1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esa1 protein
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
2E7WA 1B87A 1ZYRF 5E8IA 2K7LA 4M6YA 4ESBA 2F5CA 3JUWA 1S3JA 3I71A 1HW1A 2QENA 3F5BA 2B5GA 3V8LA 3FXRA 1IYKA 5ILUA 3WU1B 5F1RA 1U6GA 2I00A 3LAPA 4XPDB 2MC3A 4Z2YA 5H84A 2H6CA 1JE8A 3E5XA 1P4WA 4FD7A 3U1DA 2CNSA 3I3GA 1UCRA 4R57A 1UHMA 2WTEA 3EUHA 4HLXA 2G3AA 3GYHX 4U0WA 3DKWA 3GWZA 5HDKA 3PQKA 5BQTA 1QZZA 2PR1A 1XCBA 3GVAA 4LG0A 3E0KA 3K9UA 4OIQF 2CO5A 2H09A 3J80K 3QU6A 3TE4A 1STZA 2HTJA 5HS8A 2EV5A 3E5QA 4UVCA 4ZZLA 1Z9UA 5DUIA 2E1NA 2KIFA 2STWA 2XAFA 3E5UA 3EY5A 3R0JA 1P4NA 1H0MA 5HH1A 5E8GA 3EFAA 4CDGA 3G73A 4ENJA 2J5OA 1OZPA 3L2CA 2KCWA 1TW3A 1UHWA 1S29A 1KQ9A 2GZWA 2LF8A 2XKPA 4B5OA 2ZBKA 1T38A 3HIFA 2PFBA 4HOBA 1I5ZA 2STTA 3K69A 2IA0A 1R1TA 3WTYC 3HTSB 1B59A 2A07F 1XB4A 2XAGA 1ON2A 1FPQA 1QBJA 2LKPA 2HS5A 1V0CA 3KP2A 3E97A 1NMTA 4ZBGA 3FBUA 2VE9A 1GXQA 5CVRA 1OPCA 1W4MA 2ZNYA 4KIGA 3FHZA 2B5GB 2W24A 5DEQA 1M4GA 3OWCA 2NS0A 3FM3A 3VOEA 3ELKA 2HR3A 2REEA 5LRSA 1XD7A 2DAOA 4OMZA 4JD6A 1RUNA 1OR7A 3I54A 3Q9VA 2LNBA 5DV5A 2A4NA 3F8FA 4CS0B 4KOUA 1AWCA 4ASNA 1Y7RA 3NE7A 4KLWA 4H6UA 2EFWA 4MBUA 2IL4A 1LEAA 3BWGA 1USSA 5JQ4A 3RI4A 3WU0A 2CFXA 2Y48A 4Q5SF 2K27A 2REFA 1MJ9A 2OU2A 1O7LA 4KMUX 2JTVA 2CG4A 3IGRA 1I1GA 2D4PA 4IPAA 4YFJA 1F5TA 4IF4A 5EBVA 5C88A 2MLKA 2XRNA 1M44A 1IN4A 2Q4YA 4ON0A 2P6TA 5EC4A 4BXUA 1YIOA 4HX4A 4RAZA 1W5TA 5E96A 2RN7A 5LRRA 2ZKZA 1YS7A 2JZYA 4G7ZF 4KUMA 4H89A 4CZZA 1G3YA 4CGZA 2OD5A 1Z6RA 3L9FA 4A5NA 1HKSA 5AONA 1JXSA 3G3ZA 2VBWA 1LDKB 1GVJA 2VZYA 2V79A 3D2MA 2AS5F 3C3WA 4PSWA 2BV6A 2DI3A 2BBYA 1I12A 1IN8A 4KIFA 4HNWB 4JLYA 2ARHA 2FIWA 3T0YA 2VOOA 1S6LA 1CJWA 3R1KA 4U7DA 2ZO4A 5L3DA 2O3FA 5HS7A 1DP7P 2V1UA 1YX0A 3R9EA 1RO5A 3KETA 4FD6A 1B9NA 1QQIA 1YW9A 4U9ZA 2NAZA 1WK4A 2XUBA 2QBYA 5DCMB 2W84A 2Q2EA 1LEBA 1KQ8A 1IRFA 1YFHA 1Q2DA 2QECA 4EJOA 3PFIA 3TKYA 1PP8F 4P5OA 3M1EA 4BHBA 4CHUA 1IXCA 2HZTA 3HRMA 3N7ZA 3DQVC 3BOQA 3I53A 3BROA 4WCGA 2A3SA 5BMZA 2EUIA 1F1ZA 5FB2A 3T8TA 1BOAA 2EWNA 1ZARA 3WE2A 3V7SA 4MQ9F 1QSMA 1B4AA 2B4BA 2D1VA 4II9A 1FWZA 1ZGAA 2RQPA 3B8GA 3E6CC 4AVPA 4EGYA 1UB9A 3F23A 4B5PB 2PEXA 3B02A 1CF7A 1EV7A 4HZFA 2EFPA 2DBBA 3F8MA 4CXFA 4EJVA 3GYAA 2CSOA 4M73A 4Y15A 1MKMA 4DNCA 2ZNZA 3K2ZA 4AG9A 2Z11A 4P96A 4OINF 5IT3A 4UWIA 1SD4A 3HOSA 4B09A 2V6CA 2ADUA 1B1BA 5BS6A 3JTHA 3GFMA 4KT5C 4ESJA 3D3SA 2YR2A 2PI0A 2G7HA 2MH2A 3ULQB 3KP6A 1TQPA 4EV0A 1T6SA 3JVNA 4QC6A 2MD5A 1FNNA 1BN5A 2VXZA 1QSNA 1W5SA 3O2PE 5F64A 1R36A 3MZYA 4CYDA 1TBXA 1ZGJA 3WTVC 4KICA 1XDSA 2EV0A 3FZVA 3TFYA 2GXBA 4O6JA 1KU2A 4ENNA 1BJAA 1RUOA 1EH8A 5FFZA 3CUQC 1MJAA 4I0BA 1MDMA 2F2EA 4RS2A 1I27A 2VONA 2HKXA 1HBXG 3K1PA 4PDKA 2P0WA 4R1HA 2JLMA 1J0RA 2OH1A 4NQWA 3FIXA 4JK1X 4A0YA 1ON1A 3K1NA 1FX7A 4HF1A 3R60A 2CW0F 2VC0A 3KP7A 2MA3A 1J4JA 1PUAA 2H27A 2ZMEB 3E6BA 2UXXA 4GYIA 1P6RA 1RZ4A 1OMIA 2BEOA 4UHTA 3I5UA 3MAJA 2H5MA 2WPWA 5AIPA 1LNWA 3RIRA 2OQRA 1XE4A 2Z10A 4KZTA 4EMSA 5LHIA 3V7RA 1QNTA 4GGGA 4H0EA 3PZJA 2QWWA 4AVAA 5CVVA 3SFZA 3EDPA 3GFJA 2CY2A 2RKHA 1MZBA 4YIIA 4CAWA 1XCVA 4L0YB 1R1VA 3L7WA 4Q4ZF 1FLIA 3F8KA 4L5JA 2EFQA 4JBAA 1P0HA 2O61A 4M6XA 5K5OA 4QBJA 2P6SA 5LEJA 1QO0D 3P9CA 1LB2A 2L02A 1ONVA 2ZW6A 4KVXA 4CAXA 2K86A 4BH9A 1ZG5A 2NRAC 4YGOA 4WXDA 2IA2A 2GE3A 5IB0A 2A6HF 4MY3A 2JPCA 4GO1A 1Y9KA 3HHHA 4Y49C 2CQKA 1AOYA 5DCFA 3DDDA 2BE5F 2PMUA 4E0AA 2LF7A 2G3TA 3CO7C 3V4GA 2F5EA 1XSXA 3SHFA 3VB2A 5A2QZ 1U5TC 3LSTA 5BOXA 4LJZF 2AE6A 2YU3A 5LGNA 4PZJA 1R5HA 4U0YA 2D1HA 2TDXA 4AIKA 4B8XA 1ZLKA 3CO6C 3LFKA 3TDUC 2B3UA 1O3QA 3F72A 2YPRA 3MEXA 1SQHA 1YO5C 4L9TA 2W57A 3GFIA 2FCKA 4K2EA 4L9NA 1IF1A 1T0FA 2XAQA 2PMHA 1EH7A 2RC4A 1XGNA 1KUYA 1KYZA 5CNPA 2VBZA 1VKCA 1YLEA 3LD2A 2UXNA 1G3TA 2KIUA 4EQQA 2WWYA 4LD5A 5JI6A 4R3KA 5K5RA 5JHUA 4OLLA 2Q04A 1GXPA 2ZCWA 3R95A 4RAYA 1MGTA 3WE3A 2NYXA 2MH9A 2XV4S 2EVNA 3SQNA 2EK5A 2FMYA 3TT2A 2XIGA 5ILSA 2JRTA 2M8EA 4KA4A 1WWZA 1Q1HA 5EEGA 3RKXA 1SFEA 1IRGA 3IWZA 2P7CB 3CLOA 1FC3A 3DNSA 1DPRA 2RV8A 1BIBA 2OB0A 3NRVA 1Z7UA 4O3MA 3KZYA 4EGZA 3QOPA 2X0LA 1MDMB 4M9XA 2PC1A 2ZXJA 4LLNA 3H3ZA 4UVAA 2HKOA 1HW5A 3M8EA 2Z5UA 3LODA 4JJXA 4NB5A 3HTUA 3HSEA 3FX3A 3FXTA 4HQEA 5EEHA 1IN6A 4JQFA 5E1WA 1KU7A 1XMKA 4CICA 3DXJF 2FEZA 4RGRA 4LX9A 1KYWA 1XGOA 5DD4A 3NEUA 2FU4A 2K4BA 4G94A 2DLLA 3CDHA 2JPBA 1JHFA 1KU3A 3NQOA 4ZZDA 4E8OA 1YGHA 4MEYF 2Y0MA 2DK8A 4LLGF 2Q4VA 2FL4A 2K02A 4PK2A 4U5YA 4IVNA 4U7BA 2P8TA 2XROA 2ELHA 4ORFA 1IN5A 3GZ5A 1P4AA 1G6NA 1RIOH 2FQ3A 1KGSA 4WXHA 4RB1A 1S7FA 3I64A 4KN7X 4YRHA 1SD5A 3M9AA 3JSOA 4UBRA 3CUQA 2GQQA 2P6GA 4JWPA 4UVBA 4QLCU 3REOA 2M1BA 2IPQX 2GA1A 1M4DA 2VQYA 1HKQA 2DK5A 3SZTA 3TQNA 2WPXA 3GKRA 4OMYA 4XNHC 4AD9A 1CM0A 1YREA 3KLNA 2GANA 5CYVA 4Y49B 4KUAA 1QPMA 4MEXF 2YX7A 4IRGA 2HV2A 3MWMA 3CXSA 4BMHA 4YFXF 4EJUA 4IHSA 1E17A 3I9SA 1RNLA 2Y75A 3TO9A 3FMSA 2HQYA 4Y13A 4XBFA 4P9FA 2FT0A 2ETHA 1KQ0A 1SMTA 3KLOA 2L3DA 3RYOA 2JT1A 4UXNA 5F6FA 2OA4A 3K0LA 4I02A 3EXNA 2DQRA 1N71A 4KOWA 1GHCA 1I6XA 4WF2A 2FE3A 5CJ9A 