1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Esa1 protein
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
3FMRA 4KZTA 4H6ZA 2JRTA 4M71A 2JPCA 5TRDA 2PFBA 3DPLC 4O5VA 4Y13A 1IRFA 2W57A 4MHDA 2JEVA 3VWDA 2ISZA 4IRIA 3QP5A 1B4AA 1HSTA 1ON0A 1RNLA 3I59A 4HF2A 2WC2A 4A0ZA 4L0YB 3WU1B 4BNCA 2B3VA 2ZW7A 4OAEA 4HLXA 1ON2A 1T2KA 4HQEA 1Q1HA 4UWJA 3I3GA 4CICA 1OYYA 4IVNA 3KLOA 2HS5A 4I02A 2BBYA 4OIQF 1XMAA 4AVPA 4KOXA 3GUDA 3HYIA 2HV2A 5FO5A 1ZHFA 3BY6A 2C27A 4MJ8A 1BN5A 1SMYF 1QSMA 2HDCA 1S7FA 1BOBA 2ZW5A 1R58A 2IW5A 2CNMA 1FLIA 4NSQA 3F22A 4I0AA 5HLHA 1S5KA 1WKMA 2XVCA 3CUOA 3COAC 1U5TA 4AG7A 2GWRA 4OIOF 2XIGA 1CF7B 2FA5A 2VOPA 2FF4A 5LGTA 3REOA 4J3GA 3CO6C 3C7JA 2O28A 4YGOA 2AS5F 4ESJA 3IHUA 4ETSA 3ABUA 1G3TA 4AVCA 3KEOA 5HH1A 2EFQA 4XSXF 2WPWA 2H94A 3TE4A 4RGSA 4XLPF 3F6OA 4IF5A 2MBFA 4U5YA 2RVCA 3RIRA 3UY5A 2A3SA 3HOTA 3P2FA 2F5DA 3LODA 5ILSA 2A4NA 4OLLA 4KNYA 1QSNA 1BIBA 1XSDA 1QSRA 3CTAA 5F64A 2E1NA 5DCFA 1PU9A 2PDOA 1USTA 3BJOA 3HSRA 1MZBA 2MLKA 1RUOA 2OH1A 5LHIA 3C3WA 4HF0A 4ON0A 1TLHB 2FL4A 1XB4A 2OB0A 3ZZIA 5C88A 4KYWA 1J4JA 4M85A 2HYFA 2PG4A 1U78A 4XSZF 5ILVA 3MZHA 4R79A 1F4KA 4WF2A 5IT9K 3GYAA 2A6HF 2O0YA 2VBXA 4X5KA 1H9GA 2L54A 4CO8A 3O2PE 2EB7A 2QQ9A 3ELKA 3WGHA 2EWNA 2PSWA 2P5VA 2CY2A 2OZUA 1J7KA 2YSRA 1NMTA 3EXNA 1QGPA 2A68F 1RO5A 4PSWA 1FBUA 3V7CA 1XE4A 3ZMSA 1ZG5A 5D8KB 2ZW4A 1I1GA 4KIGA 1IYKA 5HDKA 1T0FA 3C1DA 1P2FA 1NE9A 5K5QA 3IC7A 4AVBA 3LSTA 4NB5A 2Q44A 5LRRA 5EC4A 3HSFA 3TKYA 1J75A 2G7UA 2ZNZA 2QVOA 1KUXA 4HLYA 1K79A 3VOEA 4L5JA 1WWXA 2BUEA 4A12A 4OINF 3WTSC 2EV5A 2CQKA 3F8KA 2RDPA 2B3UA 3FB3A 5HMNA 1XSXA 3FYNA 3R95A 2GAUA 1IICA 1YW9A 4KVME 3U9GA 1MKMA 3WTZA 2OA4A 2PBIA 5L3CA 2XAQA 4UVAA 5BOXA 2A07F 2DPUA 1P92A 4RI1A 4I0BA 4KOTA 3M7GA 2FXAA 5HS8A 4R3LA 