVIA 4D7NA 3D2MA 4BXFA 1M4IA 2OBPA 3BLYA 2L01A 5KHDA 3KP6A 3KLOA 2Q1ZB 4YG2F 3LAPA 5HNHA 1NSAA 4ZY1A 3SJGA 3I4NJ 4DUKA 2IT0A 3FVLA 4XIDA 3L2WA 3WE3A 1BM9A 3ZMVA 1T2KA 1JKQC 1REPC 2V1CA 1WI9A 3BJ7A 1IRXA 2DBBA 4QIWN 2JJ7A 1M8BA 3WG7H 2VE9A 2RGVA 1H89C 4V19K 3PO2J 1E3HA 4A94A 4A69C 1WSUA 3KEOA 1O3QA 4NF1A 2ZW6A 1PYVA 4LIUA 3UNGC 1H88C 5HLIA 2M0MA 2AFZA 2CQXA 4Z6YA 1EV7A 1TQIA 1X1PA 4IHTA 1VGYA 1YVOA 2JZYA 2E1MB 4AXVA 4B4CA 4XOTA 3HKZN 2PJ7A 3BTCA 4MFQA 3O3KA 4I76A 4ZYAA 4EJUA 3T5XA 3TP0A 3RKWA 3QU3A 3G3SA 1Z0XA 4O5VA 2GXAA 3TT2A 4WWCA 3GB0A 2M2EA 3R60A 1WHUA 1IW7F 2LNBA 4XLHA 2PJRA 4B8XA 1OCOH 3GO5A 1BI0A 1SEUA 1RUNA 1UFHA 2D4PA 1WK4A 3DLLF 1GT0C 3E0KA 1S29A 1KGSA 2R7QA 1LOKA 2LYCA 2QYOA 2VASA 5TGTA 2P0WA 3K1PA 2C27A 2L8EA 1N25A 2V6CA 3VYUB 4JXRA 1EH7A 3H0DA 2VC1A 3VYRB 2M9HA 4Q4ZF 4A3LJ 4CCNA 1KMAA 3CTAA 3JRGA 2HDWA 4WJBA 2FXFA 4JBAA 2EIKH 3RNZA 3NFZA 4DBRA 2QQ8A 2Z3YA 1JHFA 1VHSA 3EFAA 2CQ7A 3CDIA 4L9NA 1ZLKA 4ZY0A 4P4EA 1D8JA 2NS7A 1NXUA 3R96A 4EQQA 4LX9A 2FOKA 1QHHD 3JSOA 2C6CA 3F9KA 1Y9WA 1R4MB 1PDNC 5DM7F 5HODA 2GIZA 2R93J 2UZ3A 3IO1A 3CCLI 1YITI 4CGLA 5H2FC 4LLNA 3OL4A 1CPSA 2JBJA 3DGVA 1CE3A 2EB7A 2CO5A 1ZREA 1KU3A 1MH4A 4GS4A 1R57A 3W6KB 3MWMA 2R7RA 2DMNA 4DIQA 2D1VA 1Y6IA 1H9TA 1F43A 5AG7A 2ROWA 1U9NA 2O7OA 4ZI6A 4UCPA 3CLOA 3A1YA 5J40A 2B3VA 4KVXA 1OCPA 2VE8A 1CT0I 1FOWA 1YVKA 3BCAA 2WSAA 4IVNA 1XG1A 2EFOA 4G8XA 1ZRDA 4NC6A 1QSRA 4JOMA 1XOVA 4HQEA 5DUIA 5A2QZ 1IN8A 1N75A 1U5TA 1JHHA 1Z3YA 3OYAA 2ABZA 3FNCA 2F5VA 3K6GA 3W91A 3FXTA 3SHFA 4HOBA 4RA2A 4N9HA 5HOOA 1YW4A 3F22A 4MMOA 1CT2I 1SMTA 2VUMJ 2EFWA 2XB0X 2V1NA 2E1CA 1SD4A 1QBJA 4N4NB 4XRFA 4B5OA 4D9JA 4R3LA 1ITYA 3TCVA 2QQCA 2KIUA 5ICGA 3UGDA 2X1DA 1YS7A 2IA2A 2DPUA 1QSNA 3GTLJ 1JE8A 4P96A 2PJ1A 4Q38A 1APLC 1QHGA 3S1MJ 2P5VA 3IAS2 1V1HA 4KSFA 3K9TA 2IAIA 1R00A 2OD1A 2F5CA 2XVCA 1YLFA 4XLAA 4E7KA 4ZTJA 2LTPA 3DTEA 3O6BB 4KN4X 4MGRA 5LRRA 4RGUA 3B4VC 2KLOA 2OCEA 3MN2A 1GHEA 2ZENA 3GFIA 5FKNA 3QB8A 1X2MA 1YIOA 4M74A 4BHBA 4G6TB 3CD6I 3ECOA 1FMVA 5KTCA 1KQ8A 4MFLA 2KRCA 1XSVA 2ZSHB 3QP6A 2VN2A 3UR3C 4KNYA 2Q8KA 4KORA 4BE2A 4AVAA 1FIAA 4JLYA 4L0ZB 4CYCA 1S7NA 4FETA 5HNFA 3OYKA 3C3WA 4XNHC 1ZN2A 4YEJA 4KOYA 4N0BA 2HPIA 4ZZDA 1ZG5A 