2K4JA 3B73A 2DTRA 3GEZA 4L8AA 4RGXA 4KOXA 1Z6TA 4KOVA 5KTAA 1TQMA 3ZMTA 1XIXA 1ZAOA 5DWMA 2PLYA 4HV6A 4KORA 2C27A 1JHHA 2ISZA 5CVJA 4XRFA 2AJ6A 2PDOA 3VFZA 2PG4A 2OQGA 4KFCA 2GA2A 4YFNF 4UA3A 2ZPAA 2NNNA 1HKTA 3ZPLA 5FLXK 2FBIA 1CGPA 3SXNA 2XAHA 1L0CA 2ATRA 2BGCA 1X3UA 4BHCA 1SFXA 3LQQA 1PP7U 4PK3A 2CWEA 1OYYA 2HFHA 3F22A 1IZ1A 2P7VB 4HDVA 3F3XA 2FE7A 3I0TA 1K79A 2H6BA 4NCZA 2KKOA 1QGPA 4UNOA 2I79A 4L18B 3J80Z 3E6MA 1Z91A 2VI7A 1UFHA 4LK1F 5C82A 2R7DA 3C18A 1H9TA 2O03A 3DR8A 1FSHA 2IRFG 5D6EA 3O3KA 5ICGA 4KMFA 1S7KA 4P9UA 1TQIA 3ZMVA 3PQJA 2VT3A 2O6GE 4P55A 1W7PB 1F4KA 4G8XA 3O6BB 1S7OA 4E2AA 4MNUA 1VTNC 2QQ9A 4IXAA 5ERIA 2HDCA 4UV8A 2CNMA 4KIBA 3ZMDA 2IA1A 4I7HA 2DW4A 4GS4A 1WWXA 2E1CA 1KUXA 3KP5A 4RB0A 1FOKA 4KLVA 2VEZA 1Y0UA 5D5UB 3W91A 5D4RA 1T39A 1IXSB 3V8KA 3BJ7A 3DP7A 2B4DA 3FXQA 4I0AA 1NE9A 2XAJA 1OYIA 3T9YA 2B0LA 3ABUA 4L89A 1KA8A 2UWMA 4RB2C 1ZG3A 4JXQA 3GW2A 3HYIA 3TGNA 1LVAA 2EA4A 2JDCA 1U2WA 1YTYA 1PU9A 2KJCA 4G6QA 1FBSA 3SXYA 1XEBA 4FT8A 3W6SA 4HV5A 1WSUA 4AVBA 1XMTA 2P6FA 4HF2A 5LLQA 3WTWC 3CUOA 3SHPA 1R1UA 1U5TB 1IN7A 3DPLC 2PR8A 5TRDA 3KP4A 2M30A 1K6OA 2H94A 2QIRA 1BM9A 2JDDA 2OZGA 2P5KA 1R5GA 3PP9A 1IW7F 3L00A 1RI7A 2FF4A 3BJAA 1WKMA 1ZRDA 3C7JA 2CGPA 2NMTA 4N9HA 2QBYB 4AB7A 5FGMA 3DPTA 1XN7A 4F6AA 6PAXA 1TTYA 1FYKA 4XSXF 2PSWA 4AWXB 3IRRA 3F0AA 1HSJA 3IKTA 3BPVA 3C26A 3GUDA 3BJOA 1G3SA 4A0XA 3EYIA 1BOBA 4OAEA 2DU9A 4YIFA 1XMAA 3W6KB 2DPDA 2EJRA 5GCNA 1FZPB 1J75A 1FP1D 1G4DA 2BYVE 1BO4A 3P2FA 1TNSA 5CVIA 4XPLA 3TOAA 5H20A 1Z05A 5KVRA 4XLNF 4MGRA 2MLGA 1J9IA 3UY5A 2XKOA 2PN6A 1ODDA 2ZW4A 4KNYA 4I01A 4ZH4F 1Y9WA 1Z1DA 2L01A 4ENKA 2COMA 2J5PA 2A5YB 1S7AA 3LAJA 2GWRA 2PQ8A 1ULYA 2OZHA 4DQ2A 1PUEE 4LB6B 2P6EA 1J7KA 5E20A 4A6EA 2FXFA 2BSWA 1T98A 3QRFF 1D3YA 5D8LB 3S6FA 3WTZA 4LFUA 3ZN1A 3P9KA 1E2XA 1FP2A 5D6FA 3IWFA 4PSXA 1S3ZA 4CRYB 2EA2A 3P9IA 2IT0A 2FMLA 3IKVA 2HYFA 3ZMSA 1P92A 3F6VA 4LMYA 3PGPA 2ESHA 2C6YA 5F47A 1QSTA 2DFIA 5HOOA 3ZMUA 4CO8A 3D8PA 1BC7C 5FFXA 2V1XA 1M4IA 4A5MA 2DXQA 4HF0A 4EM2A 4UUVA 1YS6A 4FD5A 5ILVA 4OIRF 2G9WA 1W7PA 1LDJA 3QP5A 4E70A 1P4XA 3T90A 5FD5A 2QQBA 1O3TA 4KYWA 1D5VA 4GCVA 2ZW7A 2JSCA 5LHHA 1QSRA 1W7PD 3WTTC 4EVIA 3MFKA 4EJTA 5L3GA 2L4AA 4F0YA 3GX4X 4HLYA 4YG2F 2BEIA 3BLNA 2HYGD 4ZYHA 4TV7A 3G3SA 2RNJA 4MJ8A 4KDPA 2XVCA 2UZKA 5LEKA 3H4QA 3MQ0A 1J59A 2VT2A 1IIDA 2M5WA 2OZUA 3BY6A 1H9GA 3MZHA 1UFMA 1BBYA 3JAMZ 4G7OF 3FB3A 2J8MA 1YYVA 1XSDA 5FLXZ 3FNCA 2A61A 3VODA 3E3VA 4S05A 3D2PA 2HGCA 2QQAA 5IV0A 1JGSA 3GXOA 2R7FA 4XNHB 3D5LA 1LDDA 5D4SA 5I0CA 1ZN2A 2G0BA 2IJLA 2PBIA 1IB1E 4IRHA 4RI1A 4HYEA 2QMLA 2Q8KA 3GLXA 3L09A 1SFUA 2ZXVA 1TIQA 3WGIA 2XGXA 4QB9A 1XSVA 4NXYA 5K5QA 2VC1A 4YFKF 1FSEA 1HXDA 1SMYF 3SXOA 3MCZA 4G7HF 4MQVA 3F8BA 2OAZA 1MJBA 2X4HA 3BZ6A 2JEVA 5DYMA 4GXOA 3EETA 2RGVA 1WQ2A 2O28A 2P4WA 5HLGA 4FHTA 3GO5A 2VBQA 5K1YA 1DPUA 4R8HA 2R3SA 5BPDA 2RVCA 4G9YA 4UV9A 3FYNA 3RTRA 3Q9SA 3OOPA 1J2XA 1S7LA 4FX0A 2VOPA 4IJAA 3T1BA 1YVKA 5F49A 2GIVA 4QUSA 1YR0A 2G7UA 4U88A 4HA8A 2L54A 1BI1A 2Z33A 3J81Z 4MI4A 3RKWA 4AVCA 4Q48A 1TW2A 5E17F 3TDZC 4HX7A 4LLLA 3ZJ0A 2FXAA 1YG2A 1ZH5A 1U78A 4QVTA 3V8IA 1U5TA 4BNCA 2VN2A 1YLFA 2J8RA 4KVOE 4PGGA 3ROUA 3FMQA 3I59B 3GFLA 5FO5A 4MTEA 3HOTA 4S04A 2NNYA 5D5XB 2KRFA 4F7ZA 4LG0B 3LA2A 1SD7A 1G3WA 3WR7A 1REPC 4Y17A 3TOBA 1L0OC 2E7XA 5HMNA 4I98B 4OOIA 4CRZB 1U8RA 2EFOA 3BP8A 1SAXA 4WWCA 2FOKA 4N9IA 3LA3A 1WI9A 2ZJ2A 3HRUA 1YQAA 5HS9A 5FVJA 2FNPA 1O7FA 3N4MA 4M3SA 1Z4EA 4HBLA 2CNTA 5E1ZB 1C0WA 4R9MA 4WXCA 5IT9K 5ISVA 5HLIA 4G6DA 3H92A 1YK3A 3RJPA 5HDGA 2O8XA 3TCVA 1S8NA 3TTHA 4RGSA 3IC7A 4WX9A 2A69F 2FNAA 2F5IA 5A2QK 3HRSA 3DFGA 4I49A 3RYRA 3Q5FA 1ON0A 4BYYA 3QPHA 1ZHFA 4I2OA 3BPXA 2ISYA 5KTCA 3VWDA 5LGUA 1FT9A 4M9SA 1NSLA 2YSRA 3S6KA 4ONUA 2M45A 4XPDC 1LJ9A 4IRIA 2V9VA 2QUFA 3R6SA 1BIAA 3R0AA 1B9MA 2PRBA 1HW2A 3DV8A 4EVYA 3CUQB 1TNTA 1QZYA 2F5FA 3W6XA 1K78B 4MTDA 4M72A 1I1SA 2X7BA 1GHEA 2QYOA 4KOTA 1K7AA 2IP2A 3KZZA 2LSOA 1RXTA 3P7NA 5TJJA 2B4DB 3IHUA 1O57A 4HAMA 3QP6A 1S7NA 4WK8F 3T5XA 2Q44A 4BQAA 3JTGA 1B6BA 2QVOA 3BJ8A 1USTA 5D5VB 3WTSC 4R3LA 2FS5A 4NEXA 2KIMA 2R8VA 3JW4A 3ISPA 3CJNA 4BHPA 1YW7A 4I09A 1U3EM 3HSRA 3VEPA 2VBXA 5H6RA 4NSQA 5ICFA 3H3UA 3ERED 3AAFA 5L3CA 4L5IA 5JFRA 4U0VA 3T8RA 2BL1A 4PGHA 4R79A 3J7AO 1YVOA 2LDUA 4L9VA 2B3VA 1S5KA 1Q2YA 1MD0A 2O0YA 3FWEA 4OU0A 4QWQA 1FBUA 2ESNA 4OIOF 2HWVA 3TO6A 1R57A 4M71A 5D8KB 1I1DA 3RPQA 1PDNC 2BUEA 4RB3C 3KCCA 3WODF 5DUKA 1ZLJA 2A6EF 2FSRA 3DEUA 2GAUA 3IWGA 4Q47A 5D5WB 2EFNA 2EB7A 4A12A 4KVME 4RS8A 1DUXC 4EJWA 4MHDA 2HUZA 3FRMA 1TLHB 3KKWA 3OV8A 4X5KA 4XPKA 2D4OA 2Q0YA 5BPIA 2QM3A 1Z9CA 2DO7A 5F48A 5ICCA 5J6XA 1R22A 1ZRCA 2L4MA 3K9TA 5ED4A 1OKRA 3QB8A 3IL2A 4K30A 1XF8A 3VWEA 4KOSA 2CYYA 3M8FA 5KK1A 3CXQA 1R23A 2VXKA 5LBQA 5JVTA 5H6QA 5L3FA 4UWJA 3S2WA 1D8KA 5F46A 3F21A 1FY7A 2QLZA 2YX4A 4XLPF 1J5YA 1P2FA 3S6GA 2OBPA 1IICA 1XDUA 4D0PA 4ZYGA 1O3SA 3E6DA 4AG7A 2WC2A 5LHGA 3R4KA 4KUBA 1Z4RA 3FF5A 5L3EA 4OIPF 3COAC 1SD6A 1BI2A 4LK0F 2HQRA 4B5PA 2FBHA 2FBKA 