3AAFA 3DV8A 4RGRA 1I1DA 2BSWA 2CO5A 4CAVA 1A04A 5FD6A 4KVOE 4MGRA 1XF8A 2B0LA 1YFHA 3HRSA 4L18B 2GA1A 1YW8A 4L5IA 3E5QA 3TQNA 3CJNA 3FXRA 4LFUA 2FSRA 4IUSA 2AJ6A 1ZRDA 1LVAA 1BI2A 3K9TA 1U2WA 4WWCA 1GXQA 2FMYA 2FXFA 4KMFA 2PRBA 1L3LA 1Z4RA 2VZZA 1CGPA 1P6RA 2DW4A 2D2WA 2KJBA 3R60A 1HKSA 3GF2A 1SD7A 4KOYA 4KOWA 5F1RA 2D1VA 2QQAA 1MJBA 3RPUA 3P9CA 3MEXA 4RGXA 4YRHA 3BOQA 3TO6A 2D1HA 4Y15A 3RYPA 4LGWA 2ISYA 1REPC 2QWWA 4EGZA 2O8XA 3V8KA 3GWZA 2CW0F 2K86A 3E0KA 2FIWA 3F23A 4U0WA 4M6XA 2H6BA 3PQKA 4CAXA 1R23A 3BJ7A 5F6FA 4PK3A 3J81K 4GO1A 4I01A 5DWNA 1SD4A 3GFLA 4ESBA 2FE3A 4RAZA 3VEPA 3EFAA 3IWGA 1CF7A 1Z4EA 2G0BA 1Y9KA 1ULYA 3IL2A 2ZCWA 4S05A 4UXNA 2RGVA 3K2ZA 3K69A 4Q48A 2ZXJA 1KYWA 5CVRA 4HA8A 2G7HA 2LSOA 4CS0B 1ZG1A 5E1ZB 2M5WA 3MQ0A 4AVAA 3WE3A 2G9WA 2MD5A 4L9TA 2YR2A 1Z6TA 3ECOA 4FX0A 4F0YA 3BPXA 3NQOA 2FRHA 1RZ4A 4HV6A 4QB9A 1I12A 2COMA 3LQRA 6PAXA 2IL4A 1ZGAA 1KU9A 1DUXC 5BMZA 4MI4A 1S7LA 1FNNA 1Q2CA 1IXRC 4MTDA 4BH9A 1L0OC 2KIFA 3CO7C 5JR3A 2STTA 2KIMA 3DKWA 2P7CB 2HGCA 1AOYA 4KOUA 3E97A 1DPRA 1H9TA 4XPKA 2JZYA 2BEIA 2P6FA 5E17F 3R4KA 1XN7A 2RQPA 1Y0UA 2P6GA 1J5YA 5DD8A 3T5XA 2DTRA 5E18F 1T98A 3EQLF 4E8OA 1B9MA 3M1EA 3GKRA 1Z6RA 3LQQA 1RUNA 1QO0D 3F8MA 4YFJA 4MBUA 4U0YA 2MH9A 3CLOA 3ZN1A 1LEAA 3ISPA 3M8FA 2UZKA 2OZ6A 3LA2A 2XAGA 2R7DA 2XUBA 1OKRA 2FNAA 1QSTA 4YFKF 2FBKA 3R9FA 5FLXZ 2HTSA 3E5UA 2E7WA 4M9SA 4EJOA 3JUWA 2D4PA 2JT1A 5KK1A 2KIUA 4YIIA 2XKOA 3L7WA 4II9A 2IA0A 3KP6A 5L3EA 3LA7A 3CUQC 4RS8A 4HDUA 3V8JA 4BHCA 5E1XA 5AONA 4FD5A 1I21A 4I98B 4CAWA 4HYEA 3DNSA 3TOAA 1PP8F 5JQ4A 1OYWA 3R61A 2XROA 5A2QK 1T39A 4RAYA 4G6QA 1WI9A 3TGNA 5A2QZ 4P55A 5J6XA 4AG9A 3U1DA 5CVUA 1UHMA 5KTAA 1U8RA 4P9UA 1IN7A 2PEXA 4BQAA 4LJZF 5DYMA 2QBYA 2QECA 5DUKA 2M8EA 3WGGA 1I1SA 4GS4A 1FYLA 