4Q48A 4HKFA 4KOVA 1LB2A 2JLMA 2PIYA 2HQAA 3IU1A 5C4JJ 1ZQ3P 2IRFG 2Q7SA 1X2NA 4G94A 1TWCJ 4ZC3A 4C3IJ 1PUAA 2GANA 4RS8A 1W3SA 3ZN1A 2JEWA 2DCEA 3TDUC 4E6KG 3FIWA 1EJ9A 4NXYA 4F6AA 1DGWY 2Q2EA 1FP2A 2UWMA 3ISZA 2K9LA 4Y13A 4CH7A 4OU0A 1V4RA 1W7PA 3DLJA 1JJ6C 5G1ZA 3FX6A 5ILUA 3E1SA 5LEKA 5F09A 2L9SA 5JGFA 3Q0UA 2E73A 4ZGYB 4A3JJ 4QVTA 2ZMEB 2AXTC 2JVHA 2HGCA 4II3A 2A69F 1U6MA 3TP3A 2XRCA 4MY0A 3UFFA 4P1WA 1A6IA 5K7FA 3SDBA 5H84A 5J1UA 4L5IA 2CTBA 4CCJA 2REFA 4G6QA 3QPHA 1FMWA 4NNJA 3CUQB 5EDNA 1PUEE 1VNDA 2JSPA 2PI0A 3CZXA 4BHPA 5LRSA 2E71A 3JSPA 2VI7A 4I02A 2FUG2 3G6EI 1MJ9A 1OMIA 2K7LA 2CXAA 4WXHA 1IY5A 1NHAA 3A01B 4PDKA 4IQJA 5FRNA 2ICWG 3FKIJ 3KZIC 4UHTA 3B3TA 3R9FA 5DD4A 1TKFA 5EEAA 2XASA 3A0BC 3RCOA 1LR9A 5E3LA 3GW2A 4OIRF 3V7SA 3I56I 1MJBA 3JTHA 4WXDA 4BL0B 3OYBA 4HDVA 2DDBA 1S9HA 2JDCA 5D6EA 3RIRA 4ONWA 3HDDA 3HXLA 2YS9A 5GAGJ 2CGPA 1P0HA 5FKOA 2B4DB 2GE3A 4BU2A 3NH4A 1N77A 2HVSA 4ZDPA 1OQYA 1ZTRA 4XPDC 5E18F 2NVQJ 1UHAA 4HSRA 2ERWA 5CBMA 2Z10A 2Z3LA 3ZQ7A 2SGDI 1Z5RA 1Z9CA 4XMYA 1XMTA 2CIJA 5BNGA 4FQGA 3EDPA 3TOAA 1FIPA 2BHZA 1W1WE 1WJBA 3W3CA 4YIFA 4A3IJ 5AG4A 5I4MA 1A31A 1TC3C 1Z1DA 3K0LA 1IOIA 2QGUA 3ZPLA 5ICFA 3VWDA 2IL4A 4P4JA 3I58A 3OYMA 3CCRI 3IU2A 5G20A 5J1QA 2ZELA 3CT9A 1VQPI 1D1CA 1ZARA 2IW5A 3MVPA 1ETWA 4UXHA 2W57A 2IS4A 4IRHA 5E1XA 4HNYB 2JPBA 3OYFA 4B12A 3WC7A 4RB0A 1IOFA 1LCPA 3H1CA 4EJOA 4A3KJ 1RR8C 2H8WA 5E3NA 1HF0A 4BMHA 2CV2A 4B09A 1AOYA 1TQPA 5EEGA 1BIBA 3ZXSA 3OXFA 3JRCA 4E7HA 2X1EA 4AM3A 3MQ0A 1Y56A 1VTNC 3WGIA 1WRJA 4NBQA 3TW6A 4PQAA 3K4CA 1ZKGA 2F48A 3KYDB 3WE2A 1LAPA 1DP3A 3OWCA 4RAFA 4MTDA 5M3MJ 2VLAA 1VQ6I 5DCFA 2QJ8A 3FIXA 5ELYA 3E97A 1TOTA 2CNSA 4YRHA 2OUMA 5FJ8J 3NAUA 3NWSA 4M6YA 2N17A 4FD4A 2B3UA 2CNMA 3CDHA 4DW6A 1SANA 2CNTA 3PEIA 2LY1A 1AUGA 4CRYB 1HDPA 2BYVE 1PU9A 3BQZA 4OC3A 2WAFA 4B44A 1RO5A 4V2FA 1NUBA 4BEHA 1XTAA 4CPAA 3H3ZA 3I3LA 2VRWB 1V54H 3MEXA 4UUVA 5LYIA 5FUYA 4OMEA 3SZPA 2IS2A 2PMUA 5E20A 1KBFA 5LYFA 1R49A 5E3OA 4P6YA 3S1QJ 3DEWA 2BEOA 2HPMA 3HG9A 1LE8A 3VPRA 3IL2A 2F6CA 4F9UA 3ABKH 2DTRA 3HSFA 2NU1I 3KIOA 3H4QA 1V5GA 2HFHA 2RIJA 4XQFA 2VKVA 2OF7A 2PR8A 1FOKA 4FASD 1TL8A 2KIFA 3KP7A 1IO2A 3MZYA 1U2WA 2NOJB 2O8XA 3FWEA 2FE3A 2QUFA 3GUDA 