1K78A 5DWNA 2FSWA 1BI0A 1IAWA 3GF2A 4LB5A 5AIQA 1KZFA 3R61A 2DPUA 3HRTA 1IYLA 3QPTA 1F9NA 3WG9A 2IVMA 3ZZIA 1IUYA 4MHGA 1S60A 3EC4A 3F8NA 3KEOA 3JAMK 4OADA 2Z3YA 2D2WA 3F8CA 4U9YA 3ECOA 2ZMEA 3DSBA 5FD6A 2DQLA 5KTDA 4ZYEA 5J8FA 1BC8C 2HQNA 4HNYB 5E1XA 4L0ZB 4ESFA 3W6JB 1FYLA 4LUAA 3RYPA 1XGMA 4A2UA 3SZPA 2Z99A 2QZ8A 2FIAA 3TO7A 3EYYA 3FXUA 1V3FA 4XSZF 5CLSA 2Z9OA 3KFWX 4IF5A 5H86A 4IHTA 4FD4A 1KUVA 2W85A 5LGTA 3QAHA 1R7JA 3RPUA 1YW8A 1FBQA 2VBYA 2IW5A 2HTSA 3J81K 4ETSA 2F5DA 3WTUC 3JSPA 3ABTA 2HEOA 2P5VA 4NF1A 4AIHA 2R1IA 3RKYA 3S6HA 2R7HA 3G8WA 3ML6A 2KJBA 3GZ6A 3WTXC 3FM5A 3EO4A 5L3BA 4HX8A 3R96A 4HKFA 3ZMZA 2XASA 3I59A 1HQCA 2P5LC 4HDUA 4AIJA 1EH6A 2ACJA 4KOYA 2ZFWA 2HOEA 1HSTA 2Q0OA 1ZREA 3KP3A 1XGSA 4H6ZA 4EM0B 3CTAA 4ENMA 2V1DA 1O3RA 3RDIA 1I21A 5DDGA 5JR3A 4LGWA 2AXLA 3MGDA 3U2RA 2ZW5A 1BI3A 2OZ6A 4MY0A 3BJ6A 4M9ZA 1DDNA 3ZN0A 3KE2A 2VZZA 3LQRA 4R87A 1WRJA 2Z0ZA 1KU9A 2W25A 3ECHA 1R00A 5IT9Z 1MK4A 4CAVA 3C1DA 5E18F 4FX4A 3WGGA 1A04A 2K5TA 4PCQA 2RDPA 1B6AA 4O5VA 4KN4X 2PJPA 2J8NA 1ZRFA 3U9GA 1R58A 3N97A 1V4RA 3EQLF 3KEQA 3GY9A 4EM1A 3V8JA 3DF8A 3I58A 5J8CA 3ZP5A 3M7GA 1D8JA 1M1DA 4PV6A 3HHGA 4HNXB 2FRHA 1VHSA 5HDNA 2XHKA 2WV0A 3I4PA 3K1MA 3V7CA 1LQ1A 1K4JA 5DCMA 1LRZA 3WGHA 5HVQC 4A0ZA 1L3LA 5CVUA 5IX3A 4A6DA 1OYWA 1ZG1A 2FA5A 2D45A 4HQMA 2R98A 3R9FA 3LWFA 3CXPA 1U6MA 2EV6A 3DR6A 1IXRC 5JPHA 4ZYDA 2M87A 3FMRA 3HSFA 1CF7B 2GXGA 5HLHA 3LA7A 4M74A 3BDDA 3F6OA 4GYGA 4J3GA 3QU3A 3D0SA 3HUGA 1QSOA 4JXRA 2A68F 3IRQA 4RGUA 4L9JA 2VE8A 5DD8A 3R9GA 3ZQ7A 2MBFA 2B58A 1Q2CA 4HW0A 4N0BA 2Q7BA 4NHJA 2DT5A 1T2KA 3P2HA 4IUSA 4M85A 1NHAA 1FYMA 4BAYA 2VODA 5ICEA
chains in the Genus database with same CATH superfamily
2EK8A 3CXLA 2XSJC 2WVJA 2NVUB 2E7WA 1B87A 1ZYRF 5E8IA 2K7LA 4P1WA 3PSIA 4MHNA 3PRTA 1OCZH 4M6YA 4ESBA 1BPMA 1VI0A 2F5CA 1XBTA 3JUWA 4Y33A 1ULNA 1S3JA 3WU2C 2NU3I 3I71A 3FXOA 3TP0A 1HW1A 4AC0A 2QENA 5EX0A 1X2MA 1HDPA 3CF2A 4N4OB 1RKWA 3F5BA 2B5GA 3V8LA 1UMQA 2QSGX 3FXRA 1IYKA 1A2ZA 5ILUA 3WU1B 5F1RA 1U6GA 4JX5A 3LFUA 4YRVA 2I00A 3LAPA 4XPDB 2EZHA 4AIDA 2QQ8A 2MC3A 4Z2YA 5H84A 2H6CA 4ANJA 2PMZN 1JE8A 4XK4A 3M4OJ 3E5XA 1P4WA 3H5AA 2W00A 3U1DA 4D1QA 4FD7A 2HZDA 2CNSA 1MMAA 3I3GA 1UCRA 2IS2A 3NH8A 4R57A 1UJ8A 1X19A 2EIJH 1UHMA 2WTEA 3EUHA 4HLXA 2G3AA 3GYHX 2ROWA 4U0WA 2ELKA 3DKWA 3GWZA 4M3EA 5HDKA 2VRWB 3PQKA 5BQTA 1S9HA 3U1KA 1QZZA 2WAFA 2F8HA 2PR1A 1XCBA 3DTKA 1BR2A 3GVAA 3VSLA 4LG0A 3OYEA 1JKQC 1XBUA 3E0KA 3K9UA 3GZNB 2UUZA 4OIQF 2CO5A 3MKLA 2H09A 2ME6A 1LE8A 1HDDC 3D67A 3J80K 3QU6A 3TE4A 1UUCA 1STZA 2HTJA 2ZELA 3B35A 4BE2A 3IFEA 1R79A 3G1OA 3BG6A 3DBRB 3CCSI 1Y8QB 1X4PA 2XPWA 5HS8A 2R0QC 2CWFA 3M3YJ 2EV5A 2QQEA 3E5QA 2R7WA 2JA6J 4UVCA 4ZZLA 1ZR2A 1Z9UA 3LSMA 1CG2A 3D7DA 4MFDA 1XG1A 5DUIA 2E1NA 2KIFA 2STWA 3HUVA 4KS9A 2XAFA 4YU9A 3E5UA 3EY5A 3QODA 4AYBN 1FNOA 1Z3YA 4ZTFA 3R0JA 3CT9A 1P4NA 1H0MA 5HH1A 3CPAA 1OCCH 1LR7A 4P6YA 5E8GA 3EFAA 4CDGA 2GBYA 3G73A 2BOLA 4ENJA 1W36C 5EEAA 2J5OA 5E3NA 4ZGYB 4LOCA 1OZPA 3S9NA 3L2CA 3OYGA 2QCOA 2KCWA 3OYLA 2JSPA 2GU2A 1TW3A 4Q7AA 2JBKA 1UHWA 1S29A 5BNGA 1KQ9A 2R5YB 2GZWA 4PFOA 4OKOA 2LF8A 2XKPA 5EGOA 2XDVA 2ZBKA 2N71A 4B5OA 1T38A 2L7FP 3HIFA 1HC8A 2DMNA 2PFBA 4HOBA 1I5ZA 2OTLI 2STTA 3K69A 5JVGF 3S1MJ 1XRYA 2IA0A 1FIAA 2PJ6A 4G6TB 1R1TA 3WTYC 3HTSB 5F04A 1B59A 2A07F 4JYKA 4SGBI 3IUOA 1XB4A 2LLKA 2XAGA 5CQEA 1ON2A 3ERMA 1FPQA 3J7YJ 2KQRA 1QBJA 1TBOA 1ARLA 3B3SA 3R5CA 2LKPA 4JX4A 4HNTA 1FIPA 2HS5A 1V0CA 3KP2A 3TEDA 3E97A 2PJ4A 1NMTA 3HOYJ 2X51A 4ZBGA 2VB6A 4MIMA 4IHWA 4LQGA 4A37A 4A3FJ 3FBUA 2LP0A 3HOXJ 5AG5A 1VQ6I 3C2HA 2VJJA 4CUGA 2VE9A 1GXQA 5CVRA 1OPCA 3HJEA 3JRDA 1W4MA 2ZNYA 4KIGA 3FHZA 2B5GB 2LYCA 1CSOI 3LMSA 2R93J 2W24A 5DEQA 1M4GA 2V1CA 5ELYA 3B4VC 3OOUA 4FCYA 5JLXA 3TBIA 3OWCA 4NBQA 1BPNA 2NS0A 3FM3A 2L9RA 3VOEA 4E7ZA 1R6RA 4R76A 3ELKA 5IOYA 1A5JA 2HR3A 2CXAA 4TWEA 2REEA 2HPMA 4XLCA 5LRSA 4B14A 1XD7A 3ASOH 3GLJA 2DAOA 4OMZA 4JD6A 2GLOA 1OQYA 1RUNA 1OR7A 3I54A 3Q9VA 4J01A 2LNBA 2A20A 5DV5A 5F0FA 3F8FA 2A4NA 5HVHA 3S1RJ 4CS0B 3BI1A 1AWCA 4ASNA 4KOUA 2WUUA 2R4GA 1Y7RA 1UELB 3NE7A 4I99C 4KLWA 5B3SH 1SC7A 4H6UA 2CJSC 3A02A 2EFWA 4MBUA 2IL4A 3OYNA 1LEAA 2KDOA 1QVUA 3BWGA 1USSA 2JA8J 5JQ4A 3RI4A 4LQ6A 3WU0A 2CFXA 4Y52J 2Y48A 2ZEEA 3CCQI 3HUGB 2K27A 3H36A 4Q5SF 3G6EI 2REFA 2XGDA 1MJ9A 1TT5B 1H8LA 2OU2A 3Q0UA 1O7LA 1RR8C 4KMUX 2ZEFA 4E7HA 2JTVA 2CG4A 3IGRA 4OAZA 1I1GA 3OL0A 3PUFA 3ZGKA 4F91B 3FEEA 5A27A 2D4PA 1Q7LA 4IPAA 5C44J 2YQPA 1GV2A 3PB6X 2Z3NA 4YFJA 3D7HA 2I3CA 3JCUC 1F5TA 4MFZA 3SJFA 4IF4A 1BMOA 5EBVA 5C88A 1NXUA 2MLKA 2XRNA 1AA7A 4J19A 1HCRA 1AYEA 1M44A 1H89C 5CCMA 3I1UA 1IN4A 1H88C 2Q4YA 2VJ5A 1JKOC 2V77A 4ON0A 2P6TA 4D9JA 5EC4A 4BXUA 1YIOA 2HC9A 4HX4A 3FBNB 1W5TA 4RAZA 2RN7A 4XMYA 5E96A 5LRRA 2ZKZA 2GKTI 1YS7A 2JZYA 4G7ZF 4KUMA 4H89A 2XB0X 4CZZA 1G3YA 2V7FA 3IAS2 4CGZA 2L7ZA 2OD5A 2YNEA 1A6QA 1Z6RA 3L9FA 4A5NA 4F52A 1HKSA 4Q38A 1WPKA 3JRHA 5JLWA 3BXMA 5AONA 4PJMA 3G3ZA 2CUJA 1JXSA 2VBWA 3BZKA 3CMYA 1LDKB 1GVJA 2VZYA 3KZWA 4A3JJ 4UUSB 