3HHHA 5BPDA 2ZW6A 2KRFA 3V8LA 1E17A 3WR7A 3FM3A 3RTRA 4EM1A 2HUZA 4A5NA 1W4MA 3GY9A 2DAOA 4FD6A 2FT0A 3V4GA 3HTUA 2EFOA 1MJAA 4BYYA 5IX3A 1WQ2A 2L02A 1B59A 4GYIA 1KYZA 2D4OA 3KP7A 4U88A 1ZN2A 1BC8C 2ZPAA 4EGYA 3IWFA 4YG2F 1UCRA 1BOAA 3DEUA 2IJLA 3G8WA 3FMSA 4ENJA 3I71A 4LLGF 3I58A 2DFIA 2F5IA 3TTHA 4RB2C 1IIDA 3HHGA 4IXAA 4DQ2A 1C0WA 1ZRFA 1RXTA 2HR3A 1XGMA 3R0JA 2ACJA 2CG4A 2VE8A 1U6MA 3EC4A 5D8LB 3D2PA 5CLSA 2GXGA 1IW7F 3B73A 3LAJA 4ZYDA 2EFNA 1SQHA 1O3QA 3GZ6A 1R00A 5LGUA 1TW2A 4ZH4F 3W6JB 2P7VB 3I59B 2EVNA 5FFZA 1Z7UA 1BIAA 2EV0A 2OZHA 2PR1A 4JJXA 1Q2DA 3SZTA 1O7FA 4UUVA 3FHZA 2PR8A 4BMHA 5JVTA 1XCVA 1YX0A 4H6UA 2B5GB 2NAZA 3JTHA 5CVVA 5E20A 1Y7RA 1K78A 4N9HA 2ZNYA 1MD0A 2K5TA 3WODF 1ZRCA 2ZMEB 3GYHX 1QQIA 1ODDA 4G94A 2Y48A 2WWYA 3VFZA 4CGZA 4XPLA 1NHAA 3R9GA 1W7PB 5D6FA 2ZO4A 1EH7A 3KKWA 3RPQA 2ATRA 1YO5C 4EMSA 5AIPA 3ZMUA 2PN6A 1XMKA 4UBRA 1IN4A 1F5TA 2KKOA 2DQLA 5FD5A 4Z2YA 1K6OA 3FZVA 2M30A 4M9XA 4A6DA 3CUQB 4EJWA 3DR6A 3EY5A 3MAJA 4G8XA 2UXNA 5IV0A 2EUIA 3R1KA 3D0SA 1XEBA 1TNTA 3V7SA 5CNPA 2QIRA 3LFKA 1QBJA 1GHCA 2P5LC 2I00A 3FXQA 5ICCA 5L3FA 3L09A 3TDZC 4L0ZB 2Q0OA 5HDGA 4ENNA 2RNJA 4QUSA 3R9EA 1V3FA 5D4SA 2CNSA 3HRUA 4WXHA 1G6NA 1FSHA 3E5XA 3WU0A 1R36A 2FOKA 2R3SA 1HKQA 3MCZA 4HAMA 2QQBA 1S60A 2BE5F 3D5LA 1S29A 1STZA 5D6EA 5EEGA 1I6XA 1TW3A 3GFIA 2Y0MA 1SFEA 4XLNF 1XCBA 4ASNA 2VBWA 1Z9CA 2K27A 3DP7A 4IHSA 3W91A 4RB3C 3ZPLA 4HV5A 4M6YA 2HEOA 2C6YA 3OOPA 4EJVA 1QSOA 3DQVC 3W6KB 2J8NA 3EDPA 2E7XA 4BHBA 4OU0A 1RIOH 3HOSA 2VXKA 1IN8A 3J7AO 1S7OA 1G3SA 3O3KA 1ZARA 4XNHC 2HZTA 4U7DA 1P4WA 4HKFA 1BI1A 2F5EA 3SXYA 3ZP5A 2W85A 3WTUC 2Z0ZA 5DCMA 3SXNA 2OQRA 4LD5A 1IYLA 2MA3A 2B5GA 2B4DB 2P4WA 1XGOA 5CJ9A 2K4BA 3QPTA 3E6MA 5DV5A 2IP2A 3KFWX 4CRZB 2PMHA 1YK3A 3RKXA 4UNOA 5DD4A 3LWFA 