5ILSA 2Y69H 5JLXA 5CQGA 1K6YA 1YO5C 1MBEA 1LFWA 3VARA 3GKRA 3MMYB 1HLVA 5F0HA 1NG6A 4KICA 4MHGA 1YW7A 1I6XA 3D7FA 2TDXA 2VI6A 5K5QA 2FBKA 3PUBA 1VQOI 4X1EA 4I0AA 2FMLA 4HV5A 5FROA 1ZR4A 3CMMA 4WX9A 2CS3A 5JFRA 1CP6A 1BL0A 1UWYA 2RNGA 5LHIA 3OXLA 2P6SA 4MCRA 4CYOA 4DBQA 5I0CA 1FTTA 7WGAA 4PJJA 3RPUA 2LP0A 3BPVA 4ESBA 3SZTA 1YHQI 1JGGA 2JYYA 3KP2A 1YW6A 2VQLA 3EUHC 3OMYA 2XHKA 2HTJA 5J1YA 1ZG9A 2IQ6A 1QPIA 2V53A 5C82A 4A5NA 3CXLA 2C6GA 2MGQA 1F1ZA 3DV8A 4BY7J 1R36A 1Y1CA 2QF7A 3VDXA 3JRUA 4YFXF 2FNFX 4K2EA 5HLTA 2ZXWH 2I00A 2PQ8A 1TIQA 2XRLA 2R7FA 1YQEA 1XGOA 5E3QA 1VQ9I 4DYRA 4IF5A 3KKWA 3K4NA 3QTLD 3N5FA 3G1OA 1EKEA 2FOWA 5CVVA 5DCMB 1ZYRF 4BAYA 2VXDA 2HYGD 3BROA 5LHGA 5LEJA 2ORWA 2C1CA 5A27A 4ZX9A 1DP7P 2CYYA 4FKDA 4NHJA 3CC2I 5H6RA 3LACA 2IS1A 5DYMA 2RQPA 2O28A 2DT6A 2KZVA 2P8TA 2H5MA 3FXJA 1P9ZA 1WKMA 2IEKA 2KDZA 1Z6TA 2A6TA 2M5XA 4CAWA 7CPAA 4KMUX 2EV5A 1KYWA 1G3YA 2E7XA 4EVIA 3OS2A 1WJCA 3M8FA 2M4GA 1VHEA 5J4VA 2BV6A 1WJEA 2AO9A 3WODF 4KUAA 4BBHA 1MMNA 4KIBA 3S32A 2L7KA 3IKVA 1UJ8A 1D0ZA 1WJAA 1X1BA 2A3SA 1BJZA 2P5KA 2W84A 2RVCA 1D3YA 4XSXF 4XN0A 3VOEA 1PTQA 2XEGA 3SFZA 1VQMI 1R58A 5JHWC 1B4AA 1K6OA 3P5JA 4R57A 2QBYA 4C2TA 4ZYEA 4Y4RA 2V9KA 2M3AA 3HOZJ 2OR4A 4JJXA 2ZJPF 4G7OF 1KYZA 2E35A 3SDGA 4BKXA 3WTWC 4W97A 4OMYA 3KI9A 5KVRA 1XEBA 3FXRA 2ZPAA 2WV1A 4MHDA 2HOAA 4NSQA 1TWGJ 4XKWA 3CMYA 1IGNA 2JSCA 1ZO0A 2Q0OA 3IEHA 4UIBA 4DYOA 2VODA 2H8RA 3TBIA 5M3FJ 2GM4A 1FOXA 3RQIA 4KOSA 5HXDA 1U0JA 1Z9UA 2PJ2A 5DS0A 3MCZA 5L3CA 2EFNA 2BO9A 1MSEC 3J7AY 2YR2A 2HI3A 1P9GA 2PC1A 1PVEA 2VL1A 2ZOGA 2VL8A 5LRKA 2PJ0A 2BEIA 2Q44A 1ZK8A 2L2OA 3PO3J 1BPMA 1JKOC 1Z7KB 1P7JA 2PJ6A 3KQZA 3OYIA 1P4XA 4Y33A 4I09A 5FGMA 3ULQB 4EM0B 2MBFA 4HF0A 3F3XA 2KMOA 2JK3A 1UVFA 2D1HA 4W1UA 2W24A 4XLEA 5KTDA 3IAM2 3M3YJ 2MLGA 3KFWX 3QAHA 2C6YA 1YTYA 1GVDA 2E34A 1R0RI 2SGFI 4PFPA 1QO0D 2P5LC 3EYIA 2DKVA 1WFXA 3BG3A 4PSXA 3J7ZI 5CJ9A 2JA1A 3F5BA 3DQVC 3I59A 3KLNA 2ELKA 3S2DJ 4MFKA 2L7ZA 3FF5A 1S7OA 1Q2DA 4UF4A 2KIQA 2DOEA 4R87A 3ESWB 3ZQQA 1MJAA 2ZEOA 4RBOA 1ARLA 2ATRA 3MRUA 1IRFA 4DNCA 1B72A 2Q4VA 2EA4A 2KZGA 5F48A 2Z33A 3BR5A 2SGEI 2Z3OA 4CYQA 2FEZA 3HRSA 3RKXA 2Q4ZA 2Z9OA 2R5ZA 4WWVA 3GFLA 3GZ5A 1JUMA 3IFEA 2A20A 3BR6A 