5F09A 1IGBA 2KL4A 5FLVA 2E1OA 2V79A 2CMPA 3D2MA 2KT0A 4MCPA 2VKEA 4E7IA 3G1MA 3GIUA 3OMYA 4GDFA 2Q1ZB 5E79C 2AS5F 3C3WA 4PSWA 3SI1A 2BV6A 4FUUA 3OYDA 1I39A 2DI3A 2BBYA 4L5EA 5E3OA 2GM4A 4FKDA 3KL9A 4AUXA 4TNUA 4DW6A 1Y1CA 1I12A 1N25A 1Y8RB 1IN8A 4KIFA 5E3QA 5CCLA 5C82A 1LAMA 1YSJA 4HNWB 1M8BA 4JLYA 2ARHA 2FIWA 2Y2ZA 3T0YA 2VOOA 1S6LA 2VL8A 4QPOA 1CJWA 3R1KA 4U7DA 2K9HA 2RB7A 1OYVI 2ZO4A 2LRDA 3BG5A 5L3DA 2AFMA 2O3FA 1AKHB 2F5VA 5HS7A 1DP7P 3ZQGA 4PUSA 2V1UA 1QHHD 1YX0A 4XKWA 3R9EA 1TKHA 1RO5A 3KETA 4FD6A 1B9NA 4M6GA 4LG3A 5E3PA 1QQIA 3NH5A 2CRGA 1YW9A 4U9ZA 2NAZA 1WK4A 3CESA 1SVOA 3J7AY 1YMEA 4X3RA 4ZX8A 2EPFA 2LH9A 4XICA 2XUBA 4BS9A 2QBYA 4FTHA 4ONWA 5DCMB 2HQ5A 2W84A 4IX7A 4P10A 3KQZA 2FD5A 2Y9YA 4RN7A 2Q2EA 4DJLA 2H1KA 1LEBA 1KQ8A 2QQDA 4BXXJ 4NJRA 1IRFA 3N05A 4XM3A 4IZZA 1YFHA 1Q2DA 2NYQA 2QECA 4EJOA 1YE9A 3BR1A 1P7IA 3PFIA 3TKYA 3PO3J 1PP8F 4P5OA 3M1EA 4BHBA 4CHUA 5F27A 3QPLA 1APLC 2VQHA 1IXCA 1IJWC 2HZTA 3HRMA 2PJ7A 3N7ZA 1RPWA 3DQVC 3KEYA 3BOQA 2LD5A 3I53A 3BROA 1Y6IA 2QQCA 4WCGA 1E3PA 2A3SA 5BMZA 2EUIA 1F1ZA 5AG7A 3CPXA 5FLMJ 5FB2A 4BD9A 1TWHJ 3T8TA 1BOAA 5EYRA 3OYJA 2EWNA 3IH4A 2VASA 4RAGA 1W1WE 1ZARA 3WE2A 1EA3A 3V7SA 4MQ9F 3BJIA 1QSMA 1B4AA 2DDAA 1X4SA 2B4BA 2D1VA 4FE4A 1ETYA 4II9A 1FWZA 1ZGAA 2WAEA 2RQPA 4CH7A 5F0HA 2ARPF 2ECBA 3HKZA 3B8GA 1SANA 3E6CC 3HPGA 4AVPA 4EGYA 2O9LA 3KR5A 1UB9A 1V54H 2ZEPA 3F23A 3DEEA 1PJUA 4B5PB 2PEXA 3D5SC 1QU3A 2HNHA 4XLHA 3OSGA 3B02A 5IP6A 1CF7A 4UFWA 3SJGA 2FUG2 1R0RI 5DAEA 4UIAA 1EV7A 4CCJA 4HNVA 4CCNA 1V5FA 1FTTA 4HZFA 2DT7B 2EFPA 1IY6A 3L1PA 5GTHC 3WABA 2DBBA 4O23A 3F8MA 2NS7A 3DKYA 4II2A 4EJVA 4CXFA 4QPQA 4AMLA 1U9OA 2PE3A 1TUSA 2AFXA 4MCRA 2DMQA 3GYAA 3BR5A 2CSOA 4M73A 4Y15A 4OWRB 1MKMA 4MHZA 4DNCA 1DGRM 2ZNZA 3K2ZA 4AG9A 2Z11A 4P96A 4OINF 4BJ6C 4BQQA 3ABLH 5IT3A 1SD4A 4UWIA 2JA7J 3HOSA 4B09A 3UGDA 2X1EA 3CD6I 2V6CA 2ADUA 1B1BA 3BG3A 3TL4X 5BS6A 3JTHA 1SGNI 1CP6A 4PQAA 3GFMA 1X3ZB 2O5RA 1QMUA 4KT5C 4ESJA 3D3SA 4DUKA 2YR2A 2PI0A 2G7HA 2CW7A 2MH2A 1FEXA 1ARMA 3ULQB 4Z6YA 4OC2A 3F0CA 4BU2A 3K6GA 2IGKA 3KP6A 1TQPA 1U0JA 3IEHA 4EV0A 1T6SA 1RESA 2E5ZA 3JVNA 4QC6A 2MD5A 3OYIA 5FROA 4UUTA 1FNNA 1BN5A 2VXZA 5EJCA 2L2OA 3CZXA 2B7EA 5M5WJ 1W5SA 3O2PE 1QSNA 5F64A 1R36A 1HF0A 4MRIA 3MZYA 4CYDA 5GAHJ 8CPAA 2CTCA 2PJRB 1TBXA 3HZJA 1ZGJA 4FAIA 2KMOA 1I50J 4ITVA 3VYRB 3WTVC 2A05A 5K7FA 4ZDPA 4KICA 3E1SA 1TF9A 4OIWA 1XDSA 2EV0A 3FZVA 4E1RA 3TFYA 2GXBA 4O6JA 1KU2A 2K3FA 3RQ4A 3NA6A 2O8KA 5E3MA 4ENNA 4X2TA 1BJAA 1VQOI 1RUOA 3FISA 1EH8A 4PJ0C 5FFZA 3E0JB 3CUQC 3FVLA 1DGWY 1MJAA 4I0BA 1MDMA 3ASNH 2F2EA 4RS2A 1I27A 1FT7A 2JEWA 2VONA 2HKXA 1HBXG 3K1PA 4PDKA 3LOCA 3QQAA 2P0WA 3KR4A 3B3TA 1ENHA 4R1HA 2JLMA 1J0RA 3SFIA 2YGWA 3C2BA 2OH1A 4PXBA 5D29A 3UNGC 4NQWA 3FIXA 4JK1X 4YELA 2QYVA 5LFAA 3ZQIA 4A0YA 3B3CA 1ON1A 2ABZA 1IC8A 1YIJI 3K1NA 4HRIA 5J40A 1IW4A 5FRNA 1FX7A 2IEKA 2B9SA 3R60A 4HF1A 2CW0F 2VC0A 3KP7A 4ZYQA 2MA3A 1J4JA 5F1JA 2H27A 1PUAA 2IGOA 2ZMEB 2ZEGA 4P45A 3E6BA 1R5ID 2UXXA 4GYIA 1VQ5I 2R7TA 3OVOA 3FH4A 2AQFA 1P6RA 1RZ4A 1OMIA 2LY9A 4BGDA 2BEOA 4UHTA 3UR3C 3I5UA 3L2UA 3MAJA 2H5MA 3S1QJ 2WPWA 3K2AA 1TXRA 5AIPA 1LNWA 2R5ZB 3RIRA 2OQRA 4ABZA 4PXDA 3FKIJ 4B6DA 1XE4A 2Z10A 4KZTA 4B13A 4EMSA 5LHIA 1ACIA 5EG0B 3DTEA 3V7RA 1QNTA 1LPQA 4GGGA 3CDLA 4H0EA 3PZJA 2QWWA 1MBFA 2IS1A 5CVVA 3PFYA 4AVAA 3Q0WA 1I3AA 3SFZA 5CPRB 1ELLP 3K4JA 4K3NA 3EDPA 3GFJA 3I3LA 2WCYA 2CY2A 2RKHA 1MZBA 4YIIA 4GXHA 4CAWA 1XCVA 1S72I 4L0YB 1EKEA 1YRNB 1R1VA 2NVTJ 3L7WA 4Q4ZF 1FLIA 2E71A 1X1PA 1YU6C 2FJ1A 2ME0A 2VXDA 3F8KA 4CGOA 2BY3A 4L5JA 2EFQA 4JBAA 4RAFA 1P0HA 1PCAA 2KP6A 3S8PA 1NG6A 4D7MA 2O61A 4M6XA 2JXDA 5K5OA 2AFZA 4QBJA 2P6SA 3IV5A 5LEJA 1QO0D 3CCYA 2OPTA 3P9CA 2CIJA 3RO0A 2JVHA 4CCOA 1CQTA 2CV2A 1LB2A 4CPAA 2ZENA 3H3VK 2L02A 2IQ6A 4CAEA 1WGTA 1ONVA 4EEFG 2ZW6A 1N77A 4X8IA 2E5NA 4KVXA 1OCRH 2BUSA 3RPUD 3OWTA 4F3QA 1YJ9I 4CAXA 2K86A 4BH9A 2EILH 4XOPA 1ZG5A 2NRAC 4YGOA 1GUUA 1ZO0A 3K4CA 2JJ7A 4JOMA 4WXDA 2IA2A 4UXHA 3NFZA 3PM1A 1JJ6C 2Z3PA 3OS2A 2GE3A 3MZ8A 3DKXA 1K7VA 4XL9A 2K40A 5IB0A 2L5QA 2A6HF 4MY3A 2Y30A 5J3LA 3KIOA 2JPCA 2F4OB 2B8TA 2CUZA 2VKVA 4WJBA 4GO1A 1Y9KA 2X85A 3HHHA 4Y49C 2F6CA 2UZ3A 1MBGA 2CQKA 1AOYA 2KISA 5DCFA 1WH7A 3DDDA 2NXNB 1TKJA 1XJOA 2BE5F 2GVIA 4AU7A 1Z7KB 2ECCA 1D5YA 4JZ0A 3H5ZA 1WJ5A 3H0GJ 4M3FA 3PB7X 2PMUA 3OYAA 4E0AA 4A24A 2LF7A 2G3TA 3OYHA 5B5EC 2DEAA 2GLFA 4CA0A 3CO7C 3V4GA 2F5EA 3OL3A 1XSXA 3SHFA 3VB2A 2ID3A 5A2QZ 1U5TC 3CCEI 3LSTA 5BOXA 4LJZF 4A3LJ 3KGQA 4GFBA 2KHMA 2DA5A 2YU3A 5LGNA 1Z2LA 4PZJA 2AE6A 1R5HA 3AG3H 2SGPI 4U0YA 3SYTA 5FKOA 3DCFA 2D1HA 2FVGA 2TDXA 1JT6A 4AIKA 2XEJA 2OCCH 1D0XA 4B8XA 1ZLKA 1X1CA 3LFKA 3CO6C 1WJDA 3TDUC 3A01B 2B3UA 4BXFA 3ISXA 1O3QA 4KSIA 1T08B 3F72A 2YPRA 2CWHA 3B6AA 4RDUA 1QPIA 3MEXA 2GKRI 1SQHA 1YO5C 2NVYJ 4L9TA 2DFHA 2DA6A 2W57A 3RQIA 3GFIA 1EJ9A 4Y3OA 2DXIA 1IV8A 4ZDOA 2FCKA 4K2EA 4L9NA 2XAQA 1T0FA 5FKNA 2PMHA 1IF1A 2DCEA 1QHGA 1EH7A 4JYWA 2RC4A 4HPQA 3WC7A 1XGNA 5EZGA 1KUYA 1Z8XA 2IJZA 1KYZA 3R5DA 5CNPA 2VBZA 