5JI6A 3FWEA 2DU9A 1TIQA 3QU6A 1IAWA 2XHKA 2Z11A 4KORA 1S3JA 4QVTA 1XSVA 3SQNA 1SD5A 2V79A 3WTWC 3B02A 1T6SA 4UA3A 4NXYA 3ML6A 1D8JA 3RDIA 2XKPA 1O3RA 4I09A 4BXUA 2YX7A 4F7ZA 3T90A 1QPMA 1Z05A 1K78B 1TTYA 2WPXA 3GEZA 2FCKA 3D8PA 5FVJA 1R57A 4I49A 3F8CA 3FMQA 3FRMA 5D5WB 2P5KA 2QZ8A 1U3EM 2NYXA 4LG0B 4K30A 5D5VB 2HTJA 1BC7C 3MWMA 3W6XA 2FNPA 3R6SA 4HOBA 4JWPA 1X3UA 4M72A 1FWZA 5H6RA 3EYIA 4KUAA 2XAHA 2F2EA 1IUYA 3OWCA 3SHPA 5DWMA 2V1DA 1OZPA 1UHWA 3BJ6A 1J59A 4OIRF 5HDNA 2JDDA 4U7BA 4KOSA 3I9SA 1D8KA 1MDMB 2K4JA 3FXUA 4R3KA 4D0PA 1IN5A 2BL1A 1M4DA 2L01A 3QB8A 3TCVA 1FC3A 4H89A 3TO7A 1BO4A 3ROUA 1LJ9A 2HOEA 2JPBA 3I0TA 4E70A 1XGSA 5H86A 4JXRA 1YG2A 1R1VA 4AD9A 1ZYRF 4EV0A 3N7ZA 4ENMA 4MEXF 5D5UB 3FM5A 4U9YA 5HS7A 4LX9A 2DK5A 1ON1A 3TT2A 4TV7A 3K1NA 1BI0A 2Z99A 3EETA 1FX7A 2Z3YA 3E6CC 3E3VA 2L4AA 5BPIA 2RC4A 3IRQA 1MGTA 1Y9WA 2FU4A 3ERED 2Y75A 4ZYGA 3J81Z 3DFGA 4UV9A 3H3UA 3GLXA 1R22A 1KQ8A 4A0XA 1FBSA 2OQGA 2P6SA 1V0CA 3ECHA 2PQ8A 4CHUA 1ZLJA 5C82A 4KFCA 5AIQA 1XIXA 3G3ZA 4IRGA 1UB9A 3L9FA 5F46A 2B4DA 4XNHB 4UVBA 4NF1A 2VT2A 5D4RA 3K1PA 4A0YA 1WSUA 1IXCA 2EV6A 3WTTC 2ZKZA 4A2UA 5BQTA 4Y17A 2HKXA 2E1CA 5FFXA 5EBVA 2NRAC 2ETHA 3L2CA 1PUAA 2HQRA 4HZFA 2J8RA 2A6EF 5FLXK 4KUMA 5LRSA 3D3SA 2PMUA 2ZMEA 2LDUA 4PV6A 3KLNA 1F1ZA 4P5OA 1KUVA 1FYMA 1HKTA 4HF1A 3QP6A 1F9NA 4WXDA 2YPRA 2W84A 4ZZDA 4ZYHA 1B9NA 4PSXA 3H4QA 4HX8A 5ICFA 2Q8KA 5L3BA 4KOVA 5KTDA 2QYOA 3KP3A 1HW1A 3WGIA 2QUFA 4HX7A 3DSBA 2FBIA 2O3FA 2EA4A 2LF7A 3I5UA 4CZZA 1IN6A 4OIPF 4IF4A 1GVJA 3OV8A 2REFA 4GYGA 1O57A 3BJ8A 5K5RA 3TDUC 5IT9Z 4ZBGA 5F48A 1MK4A 1OMIA 3QU3A 4KMUX 5CYVA 2DQRA 4PK2A 3VWEA 3P9IA 5DCMB 1B87A 2GIVA 4I7HA 1KU7A 1YVKA 5D5XB 4GXOA 2P0WA 1K7AA 3HSEA 1PUEE 2VE9A 3I53A 3HRTA 1R1TA 4AIHA 4MY0A 1G3YA 3MZYA 3IRRA 2BV6A 