2X0LA 1ZLJA 4B3XA 2X52A 4QUSA 2DA1A 1IYLA 3GFJA 2Y9YA 1K78A 2FS5A 4QPOA 3ZGKA 4D5FA 1BLLE 4OOIA 1TKJA 4MXUA 1IG7A 3CC4I 3UY5A 2CY2A 3SHPA 1XC5A 2CH0A 3A02A 5LBQA 3J7YJ 2PJ8A 2KHMA 3JRDA 4ORFA 4F8ZA 3PQKA 5BPDA 4YFKF 2OVOA 4XNFA 1MBJA 3J80Z 3KHZA 5KTAA 3H36A 4M3EA 1LPQA 3W2WA 1PUFA 3UGLA 1FWZA 5BOXA 2GOXB 4CAFA 2BY3A 4LMYA 2ZEDA 3PSFA 3K2AA 1AKHB 3L00A 2BOAA 5FKMA 2BBYA 1UHSA 3PQJA 3FMRA 4CZZA 1H0MA 5JH9A 3K2KA 1TW2A 2DA2A 2ENZA 2NVXJ 4AC0A 2H94A 2P4WA 4UB8C 3HPHA 3M9AA 2PVWA 2RDPA 4B48A 4J00A 2LG4A 5CYVA 4EMEA 4KLWA 3REOA 3U1DA 3CJTB 3WGGA 1RKWA 3D8PA 4A0XA 3R5DA 1BR1A 3B2YA 2PJ5A 1XN7A 2TRTA 3QPSA 5ICCA 3PJRA 2ZXJA 2PX9A 4QTRA 4KS9A 3RKYA 3ZQCA 3P2FA 1BBYA 4QWQA 1W4RA 2ZO4A 1T33A 2VT3A 4BBSJ 4HV6A 2BOLA 2PJPA 1H8LA 1MH3A 3O2PE 2CQNA 1BR2A 2IBDA 2XAUA 3DKXA 3DU6A 3OOUA 1A2ZA 2FL4A 3NH5A 4FD6A 2XKOA 4AIDA 4PXDA 1AU7A 5FD5A 2H6BA 1UCRA 1E3PA 4R8HA 4GO1A 3LSJA 4RAGA 4MCPA 1CJWA 3MN8A 2JDDA 2HS5A 1OYVI 4IOAF 5D8KB 2ZOFA 4BINA 3SZGA 4DZPA 2X85A 3Q9VA 3X2QH 2JXDA 2HXIA 2HVRA 4IRIA 1R1UA 5E8IA 4IOCF 2XUBA 1SGRI 1WZ2A 1W0TA 1P4AA 4NB5A 2LK2A 1Z8TA 3TC8A 5JQ4A 3H8FA 2KQRA 2PR1A 1OR7C 1G6NA 2HXOA 1W4MA 3FF3A 2LY2A 3BP8A 4CSWA 4C2YA 1FY7A 2FQ3A 3LA7A 4JK1X 2A68F 3LSTA 1LR7A 2Z0ZA 2ETHA 3PB7X 2N71A 3FXMA 2EZLA 1S5KA 2LKXA 1ERDA 4B13A 2R7WA 5JLWA 2KISA 2MD5A 4XLPF 1FZPB 4A6DA 3WABA 4B14A 1RFHA 5CLSA 4CYNA 1UG2A 4KT5C 4GFBA 3GTKJ 5HDNA 2K4JA 3A4CA 3G1LA 4Y49B 2K27A 5IV0A 1D1AA 2EINH 5AIPA 1U78A 1DTDA 3V38A 1CGJI 4UUTA 4IPAA 3HUVA 3WR7A 2Y30A 3E6CC 4BHCA 4ZX8A 1LDDA 2IGKA 3ABTA 1Z4RA 3LSIA 2OB0A 3JVNA 2HZTA 2ACJA 3HM5A 1HA8A 2QSHX 1XDUA 3M8EA 1JWQA 2WUUA 4PXCA 5JPHA 2FBHA 3EYYA 1VQ7I 2M8EA 2JN6A 3OYCA 3DEUA 3AAFA 5IT9K 3DFGA 1D0XA 3EUKL 4A3GJ 2FSRA 2VQYA 2EV0A 1QSMA 4MPIA 3ZZIA 3A0HC 5C44J 5F0FA 1MZBA 2UVOA 1YLEA 2HUZA 1T08B 2OAZA 1QMUA 2PVVA 5HVGA 3R0AA 2KMPA 1KUVA 5CNPA 3CJNA 4P4DA 1WCMJ 1IAWA 1WWZA 3BR1A 1TF9A 1LEBA 4PK3A 3FKJA 3T90A 2KRHA 4HEA2 2V8HA 3S2WA 4JWPA 1HW1A 3HIFA 2BVLA 3SFIA 1IIDA 4X2TA 2ID3A 2HOSA 1M44A 4AUXA 3H35A 1YSJA 2GKRI 2JTVA 3J81K 1NH3A 1HPTA 1CX8A 3WGHA 2CTCA 2A6EF 3HRMA 4MQ9F 3CCMI 2EILH 1TBXA 1IJWC 4IHYA 3RSNA 2Z3NA 4AG7A 1AYEA 2HZDA 2OD5A 4RB1A 5HLHA 4IO9F 4UWJA 3CCEI 1ZG1A 