5IP7J 2DMUA 1VKCA 2BY1A 3S3NA 1YLEA 2QPOA 1PUFA 3LD2A 4UCPA 5THWA 4BEHA 4F9UA 3O8GA 3G4SI 2UXNA 3LSPA 1G3TA 3GMEA 2KIUA 1K6YA 4EQQA 4LD5A 5JI6A 2WWYA 1WZ2A 3FSXA 4G1PA 4R3KA 2DFEA 1YITI 1XA6A 2CJJA 2F3CI 5K5RA 1BR4A 4A3MJ 4I76A 5GP9A 5JHUA 5IOZA 1SGRI 2IS4A 4DIQA 2DMTA 4OLLA 2K5CA 2Q04A 1F57A 4DYQA 4M6VA 2ZCWA 2F48A 4RAYA 2E19A 1MGTA 3WE3A 1GXPA 1VF9A 2NYXA 1JGGA 2MH9A 1A36A 2M5XA 2XV4S 4G12A 1JQGA 2EVNA 4ZTJA 3SQNA 2EK5A 1WTJA 2DPSA 2FMYA 3TT2A 4A39A 4D5FA 3CJRB 2XIGA 5LYLA 2M4GA 5ILSA 1D0YA 2JRTA 1TF8A 2M8EA 5I4MA 1W5CC 3HL2A 4KA4A 1Q1HA 1RC9A 1WWZA 3HG9A 5KCMA 5EEGA 5B1BH 1ETQA 1SFEA 3RKXA 1ZLHA 1IRGA 4M6IA 4OC1A 3IWZA 2P7CB 4RM3A 4A3CJ 3CLOA 1FC3A 3DNSA 1DPRA 3V38A 2Z3KA 1IGNA 4WP4A 2RV8A 2Z16A 1I3QJ 2R7VA 4BY1J 4L9MA 1N75A 2W7NA 3MKWB 1BIBA 3D5RC 1MBKA 2XGCA 2VUMJ 3NRVA 2OB0A 4OC4A 4PXCA 5K8NA 4N4NB 3X2QH 2HOTA 2N1AB 3D7FA 1Z7UA 1RKTA 4D5CA 4O3MA 3KZYA 4EGZA 2HOSA 3HDDA 3QOPA 2X0LA 4BY7J 1MDMB 3HOVJ 5E3RA 2YS9A 4M9XA 2PC1A 2OTJI 1OISA 2ZXJA 4LLNA 1Z8WA 1GT0C 3H3ZA 3D66A 4UVAA 2HKOA 1YJWI 1HW5A 3M8EA 5EG0A 1TGSI 2Q43A 2Z5UA 1VDDA 3PNYA 3LODA 1H0ZA 2M4KA 1TL8A 4JJXA 2K9NA 3HXLA 4NB5A 3HTUA 5K8OA 3HSEA 3FX3A 2PJ2A 3FXTA 1JKPC 2IS6A 2X1CA 2X52A 4NC6A 4HQEA 2ZSHB 5EEHA 1IN6A 4JQFA 5E1WA 4KJZA 3HOZJ 3HBLA 4NC8A 1KU7A 1XMKA 3SI0A 4CICA 3DXJF 2FEZA 4RGRA 4BAYA 3B3VA 4LX9A 3IO1A 1S7EA 4P4DA 1KYWA 3WC6A 3FK6A 3O8HA 1XGOA 1X58A 5DD4A 5CBMA 3NEUA 2FU4A 2K4BA 4G94A 2HYJA 4DZPA 1SFOJ 1LR9A 1E3HA 2AO9A 2DA7A 1MW7A 2DLLA 3CDHA 2RIJA 4PJNA 2KZGA 3TJQA 3M1CA 2Q2EB 2JPBA 2YU9J 1JHFA 4ZY2A 3H9GA 4HNUA 1KU3A 1MMDA 3NQOA 4ZZDA 4UY8I 1AMPA 4P4BA 5TISC 1YGHA 4E8OA 4IOAF 2ZJPF 1VQ8I 3PO2J 3RZOJ 2TCTA 4MEYF 3PB8X 2RFHA 4P4IA 3FXMA 2Y0MA 4JP0A 4M3GA 1LKXA 2DK8A 3JREA 4LLGF 1T33A 2Q4VA 1ULMA 2FL4A 2K02A 2DA1A 1EF4A 1HA8A 4PK2A 3PNVA 1R4NB 4U5YA 4MCQA 4IVNA 1VNDA 2UVOA 4U7BA 4HSRA 1EE3P 2QKLB 2P8TA 3OIPA 4II3A 2CFOA 2H1LA 2XROA 1ORKA 2L9SA 3HC7A 2ELHA 2YNCC 1IUFA 4B11A 4ORFA 1IN5A 3GZ5A 3TMOA 1P4AA 2M7AA 1G6NA 3DLLF 1QA6A 3H8FA 3CCRI 3ZQHA 1RIOH 2FQ3A 1KGSA 4WXHA 4A38A 2RREA 3A01A 3OS1A 2E1MB 4RB1A 4IO9F 1M4LA 1S7FA 3I64A 2X6OA 1V1HA 4KN7X 4YRHA 1SD5A 3M9AA 3JSOA 3KQXA 4UBRA 3CUQA 4CAFA 3C2GA 4NGQA 2OVOA 2GQQA 4UUSA 9WGAA 3OXGA 2EINH 2P6GA 3FX6A 4UVBA 4QLCU 4JWPA 1SFKA 3REOA 2M1BA 2IPQX 2GA1A 1M4DA 2VQYA 2EK9A 1HKQA 2DK5A 3QWPA 3SZTA 3TQNA 1OR7C 2WPXA 2IGMA 2MD0A 3GKRA 2W48A 4OMYA 4CCMA 2ZFUA 5IP9J 4ZY0A 2LMDA 4XNHC 3GTKJ 2ZEDA 4AD9A 1CM0A 3H9JA 1V55H 1YREA 4RLQA 3KLNA 5M3FJ 2GANA 4Z65A 5CYVA 1X10A 4OC3A 4Y49B 4KUAA 1QPMA 3V7ZA 2JA1A 4MEXF 3OR2C 4KITB 2YX7A 4IRGA 2NU1I 1FOYA 4BDYA 3MWMA 2EQRA 2KRHA 5DM7F 1VQLI 2P6AC 2HV2A 3CXSA 3LACA 2ZEOA 3SEQA 1SGEI 4YFXF 4BMHA 4EJUA 4IHSA 2ZJRF 1IOIA 1HOMA 1E17A 1FMWA 2IAIA 4B10A 3I9SA 1VHEA 3IWEA 1RNLA 2IGNA 2Y75A 3S9LA 3TO9A 4X0GA 3FMSA 2GOMA 2LR8A 3KY9A 2HQYA 4Y13A 4XBFA 4P9FA 1DU6A 2FT0A 4CYQA 2ZOGA 2ETHA 1KQ0A 1SMTA 3M8JA 3KLOA 2HVSA 2QSHX 3GTOJ 2L3DA 1R4MB 2JT1A 1NK3P 4UXNA 1SEUA 5F6FA 3IC1A 2OA4A 3K0LA 4I02A 4IQJA 3S1NJ 3EXNA 5C4JJ 2DQRA 1N71A 3CP8A 4KOWA 2PRQA 1GHCA 1I6XA 4CYCB 4WF2A 2FE3A 2A6TA 4IL6C 4BBRJ 4UFXA 2MW8A 1JUMA 5CJ9A 2JBJA 3SEZA 2DJNA 2K4JA 2XC7A 4B43A 3B73A 2DTRA 4X1EA 3OR1C 3GEZA 4L8AA 4UEFA 2TRTA 1CHOI 4P4FA 2E35A 4RGXA 2G9DA 4KOXA 4GRIA 3HM5A 1Z6TA 2EH3A 4KOVA 3EUAA 2PIYA 2J87A 3MN2A 4BE0A 2KMUA 2BCOA 5KTAA 1TWAJ 1TQMA 3I4MJ 2ZEMA 3CCVI 3NE8A 4QTRA 3PSFA 3ZMTA 4CGNA 3BR0A 2QEXI 2JW6A 1XIXA 1ZAOA 5DWMA 2PLYA 4HV6A 3VDXA 4KORA 1TOTA 3G1LA 4FQGA 1Z5RA 1OLTA 2C27A 1GYTA 1JHHA 3R5AA 3RCOA 2DA2A 1MMNA 5CVJA 2ISZA 4XRFA 2AJ6A 2PDOA 2E60A 3VFZA 5K7HA 2PG4A 1X2NA 2OQGA 4KFCA 4F9VA 2GA2A 4YFNF 4UA3A 3VSKA 2ZPAA 2NNNA 4MHYA 1HKTA 3ZPLA 5FLXK 4OC0A 2FBIA 3PNTA 1CGPA 2XEFA 3SXNA 3BT9A 2XAHA 3LSKA 1L0CA 3LSHA 2ATRA 2BGCA 5EX3A 3A2KA 1X3UA 4BHCA 2KMPA 1SFXA 2BY0A 3LQQA 3QTLD 3UOEA 1IY7A 2GLJA 1PP7U 2H8WA 4PK3A 1PJRA 1Z2IA 2KMRA 4C3IJ 2CWEA 4BQNA 2PJ0A 5G21A 1OYYA 3MKZA 1FJLA 2OF7A 1G59A 2Z3OA 3PFEA 1SAUA 2HFHA 3F22A 1IZ1A 3KASA 4MMOA 1Z77A 1R3NA 2P7VB 4HDVA 3F3XA 3LSGA 4E1PA 2FE7A 1MBJA 3I0TA 4I6ZA 2ICWG 4XORA 1K79A 2E5RA 2H6BA 3HOUJ 2H8RA 2NU4I 1TKFA 4NCZA 2KKOA 1QGPA 4UNOA 3PL8A 5HLTA 2E2JJ 1JWQA 3JR9A 3S17J 1JI8A 2KCXA 2I79A 1U9NA 4L18B 1NSAA 3CMEI 3DBHB 4E4HA 3J80Z 2PVVA 4UCNA 2GREA 3K4KA 3ZOBA 4CSWA 3E6MA 2Z2SB 3H0DA 1MH4A 1Z91A 1Q9BA 1ELMP 2Z3MA 1X12A 2VI7A 3CMAI 4B3AA 1JJ8C 1UFHA 3K2KA 3S3MA 3A9LA 4LK1F 4A33A 2R7DA 1JTXA 2ZC2A 3C18A 1H9TA 4FE7A 3PUBA 2O03A 1WGCA 1OCOH 3PDNA 1CGJI 2Z3LA 2M8GX 3DR8A 4XOTA 1FSHA 2IRFG 4XLEA 4NFRA 5D6EA 3O3KA 3SDBA 5ICGA 4KMFA 1U5KA 4A32A 1S7KA 4P9UA 5GPCA 5CQGA 1GLNA 3H5NA 1TQIA 3ZMVA 3PQJA 1TZLA 2VT3A 2O6GE 4P55A 1W7PB 3VYSB 5LD2C 4G8XA 3O6BB 2KRCA 1F4KA 3B2YA 1S7OA 1T95A 4E2AA 2PMZA 4MNUA 2GKVA 1VTNC 4C7HA 5J1QA 2CQQA 1R9TJ 2Q7SA 5K8PA 2QQ9A 1M1EB 4IXAA 4OAYA 1XFOA 5ERIA 4HSTA 1F2PA 2HQAA 2W0TA 1FTZA 2HDCA 4UV8A 3D1NI 5F08A 2CNMA 4KIBA 3ZMDA 2IA1A 4I7HA 2DW4A 2ZMEC 1N13A 4EMEA 4GS4A 1WWXA 2JZMA 2E1CA 1KUXA 3KP5A 