2EA2A 4KIBA 4S04A 3FNCA 1SAXA 4L9JA 1TQIA 2YX4A 4E0AA 3BPVA 4IJAA 1ZH5A 1WRJA 2K02A 5CVIA 2GE3A 4FT8A 4LK0F 4OOIA 3BP8A 2JTVA 1Z91A 3ZQ7A 3JSOA 1UFHA 5TJJA 2Z5UA 4MEYF 2EJRA 2HQYA 2H27A 3P7NA 4JD6A 5F49A 1EH6A 4EJTA 2XAFA 3CXSA 1HQCA 4QBJA 4OMYA 3KEQA 2VQYA 4G7OF 1IXSB 3M9AA 3EUHA 4LB6B 1HW5A 2X7BA 1W5TA 3S6HA 2AXLA 3F8FA 2VBZA 4R8HA 3DXJF 4EQQA 3H3ZA 3RJPA 4ZYEA 4NCZA 3B8GA 3G3SA 1HW2A 3IKVA 2MC3A 1LB2A 2IA1A 2B58A 3IGRA 1QNTA 1FPQA 1ZAOA 3T8TA 4QC6A 2I79A 3F72A 5ED4A 3W6SA 4L89A 4EM0B 4KDPA 5L3GA 5H84A 4PZJA 3JVNA 1M44A 1O3TA 2IRFG 1I5ZA 2ZBKA 5FGMA 2VC0A 1HBXG 2XV4S 1ZG3A 4G9YA 2UWMA 3PP9A 4Y49B 3H92A 2XASA 3C18A 3TO9A 3T1BA 1HSJA 1SFUA 1CM0A 4EVYA 3EYYA 2AE6A 4CXFA 2BYVE 3LD2A 2IA2A 3MGDA 3O6BB 4AIKA 4YFXF 2P6TA 1KZFA 4R1HA 1GHEA 2A61A 3WTVC 1VTNC 3TFYA 3F8NA 3GW2A 1VHSA 2F5CA 4KLWA 4AIJA 1W5SA 4U9ZA 2V1XA 5H20A 5LEKA 2Q7BA 3JTGA 4JK1X 3K1MA 2DK8A 4B5PA 3R0AA 3FBUA 3QRFF 4MTEA 4EM2A 3GX4X 4IPAA 3KE2A 1TQMA 2V6CA 2VEZA 4O3MA 4CDGA 5ILUA 5KTCA 1P0HA 2EK5A 4F6AA 1MJ9A 3E6BA 1TNSA 3I4PA 4WCGA 5LLQA 3F0AA 3FF5A 2PJPA 3ZN0A 4HDVA 1KGSA 2QM3A 1IRGA 3NRVA 3HTSB 3LA3A 3GZ5A 1LNWA 2FE7A 4L9NA 1S7KA 3SHFA 5DDGA 3HIFA 1BJAA 2RV8A 3GVAA 1LEBA 4KT5C 4KVXA 3EO4A 4KICA 2JSCA 1R5GA 3SXOA 4LMYA 1ONVA 4KN4X 1HXDA 2ESNA 2ZJ2A 2G3TA 1YLFA 2JDCA 2R1IA 3J80K 4M73A 3CXPA 3BDDA 1H0MA 1E2XA 1MDMA 3M8EA 2VN2A 2WTEA 4K2EA 2GQQA 5ERIA 2XGXA 4NHJA 2BEOA 2CFXA 4XPDB 4JLYA 1N71A 1DDNA 4RGUA 1M4IA 3NEUA 3F5BA 2KCWA 1FY7A 1J0RA 2ARHA 3RYOA 5BS6A 2KJCA 4PGGA 3SFZA 2IT0A 4G7ZF 2NNYA 1YW7A 3JW4A 5E1WA 2FIAA 1LDJA 2O6GE 4ORFA 3VODA 1SFXA 1W7PA 1S6LA 1LQ1A 2DO7A 1IZ1A 2Q0YA 2OZGA 4MY3A 2YU3A 2J8MA 4M74A 2DBBA 2NMTA 4XRFA 1L0CA 1FZPB 1BM9A 2L4MA 4P9FA 1XD7A 4QWQA 1W7PD 4RB0A 1R5HA 5E8IA 2GZWA 4HNWB 3WG9A 4UVCA 