2W48A 1JT0A 3RAMA 5K8MA 1LDKB 1WJDA 3BY6A 3F8CA 1SFKA 5DTDA 2BSWA 4JD6A 2HDCA 4P9UA 2O03A 3CJQB 2VBWA 1DS3I 2IVMA 4D5CA 2L9NA 3DXJF 4AYBA 5JVGF 4Y52J 2OU2A 3D2PA 5J4YA 2R7XA 5DWMA 1ODDA 2V7FA 2A4NA 2J5OA 3SEQA 4P44A 3L2RA 2HVQA 3S15J 4IHVA 4BJ6C 5HVHA 2N1AB 3ECHA 3S14J 2J8MA 3GLJA 3AL0C 3FJUA 1IYKA 4PZJA 2B7EA 4JZ0A 1RR7A 3E6MA 1TZLA 3I71A 2V9PA 2WAQA 3DTKA 2VBQA 3CPAA 2PLYA 3OIPA 5L3EA 4A37A 1QA6A 1X4SA 3TW7A 1XB4A 2PIZA 3I4MJ 2SGQI 4MRIA 4A3DJ 3RZOJ 1DPUA 3LMMA 3L2QA 2FD5A 2BXZA 1MBHA 2GAUA 4PXEA 3B3CA 2ZXIA 1K61A 1K79A 3NE7A 3PNTA 1ZGJA 2CSOA 2DU9A 2ZMEA 1YU6C 5AG5A 3LFUA 4Q5SF 2LEOA 2KRFA 3T8TA 4KJZA 2IMOA 4RLQA 3RDIA 2IA1A 3GTQJ 5EGOB 2DN0A 2GA1A 1PPFI 2V79A 2COMA 3IWGA 1MIJA 1W5SA 3MGDA 1HXDA 1FC3A 2CFOA 2ELJA 3CUQA 4O23A 2ELHA 2DA5A 2UV1A 4IXAA 1RIOH 2F5FA 1XMAA 3R1KA 4HPSA 2DTZA 2FU4A 2X48A 3VWBA 4LG0B 2OQGA 3VATA 3DU5A 3CJRB 4LITA 2CUFA 3W2VA 5F27A 1K7AA 3A01A 4L18B 4AU7A 3PB8X 2XEFA 4OC5A 4P10A 5LYDA 1S7KA 1ON1A 3FM3A 3GUXA 5FUVA 1G3TA 3FK7A 2A6HF 3FMQA 2EVNA 2JBKA 3KCCA 3I3GA 2CUJA 4E7SA 4NGRA 4NGSA 4BNCA 2G0EA 3QOEA 3K4KA 1B1BA 3OYHA 4IHWA 3WHBA 2DPSA 1OCRH 1U5TC 3IH4A 3Q0VA 4E4HA 2JW6A 4MIMA 4LGWA 2B4DA 4KSAA 5HVFA 4EVYA 1B59A 1YE9A 1OMUA 1SVOA 4U7BA 5H86A 1QVTA 1LVKA 2B5GB 4LJZF 3VE5A 1FP1D 3C2GA 2B63J 1SGYI 2L9VA 1D0YA 1XCVA 4CO8A 2Z2SB 2K5CA 2WAEA 1R1VA 1OCTC 1Y9KA 3VWEA 4JYWA 1E3OC 3VFZA 2XV4S 3EETA 2ME0A 3F0AA 3ASOH 4XPLA 3B8GA 2M0CA 2VT2A 4XR6A 3ZQHA 4DYCA 4XRMA 5J8FA 3GFMA 4B47A 3HTUA 3VDUA 1FT9A 3WC5A 2GIVA 4AYBN 2PEXA 3DBRB 5GPAA 5HS8A 3ZP5A 3NQOA 1K7UA 5FVJA 3DWLE 1R71A 2L3DA 2Z5UA 1QZEA 2POKA 4IL6C 1R4NB 4YIRX 4KSIA 4IZZA 3ZMDA 3HOVJ 2OTJI 5HMNA 2GLOA 3K1MA 2STWA 1D8KA 4XLNF 3JRIA 1S20A 4KUMA 1IN6A 3U9GA 2NS8A 2BW3B 2KJCA 2WAQN 4WCGA 2GXBA 3H3UA 4GDFA 1Y1BA 1F2PA 3FECA 1R79A 3CDLA 3QOPA 2NVTJ 1Y7EA 2WB1A 4BACA 1GV2A 1R5ID 1OKRA 1VZ0A 4LUAA 2VKEA 2Y31A 1MW7A 2LMDA 1ORKA 2PG4A 2ZXHA 3KYLA 3H5RA 4UNOA 4BXXJ 1DU0A 1R5GA 3HPGA 3OOPA 2Q0YA 2Z3KA 5IB9A 2M34A 2JA8J 2JUCA 2NOGA 4YELA 2KIMA 4EFDA 4NUBA 2IGMA 3J7AO 3T9YA 3P9CA 3OV8A 1YGHA 2XAHA 4RS2A 4ENNA 2JA6J 2W00A 2BZTA 3DSBA 3D4UA 3H3VK 3DPUA 4XKBA 4M6IA 2JWTA 2LY9A 4B11A 2IGOA 2BE5F 2GQQA 3EC4A 1CP7A 3BJOA 3K4JA 4Y3OA 