1AUGA 4RB0A 2AXTC 2DOFA 1ZGWA 1FOKA 4RA2A 4KLVA 2VEZA 1Y0UA 2QA4I 5D5UB 4V2GA 3IU2A 1YX5A 3W91A 1OCPA 3ZQFA 1X4OA 5D4RA 4B1RA 2PJ1A 1AKHA 2Y69H 4JX6A 1T39A 4JCVE 1IXSB 3V8KA 3LSRA 2VKHA 3PIOF 3SI2A 3BJ7A 2M0CA 2IMOA 4UEZA 3DP7A 1YX3A 2DKVA 2JWTA 3FXQA 4I0AA 1NE9A 2XAJA 2B4DA 1OYIA 1W3SA 3T9YA 4C2TA 1OVOA 3KYLA 2B0LA 3S15J 2L0KA 3ABUA 1R49A 1E3OC 1CPSA 4L89A 3UGLA 1KA8A 3ZCOA 2UWMA 4RB2C 1ZG3A 2E1MC 2VLAA 4JXQA 1D1AA 4IHYA 1KONA 4A3IJ 3GW2A 2HDDA 1NH3A 3HYIA 2V8HA 3TGNA 1JUSA 1LVAA 2EA4A 2JDCA 1U2WA 2BY2A 3DLAA 2ANPA 1FMVA 5KAFC 3JRAA 2C6GA 3KHZA 4KT6A 2ODDA 1YTYA 1PU9A 3CC7I 2KJCA 4G6QA 3AL0C 1FBSA 4RMNA 1NTCA 3GBGA 3ZXSA 5LYDA 3SXYA 1XEBA 4FT8A 3W6SA 4HV5A 4BQOA 4PPZA 2V9PA 4W97A 1WSUA 4AVBA 1MMGA 1XMTA 2NU0I 4Y4RA 2R5ZA 2P6FA 1OJLA 2GOXB 4HF2A 5LLQA 2LOOA 3CUOA 3WTWC 2D5VA 3BHXA 4RBOA 1Y1VJ 2VPRA 1WJCA 1XMBA 2FQ4A 3SHPA 1R1UA 5K8MA 4EWTA 4BBHA 1U5TB 3CP2A 4BBSJ 2R7XA 2MSYA 5LRGA 2PJCA 1UVGA 1IN7A 3DPLC 4V19K 2PR8A 2BHZA 1TBQR 5TRDA 3KP4A 1XMXA 2M30A 2H94A 1WJAA 1X3WB 1K6OA 2QIRA 1BM9A 2JDDA 2OZGA 2P5KA 1R5GA 4J00A 4IQ4A 4A93J 3PP9A 2B63J 1VQNI 4PXEA 3VARA 4BINA 1IW7F 3WG7H 1UG2A 3L00A 1RI7A 3DBLB 1A6IA 2FF4A 2X6XA 3BJAA 3Q3SA 1WKMA 1ZRDA 3C7JA 3TP3A 2CGPA 2NMTA 2DFFA 4N9HA 2EBJA 2QBYB 4B4CA 5J47A 5DM6F 2SGEI 5DS9A 4AB7A 5FGMA 4F8ZA 1W0UA 3DPTA 1XN7A 3S2HJ 4F6AA 2XEIA 2K85A 2E36A 1XOVA 6PAXA 2KFDA 1MNMC 1TTYA 3S3OA 2QSFX 1FYKA 3R95A 4XSXF 3VDPA 2PSWA 4AWXB 1Z3XA 3OL4A 2PIZA 3IRRA 1F2OA 3HGYA 3F0AA 5EF6A 1HSJA 2HXIA 3IKTA 3VYUB 2V1CC 3BPVA 3C26A 3GUDA 3BJOA 4YEJA 3WHCA 3BC8A 1G3SA 4A0XA 1BOBA 3EYIA 1F43A 4OAEA 3ZQLA 2DU9A 4YIFA 2OR4A 1ZKGA 1XMAA 2K9LA 3K70D 2DF5A 3W6KB 2DPDA 4MLOA 3BR2A 1FOXA 2EJRA 5GCNA 4F92B 1FZPB 4IKFA 4XRMA 1J75A 1XTAA 2RNGA 4R8FA 3KZIC 1FP1D 2K9SA 1G4DA 2BYVE 2PJBA 2DYRH 5K7ZA 2JA2A 4MXUA 1BO4A 3P2FA 1TNSA 1ETKA 5CVIA 3BQYA 2AHQA 4X6AJ 3FBIB 2BXZA 2OCEA 4NDLA 4XPLA 2XGEA 2LC2A 1V5GA 2M34A 5H20A 3TOAA 3HH2C 3QNVA 2FX0A 1WI3A 1Z05A 5FUWA 5KVRA 2Q51A 4XKCA 4XLNF 4MGRA 2MLGA 3B6CA 1J9IA 3G2BA 3IP4B 3MVPA 2XKOA 3UY5A 2PN6A 2CQXA 1ODDA 4DBRA 2ZW4A 1HLVA 4KNYA 2X6WA 4I01A 4ZH4F 1Y9WA 1Z1DA 7WGAA 4UFVA 2L01A 4ENKA 2COMA 1BUSA 2F4IA 2J5PA 2A5YB 1ZG8A 1S7AA 2F4MB 3FXLA 3LAJA 5GTIC 2B0UC 2JUCA 3ESWB 2EWBA 2OC6A 2GWRA 2PQ8A 1ULYA 1HPTA 2BW3B 1G2HA 2OZHA 4DQ2A 1PUEE 4LB6B 1ERDA 5CKTA 2P6EA 3H9QA 1J7KA 2M3AA 5E20A 4A6EA 2FXFA 2BSWA 2DT6A 1T98A 2A5WA 3QRFF 2R92J 1IU8A 1D3YA 5D8LB 3S2DJ 3S6FA 2JUGA 3WTZA 4LFUA 3ZN1A 3P9KA 1E2XA 1FP2A 5D6FA 2EO8A 2QKMB 3IWFA 3FXJA 3RU0A 4GI3C 2NVXJ 5HVGA 1B8IB 4PSXA 2HVRA 1S3ZA 2O53A 4CRYB 2EA2A 4E6KG 4YIRX 3P9IA 2IT0A 2FMLA 2I10A 2W82A 3IKVA 2YNCA 1IRXA 2HYFA 3ZMSA 1P92A 1YHQI 3F6VA 4LMYA 4M3DA 3L2VA 2NU2I 1BA5A 3OYMA 1KWMA 2ESHA 3PGPA 2C6YA 5F47A 1QSTA 2DFIA 3M07A 5HOOA 2N17A 4BUPA 3ZMUA 1SVMA 2QVPA 4CO8A 3D8PA 1BC7C 5FFXA 2V1XA 1M4IA 4A5MA 3W6VA 2O7OA 2DXQA 4HF0A 1QQ9A 3OYFA 3S16J 4P4JA 3ONQA 3BZCA 4EM2A 1J09A 4UUVA 3RNZA 1Z7LA 1YS6A 4FD5A 5ILVA 2POKA 4OIRF 2G9WA 2BW3A 1LOKA 5KHDA 1W7PA 1LDJA 1OCTC 4CYPA 3QP5A 1WHUA 4E70A 2XRCA 1P4XA 4XLFA 5FUYA 1NK2P 3T90A 5FD5A 5GAGJ 2QQBA 1BLLE 1O3TA 3CCLI 4KYWA 3B7IA 2Y31A 4U87A 2M9HA 1X1AA 1D5VA 1DS2I 2X6YA 4GCVA 2JSCA 4XONA 2ZW7A 2HVQA 2M7BA 5LHHA 1ZQ3P 1QSRA 2XEGA 1NUBA 4P4EA 1W7PD 3WTTC 4EVIA 1VQKI 1I6HJ 3OIOA 3MFKA 4EJTA 5L3GA 2C6PA 3PB4X 2L4AA 1RRJA 4F0YA 1LE8B 2NS8A 3GX4X 4HLYA 4YG2F 3IAM2 4IHXA 2VQLA 5FUVA 2BEIA 3WHBA 2EZIA 3BLNA 5IB9A 2HYGD 4ZYHA 2V6EA 4TV7A 3H1CA 1VIXA 2M0MA 2RNJA 1VQ9I 3CF5F 3G3SA 9ANTA 1B8IA 4MJ8A 4KDPA 2XVCA 2UZKA 3QYEA 3VYTB 5FRMA 5IY5H 4B6ZA 3S14J 5EZHA 1AU7A 4HPSA 2ZXHA 5FKKA 2ZEHA 3A0HC 5LEKA 3H4QA 3MQ0A 1WFXA 3ZQCA 1J59A 3GUXA 4BJ5C 5JHWC 2VT2A 1IIDA 2M5WA 2OZUA 3BY6A 5B66C 1H9GA 2K9QA 4H2KA 3MZHA 1UFMA 1BBYA 3JAMZ 3WC5A 4G7OF 1POGA 1MNEA 3FB3A 3KX2A 1YYVA 5GADJ 2J8MA 3D4UA 1XSDA 5FLXZ 3FMCA 2PJ8A 3FNCA 4UXJA 2A61A 4MO7A 3VODA 3E3VA 1Y8FA 1YW6A 2CUEA 4S05A 1HDUA 3D2PA 3TC8A 2HGCA 2QQAA 5IV0A 1JGSA 1UHSA 2LREA 2M2EA 3GXOA 2R7FA 2LY1A 4XNHB 3D5LA 1LDDA 2XB5A 5D4SA 3H5RA 3SGBI 2XF6A 2WYRA 1ZN2A 5I0CA 2G0BA 4DZJA 1O4XA 2JMWA 1OMUA 2IJLA 2OUMA 4PJLA 2PBIA 1IB1E 4IRHA 4RI1A 4HYEA 2QMLA 2Q8KA 2XPUA 3GLXA 3L09A 3JRFA 1SFUA 2ORVA 3GLLA 2ZXVA 1TIQA 4NGTA 3WGIA 2XGXA 2C6CA 4QB9A 2DOEA 1XSVA 4NXYA 5K5QA 2VC1A 4MHPA 5DTDA 3K70C 2QQ0A 4YFKF 1Y39A 1ETVA 1FSEA 1HXDA 1SMYF 4IOCF 3CJTB 1ZG7A 1VGYA 3LL7A 5JH9A 3SXOA 2ZB9A 1RR7A 3AKZA 1WJEA 1SGPI 3MCZA 4G7HF 4MQVA 2QJ8A 3F8BA 3D7GA 2OAZA 1MJBA 2RAEA 2X4HA 3BZ6A 2DTZA 3FK7A 2JEVA 2LG4A 4YWYA 4LITA 4EFDA 5DYMA 3NAUA 4XLAA 4CCKA 4GXOA 2XPVA 5TGTA 1VHOA 4DYRA 1IRZA 4NGSA 3EETA 2RGVA 2GXAA 5EMIA 1WQ2A 1YOVB 2HXOA 2P4WA 3FXKA 4FHTA 3W3CA 5HLGA 3CC2I 2O28A 3HLPA 3GO5A 2VBQA 5K1YA 1DPUA 4R8HA 3ISZA 2R3SA 3GTJJ 3L2WA 5BPDA 4CGLA 2RVCA 1BR1A 4G9YA 2DA4A 3FHNA 4UV9A 3Q9SA 3OOPA 3RTRA 2XAUA 1V1IA 3FYNA 1J2XA 3NH4A 4IHMA 1QZEA 2V8DA 4UEEA 1S7LA 4FX0A 2R7QA 2VOPA 5EGOB 3CDIA 4IJAA 3K4NA 4AYBA 3T1BA 3VH9A 4C2XA 1S20A 3HEFA 2NSMA 3ABMH 4ZYAA 3BTLA 