1G4DA 2OD5A 1P4XA 2D45A 5LGNA 4HNXB 4CRYB 2BGCA 2Z9OA 1PDNC 3T8RA 2VODA 1FP2A 2CYYA 1YGHA 2H5MA 3N97A 2CGPA 2O03A 4EVIA 5J8FA 5GCNA 2IVMA 3Q5FA 4B8XA 3BLNA 5H6QA 3GFMA 3PZJA 4P96A 5HLIA 3RI4A 2ADUA 1WWZA 2P8TA 2X0LA 2X4HA 3T9YA 3FIXA 3GXOA 3IKTA 4NEXA 3I54A 4KN7X 2PI0A 4LLLA 1S7NA 1XDUA 1DPUA 2GXBA 3V8IA 2HWVA 4KA4A 2H6CA 1G3WA 2Z33A 2VT3A 2L3DA 2LNBA 2V9VA 4ONUA 3F21A 3QAHA 1QZYA 2ZXVA 1BI3A 2V1UA 3D2MA 2JLMA 3RYRA 3S6FA 2STWA 1OPCA 1OR7A 1TBXA 1J2XA 1CJWA 1EH8A 4AWXB 2A5YB 1LRZA 1QZZA 5DEQA 3LAPA 4B5OA 2Z10A 5F47A 4MNUA 4MHGA 2VBYA 1P4NA 1EV7A 3KP4A 5HLGA 2P6EA 2XAJA 5JPHA 1Z1DA 2LKPA 2Q4YA 1ZREA 2FEZA 3TOBA 3RKWA 2HKOA 4FX4A 1JGSA 4RS2A 4L8AA 2WV0A 4GCVA 2FSWA 4WX9A 4NQWA 2HQNA 2RN7A 4CYDA 4G6DA 2HFHA 2B4BA 4L9VA 4ENKA 1T38A 3QOPA 2PC1A 5HOOA 3G73A 2W25A 3BZ6A 1FYKA 1FOKA 4Q47A 3HRMA 3JAMK 2DPDA 3DF8A 1K4JA 2VI7A 4RB1A 3BWGA 4YFNF 4FD7A 3R96A 2A69F 1XGNA 4WXCA 2DT5A 3KETA 1U5TB 1USSA 5ISVA 1YR0A 2DXQA 5JFRA 3PQJA 2VBQA 4R57A 4OADA 2FBHA 3PFIA 2OU2A 3ZMDA 3GO5A 1D3YA 1KUYA 2CNTA 3ZMVA 1KA8A 1KQ0A 2F5FA 4UHTA 5K5OA 1YYVA 2Q4VA 3T0YA 1YS7A 5JHUA 2NS0A 1R1UA 1WK4A 3S6GA 4UWIA 5IB0A 1B6BA 4LUAA 3BROA 1Q2YA 1JHFA 3WTXC 2QENA 2Q2EA 5LEJA 1LDKB 3SZPA 2H09A 1BBYA 4KLVA 1V4RA 3ULQB 3E6DA 5ICEA 5FB2A 4I2OA 3QPHA 2R98A 1KQ9A 3I64A 4A5MA 1IB1E 2J5PA 4B09A 4XBFA 1S3ZA 5ICGA 1FT9A 1JXSA 2QLZA 2CSOA 5K1YA 1S8NA 1PP7U 2VC1A 4Y49C 2MH2A 3VB2A 5I0CA 2OBPA 2VXZA 1SMTA 4ESFA 3C26A 4PGHA 5HS9A 1I27A 2QBYB 1FSEA 1YTYA 4AB7A 3GFJA 3KZZA 1IF1A 1ZGJA 4B5PB 2VONA 1VKCA 1KU3A 3KCCA 3K0LA 5E96A 4R87A 4HX4A 4LLNA 3P9KA 4IRHA 3F3XA 2EFPA 3NE7A 1YVOA 1YIOA 2W24A 1JHHA 3PGPA 2DI3A 4KIFA 4DNCA 2M87A 5HVQC 5LHHA 5EEHA 2VZYA 1O7LA 3HUGA 3DPTA 2UXXA 1YS6A 3S2WA 3Q9VA 4G7HF 3S6KA 4JBAA 2ELHA 2RKHA 2ESHA 1XDSA 4KUBA 