3TKYA 4OIWA 4IJAA 2L54A 4CRZB 3ISXA 3RJPA 1MT1A 2XEJA 3OSFA 4MFPA 3PZJA 1ULYA 3P9IA 2O8KA 2RREA 3WTYC 1RPWA 3H9JA 1WTJA 1VDDA 2DA6A 2ZXVA 3TDZC 3ZQGA 4E1RA 5EF6A 4D7MA 3FDYA 1UUCA 1T8IA 5LHHA 1UB9A 2GWRA 3SYTA 4A0ZA 4B6DA 3SQNA 3VEPA 4FAIA 2F5DA 4NQWB 1NE9A 1DDNA 1HJAI 1X3WB 3BR2A 5CQEA 2QCOA 5E3MA 3HYIA 2DODA 1H9GA 4HGUA 5FUXA 4IAVA 2K9MA 3MZ8A 4ABZA 4EM2A 4S05A 3WTUC 4BJTA 2DQLA 2FJ1A 4UXNA 3IWWA 4A38A 4EGYA 1FYBA 2E2JJ 4OWRB 4M6GA 2WYRA 3HGYA 1TURA 1WGCA 5FRMA 5IPAA 5BMZA 4LB6B 1RRJA 5FLXK 2E36A 1Y0NA 1FNOA 3E6BA 2LRDA 4NC7A 3U2RA 1LRZA 4R3KA 5K7ZA 1HKSA 1L0OC 2DA4A 1RC9A 3GYAA 3JAMK 1ON0A 2L7XA 2M4KA 4P45A 2K9QA 1P4NA 1BIAA 1XIXA 4R9MA 2K3FA 3PFEA 3HOSA 1WVRA 1P4WA 3S1NJ 1ON2A 1W7PD 1O3TA 4KMFA 2NU0I 4A3CJ 4M3SA 2BL1A 3F8BA 5GP9A 3WTXC 2ELIA 5CPRB 4UFWA 4HX8A 2A07F 3DDDA 1DPRA 4EGZA 1W0UA 2L4AA 1UG0A 3ML6A 5D5UB 2GKTI 1FSEA 1HDQA 3FK6A 2EO8A 2O0YA 3QQAA 4M3FA 1WGTA 1XCBA 2ECCA 3NRVA 1CG2A 4OC4A 1EA3A 4BBRJ 3G71I 3JR9A 4X5KA 3W6XA 1ZLHA 1FTZA 2K86A 4P55A 1Z05A 5DCMA 1MDMB 1QGPA 3LWUA 3RZAA 3TE4A 4E7ZA 3NARA 1YRNB 2H1KA 2E2IJ 2HDDA 3TO6A 2P6FA 2WB1N 3LA2A 4XSZF 3HSRA 4BS9A 2DO7A 3CO6C 3FXQA 3ROUA 5BS6A 2DMUA 3I0TA 5LFAA 5M5XJ 5EG0B 4CCOA 1YJWI 2EUIA 2ZEMA 6CPAA 1MNDA 3TQNA 5J3LA 3WU0A 3DEEA 5DDGA 4C30A 2EIMH 1XMBA 4MHZA 4CAXA 5K8PA 2ISZA 1SGEI 4HYEA 1IN7A 4OMZA 4M6XA 4EMSA 3SJMA 3KQXA 3LODA 4NFRA 3ELKA 1OYYA 1I3AA 1IN4A 2ZCWA 4PGGA 4CCKA 3BZ6A 4DZJA 5FLVA 4CGZA 2DPTA 4RAYA 1G3WA 2B8TA 1HC8A 3BHXA 2F2EA 3IGRA 4B10A 1IU8A 1BPNA 4BGDA 4GCVA 2EQRA 2NVUB 2VPRA 3OS0A 3AG2H 2O53A 2MC4A 5D4RA 2B58A 2XF6A 2VIXA 2WC2A 1C0WA 3ZMTA 1XMKA 2XGDA 4FE7A 3V8LA 1V5EA 2QQAA 3MKYB 2GLFA 3PBEA 1SQHA 1BUSA 3RPQA 1IRZA 5E8GA 3CESA 2P7CB 4RLFA 4JX4A 3OR1C 4CDGA 1AWCA 3FX3A 3Q9SA 1IRGA 1KQ9A 2VZZA 1S3ZA 4F0YA 1MNEA 2Y0SN 3QU6A 4D1QA 3GTMJ 3HOYJ 1T6SA 2V1DA 2OPTA 4BUPA 4ANJA 2X51A 2CF4A 1M8CA 1YJNI 5HLGA 1CT4I 2QIRA 2DAOA 4U88A 3E5UA 1KU9A 2MH9A 2WADA 2WGCA 4A12A 1YJ9I 1M4LA 4ZYHA 3L2UA 1HDUA 1IICA 2VJIA 2AHQA 4XKCA 4C7HA 2CJJA 3ZMUA 3IWZA 4LQGA 2KPMA 1MSFC 2X4HA 2GLJA 4RI1A 2GKVA 4MEXF 4L9MA 2QWWA 3K4BA 4K3NA 4ZH4F 1IV6A 2OZHA 4A2ZA 2YU3A 2NNNA 1N71A 4XNHB 3KASA 2K3PA 3KPHA 3C7JA 1DUXC 5E1WA 3FISA 3WG9A 1U3EM 