3FSYA 1YVKA 5F49A 2GIVA 4QUSA 1Y1WJ 1VQ7I 5IYCJ 1YR0A 2V53A 1P9GA 2AFWA 2G7UA 2ZSIB 4M3BA 3LSJA 1CPXA 4U88A 3VDUA 4HA8A 2L54A 1BI1A 2Z33A 2X3TA 3J81Z 2HI3A 4MI4A 3HB9A 4V2FA 4XKVA 1CT2I 2GIZA 3RKWA 3OYBA 1BAVA 4B47A 4AVCA 4Q48A 1MBEA 1ZR4A 2CV1A 2ORWA 1TW2A 5E17F 2V8VA 3BQZA 2WB1A 3TDZC 1BW6A 4H4KC 2XRLA 4HX7A 4LLLA 3KPHA 2FXAA 1YG2A 1TC3C 1ZH5A 3ZJ0A 1U78A 1UWYA 4QVTA 3V8IA 1U5TA 4E7LA 4BNCA 2LKSA 2VN2A 2VI6A 1Z67A 1K61A 3HKZN 4NGPA 2LEOA 1YLFA 3DPUA 1KBEA 2J8RA 5HQ8A 3GTGJ 2PJ9A 2HU9A 2WAQN 4KVOE 3H8EA 2AFOA 4PGGA 3ROUA 4S0HB 3FMQA 1Z8LA 2X9DA 3I59B 5HXDA 2OJED 3RKQA 3GFLA 5FO5A 1K4TA 1OBRA 2DIPA 4MTEA 3HOTA 2AFUA 2HPIA 2GFQA 3FKJA 4S04A 3IU1A 5BWAB 4R7MA 4DYOA 3CDXA 2NNYA 4A3EJ 5D5XB 2KRFA 2X1DA 4F7ZA 1W0TA 2DYSH 3LA2A 1SD7A 4LG0B 2EZLA 5IYDJ 1G3WA 3K4BA 3WR7A 1REPC 4Y17A 3I9V2 4A31A 3TOBA 2KZVA 1L0OC 5DS0A 2E7XA 5HMNA 2X48A 4I98B 4OOIA 1PUFB 4DYCA 2ZOFA 1T0FC 3A03A 3OS0A 1U8RA 1E0EA 5C3EJ 4W9YA 3RBUA 4B12A 2CTBA 4CRZB 3IH2A 4OP4A 2EFOA 4ZJZA 3BP8A 1SAXA 2LBFB 2FOKA 4N9IA 4WWCA 1A31A 3LA3A 1WI9A 2ZJ2A 1SGYI 2BHYA 2JVGA 4C2YA 1TURA 4FETA 3SZGA 3OIQA 1R71A 3HRUA 1YQAA 5HS9A 5B1AH 4D7NA 4RLFA 2SGFI 5FVJA 5GAEJ 1WGXA 2XSDC 5AGEA 1LR8A 1YTPA 2FNPA 1O7FA 3N4MA 3DU6A 4M3SA 1TWGJ 1Z4EA 4HBLA 1XX5A 3NARA 5E1ZB 1T8IA 1DS3I 1C0WA 2CNTA 2EBIA 4C7IA 3BG9A 4R9MA 3PBEA 4WXCA 3OSFA 4LIVA 5IT9K 4MPIA 5ISVA 1MNDA 3SJEA 5HLIA 5KNLA 2CW8A 4G6DA 1XS9A 3H92A 3QPSA 1YK3A 3K7AJ 3RJPA 3CMMA 5HDGA 4CZCA 2O8XA 5FUXA 4WWVA 3TCVA 1S8NA 4EATA 4RGSA 3TTHA 2ERWA 1UHAA 2HDWA 3IC7A 4WX9A 2A69F 4BJTA 2FNAA 2F5IA 4OC5A 5A2QK 3HRSA 4MFEA 3FJUA 3DFGA 2N52A 3LMMA 3JRIA 4I49A 1TWFJ 1LUJB 1PVEA 2CU7A 2VIXA 3RYRA 1Y1BA 1ETXA 3Q5FA 3I55I 1ON0A 2KLOA 3GTQJ 2R7OA 5M3MJ 3FC3A 4BYYA 3I4NJ 3QPHA 5LYIA 1ZHFA 1ITYA 4I2OA 3BPXA 2ISYA 5KTCA 2ELIA 3VWDA 2MG4A 5LGUA 1FT9A 1PCEA 3MRUA 4M9SA 1NSLA 2YSRA 3S6KA 1ETWA 2M45A 3IH3A 1MSEC 4ONUA 3R5BA 3K10A 1B72B 1M8CA 4XPDC 1LJ9A 4IRIA 3D68A 2V9VA 1KMAA 2QUFA 3R6SA 1VQMI 1UZCA 1FARA 2L9NA 2V9KA 2PX9A 1BIAA 2WA0A 4ZI6A 3R0AA 1B9MA 2PRBA 1HW2A 2VJ4A 3DV8A 4EVYA 1KBFA 4IHVA 2AFSA 3QYBA 3JRCA 4UB6C 3UEJA 3CUQB 3CQZJ 4NGMA 1TNTA 1QZYA 4DJAA 2NOGA 1LCPA 2F5FA 3W6XA 3E2IA 1K78B 4MTDA 4F93B 2WBMA 4M72A 1MBHA 1JT0A 3D00A 1I1SA 2X7BA 1IG7A 1GHEA 4E7JA 4RUHA 2QYOA 2R7RA 4KOTA 1K7AA 2IP2A 3KZZA 2LSOA 4XR6A 1RXTA 3P7NA 2W1OA 5TJJA 4UXIA 1R43A 2B4DB 2V26A 2WY8Q 3IHUA 3SGQI 1O57A 5A28A 6CPAA 4HAMA 4CYCA 3QP6A 2YNDA 2V4JC 1S7NA 4WK8F 3T5XA 3VATA 5J1UA 4MFJA 2Q44A 4BQAA 2BOAA 3NWTA 2KIQA 3JTGA 1B6BA 2QVOA 3BJ8A 4C3HJ 1USTA 5FJ8J 5D5VB 1Z8TA 1YLOA 3WTSC 4R3LA 2FS5A 4NEXA 1D1CA 2KIMA 5J4VA 2DOAA 3L2RA 2R8VA 3JW4A 3ISPA 3CJNA 4BHPA 1YW7A 2PJ3A 1XPXA 4Y7NJ 2Y0SA 2MYSA 3AG2H 4I09A 1U3EM 1Z0XA 3HSRA 3VEPA 3N5FA 2VBXA 3A0BC 5H6RA 3QAYA 4NSQA 5ICFA 3H3UA 2DODA 4E7SA 4A2ZA 4CGMA 2K9MA 1JKRC 4NC7A 5H2FC 3ERED 2YUSA 5L3CA 3AAFA 4A95A 3TW7A 1B72A 5M5XJ 2R7SA 2L8EA 3UGIA 5AG6A 1K7TA 2LTPA 4L5IA 1ULKA 1XC5A 1G8XA 5JFRA 3KYCB 1T56A 4U0VA 3T8RA 1PTQA 2VKDA 5HNHA 4XRSA 2BL1A 1HEEA 2W4SA 4MFKA 2N8GA 4PGHA 2O4HA 1HEVA 4R79A 4NNJA 3J7AO 1YVOA 5LRKA 3L2QA 1P9ZA 1IDYA 2LDUA 4L9VA 2B3VA 3VE5A 1S5KA 2L7MP 1Q2YA 1MD0A 2O0YA 3FWEA 1OMTA 4C2ZA 3SJXA 1SVLA 4OU0A 4QIWN 2BXYA 4QWQA 1FBUA 2ENZA 1WJBA 4HGUA 2J9AA 2ESNA 2NVQJ 1DQUA 4OIOF 1PPFI 3CLQA 2HWVA 1YJNI 3VWBA 3TO6A 4KSAA 4KSFA 1R57A 3CJQB 4M71A 5D8KB 1CT0I 2NOJB 1I1DA 3RPQA 1PDNC 3AL0B 1HDLA 2BUEA 4RB3C 1X1BA 5LYFA 3KCCA 3WODF 3EPZA 5DUKA 4E7KA 2R7ZJ 1ZLJA 2A6EF 1MIJA 2BZTA 3BR6A 4XKBA 2FSRA 3DEUA 2GAUA 2K3PA 3QYFA 1TWCJ 2WZNA 4Q47A 3IWGA 4ZY1A 5D5WB 2EFNA 3GTLJ 2EB7A 2SGDI 1MT1A 1JTYA 3EUKL 3ABKH 5IYBJ 2I8DA 4BACA 4CGPA 4A12A 4KVME 4A69C 3FDYA 4RS8A 4EJWA 1DUXC 3JRGA 4MHDA 4OIDA 1WCMJ 2HUZA 3FRMA 1TLHB 1W36D 3KKWA 3OV8A 4X5KA 4XPKA 4XN0A 2D4OA 2Q0YA 1IDZA 3FF3A 5BPIA 2QM3A 1Z9CA 4AM3A 1K83J 2DO7A 1CT4I 1JUPA 5ICCA 3RSNA 3CC4I 5KAIC 2LFBA 1Y0YA 5F48A 5J6XA 4XIDA 4GM5A 1R22A 3BCBA 1ZRCA 2L4MA 4C2UA 3DWLE 3L2NA 3KHXA 3K9TA 5ED4A 1OKRA 3BTCA 3QB8A 3IIBA 3IL2A 3W2WA 1HDQA 5FKLA 1XF8A 4XN3A 4K30A 2BVLA 3VWEA 4KOSA 2CYYA 3OYKA 3M8FA 5KK1A 2VQCA 3RZAA 1V5EA 5IPAA 3CXQA 1UVFA 1R23A 4DBQA 2HB6A 2LB7A 2VXKA 1IO2A 5C4XJ 5LBQA 5JVTA 1WH5A 4NJQA 3NWSA 5H6QA 4MCSA 2LK2A 2JK3A 5L3FA 3GTPJ 3S2WA 1WKXA 3OXFA 4UWJA 5J1RA 1D8KA 5F46A 3F21A 1FY7A 3KI9A 3Q0VA 4AXVA 2QLZA 1PYTB 2YX4A 4KISA 2OV7A 1J5YA 4XLPF 3IJ3A 1K4SA 2G0EA 1P2FA 5F0CA 3S6GA 2OBPA 1IICA 1XDUA 4D0PA 4ZYGA 4BKXA 1O3SA 3E6DA 4C2MJ 4AG7A 2WC2A 2YUUA 4IK2A 4CAVA 3MN8A 3PJRA 2WV1A 5LHGA 3ZRGA 4NGNA 3RZDJ 2FOWA 5J1YA 3J7ZI 5G22A 1IOFA 3ZR8X 1PTRA 5HODA 1CGII 3R4KA 3HPHA 2WADA 4CCLA 1Z4RA 4KUBA 2LKXA 1S5LC 2CQNA 4NQWB 3FF5A 5L3EA 4OIPF 3COAC 1SD6A 1Y7EA 1BI2A 1LVKA 4LK0F 2HQRA 4B5PA 2FBHA 2FBKA 3QOEA 4PK4A 1K78A 1QRYA 1DU0A 5DWNA 4A3GJ 2CQ7A 1DTDA 2FSWA 3MKYB 1BI0A 1PYVA 2LVSA 2CV0A 2QGUA 2L7XA 1IAWA 2KMQA 4UB8C 1IY5A 3GF2A 1VZ0A 5G1ZA 2LUYA 1YI2I 4LB5A 3K4MA 5AIQA 5FKMA 1GV5A 1KZFA 3R61A 2DPUA 3JTKA 1Q1VA 3HRTA 2E2IJ 1IYLA 3QPTA 1F9NA 3WG9A 2IVMA 2ELJA 3ZZIA 2DDBA 1IUYA 4MHGA 1S60A 1D1BA 1ZK8A 3EC4A 3F8NA 3KEOA 2E73A 2CF4A 2F7VA 3JAMK 5J4YA 2Z3YA 4OADA 2D2WA 3S32A 3SDGA 2LBFA 1NG7A 3E7LA 3F8CA 4U9YA 3ECOA 4MFLA 2KDZA 1P9QC 2ZMEA 1D0ZA 2WB1N 5FD6A 2DQLA 3DSBA 3T8WA 4ZYEA 5KTDA 5J8FA 5HNFA 1BC8C 2HQNA 4HNYB 2BO9A 5E1XA 2VQGA 4L0ZB 3E59A 4ESFA 2MC4A 3MMYB 3W6JB 2AQEA 4HG2A 2IXSA 3PFOA 3GCMA 2Y0SN 2JN6A 2CUFA 5M5YJ 1FYLA 1CBXA 3RYPA 4LUAA 1XGMA 4XNFA 1U8BA 1VQ4I 1OFCX 4A94A 3S93A 4NGRA 4A2UA 1LANA 4P44A 3SZPA 3FEDA 2Z99A 2QZ8A 5JM6A 2XF7A 3DEWA 3OYCA 2ID6A 2UV1A 2FIAA 1GDTA 3TO7A 3EYYA 1N78A 3FXUA 1V3FA 3AG1H 2ZXIA 4XSZF 3SEKC 1IV6A 1TBNA 5CLSA 2Z9OA 3KFWX 4IF5A 5H86A 4IHTA 4FD4A 2VJIA 2MFZA 2W85A 5LGTA 1KUVA 3GB0A 2VL1A 3UEYA 1DP3A 3QAHA 3HGGA 1WJFA 3G71I 1AHDP 5CPAA 1R7JA 3RPUA 1YW8A 1FBQA 3P5JA 2VBYA 3S9MA 3HOWJ 1TT0A 4CYNA 2IW5A 2HTSA 1P7JA 2P81A 2DA3A 3J81K 4ETSA 1Y0NA 2F5DA 1CX8A 3WTUC 1K7UA 4A30A 2ENNA 4IEJA 3JSPA 3UFFA 3ABTA 2HEOA 2P5VA 1FAQA 4NF1A 4AIHA 2R1IA 1TP4A 3RKYA 3BG7A 1CE3A 2PJAA 4UF4A 2R7HA 3S6HA 3G8WA 1X74A 2COBA 3B3WA 1DE4C 2XF5A 3ML6A 2E34A 2V8GA 2E2HJ 2KJBA 3GZ6A 3WTXC 3FM5A 3EO4A 5L3BA 2WGCA 3GOXA 3F9KA 4HX8A 1Y0RA 3R96A 1WVRA 1FOWA 4HKFA 2Q4ZA 1QVTA 4PJJA 3ZMZA 2XASA 3I59A 4FASD 4CYOA 1HQCA 2P5LC 4HDUA 5G20A 2LY2A 1EH6A 4AIJA 2ACJA 1RETA 1ZTRA 4KOYA 2ZFWA 2HOEA 1HSTA 4LIUA 2Q0OA 4PFPA 1X1DA 1ZREA 3RYOA 3KP3A 1XGSA 3H8GA 4M6HA 2R7UA 4R6TA 2I5UA 4BEHB 4A3BJ 4H6ZA 4EM0B 3CTAA 4ENMA 2BVMA 2V1DA 1O3RA 3RDIA 2DB6A 2CS3A 3CCMI 5DDGA 5JR3A 4BDZA 1MMSA 1GVDA 1XX6A 3EUHC 2SGQI 1I21A 3RAMA 4LGWA 2CWGA 2AXLA 3MGDA 5JHFA 3U2RA 2C1CA 2DN0A 5E3LA 2ODFA 3QWLA 1Y56A 2ZW5A 5D8NA 2KPMA 3W2AA 1BI3A 1Z21A 2QF7A 3CCJI 2OZ6A 1TIHA 3AFHA 4MY0A 2JYYA 3BJ6A 4M9ZA 3LNQA 2MGQA 3OY9A 1DDNA 1MH3A 3MD2A 3ZN0A 3KE2A 2VZZA 3A4CA 3LQRA 1RTQA 2PVWA 4UCMA 4R87A 3K4LA 1WRJA 2Z0ZA 1KU9A 1RFHA 3MEKA 1SGDI 2W25A 3JRBA 1VFCA 3ECHA 4RM2A 1R00A 5IT9Z 1W4RA 1MK4A 3PB9X 2DPTA 3C1DA 5E18F 4FX4A 3WGGA 4OVOA 3DGVA 4UIBA 2FNFX 1A04A 1YQEA 2K5TA 3BLYA 2RQQA 4PCQA 4BE1A 1A35A 2RDPA 3DLJA 1B6AA 4O5VA 4KN4X 1AN1I 3AG4H 2PJPA 3FIWA 2OD1A 4C9YA 3U21A 2J8NA 4HEA2 1ZRFA 1BJZA 2EIKH 2PJRA 3U9GA 1R58A 1V4RA 3EQLF 3N97A 3KEQA 2OOTA 3GY9A 4EM1A 3V8JA 3DF8A 1TBRR 5HI7A 2ZXWH 3BTIA 2JQ7A 3CZ6A 3I58A 2Z1DA 4XQFA 5J8CA 2L9VA 1YRNA 1HJAI 3ZP5A 3M7GA 1UAAA 1D8JA 3DTIA 1M1DA 2V1NA 2PJ5A 3PEIA 4PV6A 4W1UA 3I56I 7CPAA 3PIPF 4B44A 3HHGA 2Y9ZA 4DOZA 2FRHA 4HNXB 3WT4A 3V42A 4FISA 1VHSA 5LRJA 3SJMA 2VPLA 5HDNA 2XHKA 2WV0A 3I4PA 3K1MA 3V7CA 1LQ1A 1K4JA 5DCMA 1LRZA 3CCUI 4DGWB 3WGHA 5HVQC 4MFQA 4OMEA 4A0ZA 1L3LA 5CVUA 5IX3A 4A6DA 4A3DJ 1LFPA 4F55A 1ZELA 1OYWA 5EDNA 3ZQQA 4A3KJ 1ZG1A 2JRMA 2FA5A 1ETOA 2D45A 1CP7A 1ZLIA 1H8AC 4HQMA 2R98A 2DJIA 3LSIA 4IAVA 3R9FA 3LWFA 3DU5A 3FECA 4B48A 2PCUA 3CXPA 3VPRA 1LFBA 1BL0A 3BTJA 1MSFC 1U6MA 2EV6A 3PBBA 5HVFA 3DR6A 1IXRC 4C68A 5JPHA 4ZYDA 3UKGA 2ZJQF 3OXLA 1KZHA 3TX8A 3BCAA 2EIMH 4MFPA 2M87A 3FMRA 3HSFA 1CF7B 3H35A 2GXGA 5HLHA 2HOAA 1ZG9A 3BR3A 4QSHA 1BW5A 3LA7A 4BL0B 4M74A 3BDDA 3IWWA 1UG0A 1FYBA 3F6OA 4F0XA 4GYGA 3JRUA 3KYDB 1LFUP 3A1YA 2MABA 4J3GA 2WSAA 3QU3A 3D0SA 4ZX9A 3HUGA 2IBDA 1SGQI 1QSOA 4JXRA 5AG4A 2EZKA 2DMPA 3TW6A 2A68F 2R5YA 4ZDLA 4FWUA 4FBEA 3IRQA 2JA5J 4ZC3A 4RGUA 1YW4A 4C3JJ 4L9JA 2J9RA 2WAQA 1LAPA 2VE8A 5DD8A 5JGFA 3GTMJ 3R9GA 3ZQ7A 2MBFA 3W2VA 2B58A 4C30A 1Q2CA 1F36A 4HW0A 4N0BA 4AVZA 2Q7BA 2L7KA 2WY7Q 4NHJA 3LWUA 2DT5A 1T2KA 3P2HA 4XRSG 4Q36A 4B3XA 4IUSA 4M85A 5GPAA 1NHAA 2CH0A 1LFWA 1FYMA 1VQPI 3BI0A 4NUBA 2VODA 5ICEA
chains in the Genus database with same CATH topology
2E7WA 1B87A 1ZYRF 5E8IA 2K7LA 4M6YA 4ESBA 2F5CA 3JUWA 1S3JA 3I71A 1HW1A 2QENA 3F5BA 2B5GA 3V8LA 3FXRA 1IYKA 5ILUA 3WU1B 5F1RA 1U6GA 2I00A 3LAPA 4XPDB 2MC3A 4Z2YA 5H84A 2H6CA 1JE8A 3E5XA 1P4WA 4FD7A 3U1DA 2CNSA 3I3GA 1UCRA 4R57A 1UHMA 2WTEA 3EUHA 4HLXA 2G3AA 3GYHX 4U0WA 3DKWA 3GWZA 5HDKA 3PQKA 5BQTA 1QZZA 2PR1A 1XCBA 3GVAA 4LG0A 3E0KA 3K9UA 4OIQF 2CO5A 2H09A 3J80K 3QU6A 3TE4A 1STZA 2HTJA 5HS8A 2EV5A 3E5QA 4UVCA 4ZZLA 1Z9UA 5DUIA 2E1NA 2KIFA 2STWA 4KS9A 2XAFA 3E5UA 3EY5A 3R0JA 1P4NA 1H0MA 5HH1A 5E8GA 3EFAA 4CDGA 3G73A 4ENJA 2J5OA 4ZGYB 1OZPA 3L2CA 2KCWA 1TW3A 1UHWA 1S29A 1KQ9A 2GZWA 2LF8A 2XKPA 4B5OA 2ZBKA 1T38A 3HIFA 2PFBA 4HOBA 1I5ZA 2STTA 3K69A 2IA0A 1R1TA 3WTYC 3HTSB 1B59A 2A07F 1XB4A 2XAGA 1ON2A 1FPQA 1QBJA 2LKPA 2HS5A 1V0CA 3KP2A 3E97A 1NMTA 4ZBGA 3FBUA 5AG5A 2VE9A 1GXQA 5CVRA 1OPCA 1W4MA 2ZNYA 4KIGA 3FHZA 2B5GB 2W24A 5DEQA 1M4GA 3OWCA 2NS0A 3FM3A 3VOEA 3ELKA 2CXAA 2HR3A 2REEA 5LRSA 4B14A 1XD7A 2DAOA 4OMZA 4JD6A 1RUNA 1OR7A 3I54A 3Q9VA 2LNBA 5DV5A 2A4NA 3F8FA 4CS0B 4KOUA 1AWCA 4ASNA 2WUUA 1Y7RA 3NE7A 4KLWA 4H6UA 2EFWA 4MBUA 2IL4A 1LEAA 3BWGA 1USSA 5JQ4A 3RI4A 3WU0A 2CFXA 2Y48A 4Q5SF 2K27A 2REFA 1MJ9A 2OU2A 1O7LA 4KMUX 2JTVA 2CG4A 3IGRA 1I1GA 5A27A 2D4PA 4IPAA 2Z3NA 4YFJA 1F5TA 4MFZA 4IF4A 5EBVA 5C88A 2MLKA 2XRNA 1M44A 1IN4A 2Q4YA 4ON0A 2P6TA 5EC4A 4BXUA 1YIOA 4HX4A 4RAZA 1W5TA 5E96A 2RN7A 5LRRA 2ZKZA 1YS7A 2JZYA 4G7ZF 4KUMA 4H89A