1K4JA 2FRHA 4CICA 2HOEA 2V8GA 1IN5A 1O3RA 2DFHA 3KHXA 3CO7C 4II2A 4OAZA 2KL4A 2NXNB 2UXXA 4DJAA 2D5VA 4UB6C 3HH2C 2DT5A 2X6XA 4HF1A 3F8MA 3GTPJ 1BOAA 3JRBA 2B0UC 2KT0A 5LYLA 4JX6A 4RN7A 1RUOA 1IZ1A 4PXBA 2MABA 5IT9Z 2XAFA 2W7NA 4A93J 4CYPA 4CS0B 2J5PA 3HRTA 3KEQA 5LGUA 3PB9X 4GRIA 4QPQA 4F52A 1SGNI 4A30A 2ZFWA 5ICEA 1RETA 3W6SA 3OVOA 4O6JA 2LR8A 3TMOA 5J8CA 1JKRC 3QPTA 3SGBI 3AFHA 4GYIA 4KDPA 4OADA 1I5ZA 4F93B 1TT0A 3IKTA 2FVGA 2D4OA 2GXGA 4NC8A 3PDNA 2KCWA 4X8IA 1BI3A 3GXOA 5B5EC 2E5RA 2OOTA 4DJLA 1W5CC 5D5WB 3I9SA 3M1EA 5K1YA 1J59A 3HOUJ 1IXCA 1EH8A 3IC1A 3CP2A 1X58A 2LVSA 3BTJA 4A2UA 4BE0A 3N4MA 2YSRA 1IF1A 2R92J 1T95A 2LB7A 3K9UA 3BJ6A 3L2NA 1MBGA 2Z1DA 1AKHA 1HOMA 5EX0A 1YW9A 2NNYA 1TXRA 4UCNA 1E0EA 1DU6A 3SEKC 4Y15A 1Y0UA 5E3RA 2YUSA 2EIJH 1VQLI 3K10A 3EQLF 1ETVA 4IUSA 5A2QK 1M1DA 3LSHA 5FO5A 3PFYA 5BQTA 1TBRR 3LSRA 2E1NA 4XPDB 2PFBA 3NH8A 4V2GA 2DT7B 1Z91A 3K69A 2MC3A 1IUFA 3FBNB 1RNLA 2LKSA 4WK8F 1XX6A 3HUGB 4HQMA 4AIJA 2F5IA 1MMAA 5J1RA 4GGGA 4UV9A 4P5OA 2NU4I 1SD6A 2K02A 3CF2A 4LLLA 1LVAA 3RPUD 4NJRA 1TQMA 4UY8I 3KZWA 3FXOA 2JT1A 3ZRGA 4L0YB 4B5PB 5KNLA 1OLTA 1F57A 1JUPA 3LD2A 3FBIB 4ESJA 3SJFA 2FA5A 5FD6A 2GZWA 3FXKA 2OC6A 3S17J 2PRQA 1VF9A 1W36C 2CV1A 3S3OA 1WKXA 2WCYA 4IF4A 4S0HB 2A61A 5IP6A 2V77A 5E3PA 3R6SA 5THWA 3ZMZA 2HYJA 2KMRA 4KOUA 4IEJA 1P6RA 1Z77A 2XSJC 4O3MA 1Z8XA 2ZW5A 5IT3A 2XGXA 3PNYA 1L3LA 2PMHA 4I2OA 1JGSA 1HW5A 3B6CA 5C4XJ 5EBVA 2XRNA 5K8OA 2CJSC 4OC1A 3GLXA 5JVTA 2LH9A 3LOCA 2WWYA 3R5BA 5FLMJ 2Q4YA 4KVOE 2CWGA 2W4SA 4M6HA 4XLFA 4MFDA 2F3CI 4IKFA 4LIVA 2VBXA 3LAJA 4MLOA 5EZGA 4U7DA 2QECA 2ESNA 2QLZA 3HC7A 1S6LA 2Y2ZA 3K70C 1IXRC 4YIIA 3CCSI 3E0JB 2NS0A 3HEFA 5EX3A 2YNCA 5F46A 2K9SA 2KJBA 2XIGA 2XGCA 5EYRA 3LNQA 2I3CA 4C68A 1XGNA 1DQUA 2CW8A 3PSIA 4XBFA 3W6VA 2ENNA 3H5ZA 2IS6A 2IJZA 4AMLA 3QWLA 5HVQC 4UVBA 3TOBA 4GXOA 4UVAA 1EE3P 5JI6A 4JP0A 2M1BA 3VYTB 1E2XA 1YG2A 1B8IB 4NGTA 2EWNA 4ZYDA 1HDLA 2ZFUA 1FPQA 4I98B 4NEXA 1KONA 5AONA 1I27A 4MFJA 3OYEA 1VIXA 4YFJA 3KR5A 1BOBA 2NMTA 4HNUA 3R0JA 3KY9A 4KVME 4A31A 4M9SA 2OZ6A 4L9VA 1R9TJ 1W36D 1LR8A 2ZEFA 2VJJA 3U21A 1Q1VA 1AA7A 2L5QA 5KCMA 2LFBA 2JQ7A 2M45A 4KT6A 5IY5H 1ZGWA 1IDZA 2QQDA 1AMPA 2J9AA 4RGSA 1GUUA 4HNVA 2QVPA 2RNJA 4A32A 1DGRM 1FARA 5B1BH 3M1CA 4A24A 2AE6A 2HOTA 2VKDA 2FIWA 2M5WA 1OZPA 3LFKA 4BQOA 3D5SC 2DMTA 4C9YA 3OS1A 3F21A 3N97A 3I64A 4OVOA 4UXIA 2YNEA 4ITVA 2WBMA 2RV8A 3RYRA 3BPXA 2QEXI 4MCQA 1X1DA 3WT4A 5GAEJ 4QLCU 1IV8A 1ETXA 3PUFA 3QRFF 2VQGA 4M3GA 1JUSA 3ONQA 3JCUC 3KYCB 3IV5A 1O3SA 1V3FA 3CUOA 1JJ8C 2ZNYA 1L0CA 3Q5FA 2BUSA 3FBUA 4EATA 1QSOA 4OIDA 6PAXA 1S5LC 4RB2C 1ELLP 3OXGA 3K70D 3GY9A 3FXUA 4QBJA 3DBLB 1OISA 3E5QA 3K4LA 1SMYF 5IOYA 2WZNA 4H0EA 3DKWA 2DJIA 3RU0A 5K5RA 3G4SI 2ZC2A 3LQRA 1FAQA 1Y0YA 3QP5A 2LOOA 1Y8QB 1RKTA 1EH6A 5JR3A 1ZRFA 3GZ6A 1VQ4I 5ERIA 5CVIA 3VODA 2IPQX 1TNTA 1UELB 1RZ4A 4PJNA 3SEZA 1PJRA 4CHUA 3D7DA 1JKPC 2W82A 2E1MC 3QPLA 2DB6A 4F9VA 5D29A 4L5JA 1JQGA 2M7BA 3UEJA 2WPXA
chains in the Genus database with same CATH topology
2LSOA 1NSLA 1IB1E 4QC6A 3FRMA 2QVOA 4MEYF 1Q2CA 3HRUA 4M73A 1OPCA 4FHTA 1ZH5A 1FSHA 4U5YA 3IHUA 1QNTA 2CWEA 4P9FA 2UXNA 2IJLA 1USTA 5FFZA 2OZGA 1UHWA 3IWFA 1KU7A 1HW2A 1UHMA 4RB3C 4KFCA 2KKOA 3PP9A 4HX4A 2M30A 5BWAB 2R3SA 3L7WA 3S6FA 1FYKA 1MD0A 2XAJA 3GWZA 5F6FA 2PN6A 3V4GA 2YNDA 5AG6A 1YYVA 1YW8A 4LG0A 1SAXA 1J2XA 4M85A 1G4DA 4L8AA 2HV2A 3L2CA 5DWNA 2RN7A 2ZNZA 5IX3A 1WQ2A 3KZZA 2HKXA 4RAZA 4JXQA 5F49A 4FD7A 4MNUA 2XKPA 1T0FA 3M7GA 4CXFA 2CQKA 2P6TA 3ZJ0A 2JRTA 2B5GA 1ONVA 4BYYA 1HQCA 1B87A 5ILVA 1CGPA 2D45A 1O7LA 4EM1A 2FF4A 4U9ZA 4Y17A 3FM5A 2K5TA 4CGNA 5HS9A 1UFMA 2EFPA 1HSTA 1U8RA 3COAC 4PCQA 4KOWA 4KOTA 5JHUA 2V1UA 5D5VB 3A9LA 1HSJA 3WU1B 5KK1A 3WTZA 5HDKA 4LD5A 1XD7A 2QM3A 3P7NA 4U9YA 2OQRA 1XE4A 4ZBGA 4HNXB 1MGTA 1USSA 2EK5A 3D0SA 1TLHB 2H27A 3DR6A 3IC7A 1T39A 2O6GE 1XSDA 2LF8A 2I79A 1KQ0A 1BC7C 4KN7X 4UA3A 4UFVA 4EJVA 1XGMA 2G9WA 2M87A 2BUEA 4TV7A 1BC8C 4UWIA 4KIGA 2Z99A 2FMYA 3ZMSA 5CVUA 3KETA 1ZGAA 3CUQC 4NQWA 5FFXA 2B4BA 1B9NA 4I01A 2P6EA 3RTRA 3L09A 1QSTA 4K30A 2EV6A 4LK0F 2JEVA 5D5XB 3GYHX 3F8FA 2DXQA 4D0PA 1CF7B 4R79A 2L02A 3R9EA 1LQ1A 2HTSA 4G6DA 3R61A 1HBXG 3GEZA 5BPIA 4OIPF 3FHZA 1M4DA 5D4SA 3LA3A 2DI3A 2EJRA 3ERED 3ISPA 4A33A 2Z11A 3RI4A 2QMLA 4HW0A 4OIOF 2Z3PA 1J75A 2V9VA 5EEHA 1GXPA 2B0LA 1TW3A 1MDMA 3GVAA 4LFUA 1R5HA 4CAEA 3SXOA 1JXSA 3I54A 2VONA 3IRRA 5F1RA 3K2ZA 1SD5A 1PP7U 3S6HA 4AIHA 5E96A 3FB3A 4UFXA 4EV0A