1YQAA 4JXQA 2K7LA 4N9IA 5LHGA 1LDDA 4OMZA 1SD6A 3JAMZ 2PLYA 1P4AA 1M1DA 4BAYA 4BHPA 3CDHA 2G3AA 3BJAA 4PCQA 3K9UA 2FS5A 5IT3A 2ZFWA 2O61A 4Q4ZF 2GA2A 4LG0A 4IHTA 1OYIA 2DLLA 3JSPA 5DUIA 4R9MA 1B6AA 1FP1D 3CXQA 3DR8A 4O6JA 2R8VA 2LF8A 4H0EA 4Q5SF 1DP7P 3Q9SA 4A6EA 3F6VA 5J8CA 2CWEA 4MQ9F 3WTYC 4FD4A 1S7AA 5KVRA 2R7HA 2Q04A 3KP2A 3WE2A 4M3SA 4XPDC 1RI7A 4MQVA 1GXPA 4YIFA 2R7FA 2XRNA 1AWCA 5CVJA 1O3SA 3N4MA 3IWZA 2MLGA 4UV8A 1U5TC 4PDKA 3RKYA 2QMLA 3KZYA 2M45A 3ABTA 3KP5A 4JQFA 4U0VA 1YLEA 5LBQA 3J80Z 2VOOA 3L00A 2FMLA 4WK8F 4E2AA 1TQPA 4EJUA 2EFWA 3F8BA 1JE8A 2REEA 4HNYB 4N0BA 3FXTA 3ZJ0A 1M4GA 4LK1F 4LB5A 2HYGD 3MFKA 3DDDA 2GANA 1Z9UA 2IPQX 3ZMZA 4HW0A 4QLCU 3CUQA 4M9ZA 1J9IA 1R7JA 1KU2A 1U6GA 5L3DA 2TDXA 3FX3A 4HBLA 2FQ3A 1D5VA 4FHTA 3P2HA 4GGGA 5E8GA 2M1BA 1NSLA 1YREA 3U2RA 1UFMA 3V7RA 2NNNA 3ZMTA 4HQMA 4ZZLA 1ZLKA 2J5OA 1B1BA 1XMTA 2OAZA 1FBQA
chains in the Genus database with same CATH superfamily
2KDZA 4E7HA 5C4XJ 3FMRA 4KZTA 3ZGKA 2IS2A 4N4OB 2N52A 4H6ZA 3QTLD 2JRTA 2XPVA 2Y9YA 4M71A 2ZEFA 2JPCA 4DOZA 5TRDA 2PFBA 3DPLC 2NS7A 4O5VA 4Y13A 1SGYI 5AG7A 5JM6A 1FAQA 2AO9A 1IRFA 3VATA 2W57A 2F5VA 3H5AA 2KHMA 5HODA 4MHDA 3Q0VA 2JEVA 4W1UA 3VWDA 2CF4A 4X8IA 4W97A 3J7YJ 2E19A 2ISZA 4A37A 4IRIA 2BO9A 3QP5A 1B4AA 3H5NA 2PJRA 1YRNB 1HSTA 1ON0A 2R7WA 1RNLA 3I59A 3S8PA 1Y56A 5CCMA 4HF2A 2XGDA 2WC2A 2XRLA 1HDPA 2NOJB 4A0ZA 2LLKA 4L0YB 3WU1B 5GAHJ 4BNCA 4HRIA 4L9MA 4B4CA 4V19K 2B3VA 2M9HA 2ZW7A 2HC9A 4P4EA 4FUUA 3MN2A 4OAEA 4HLXA 2ZMEC 2OPTA 2NVYJ 3IH3A 3ZXSA 4RA2A 2ELIA 3ASOH 1ON2A 1T2KA 1Y0RA 2V8DA 4HQEA 1VQ7I 1Q1HA 4UWJA 3I3GA 1LE8B 4CICA 2DYRH 3M4OJ 4MCSA 4RN7A 1OYYA 3IWWA 5H2FC 2EBIA 4X3RA 4IVNA 3E7LA 3KLOA 1JI8A 2D5VA 1RKWA 2HS5A 4I02A 4BBSJ 2ZEPA 3H8GA 3TMOA 2BBYA 4OIQF 3FC3A 2NOGA 5KHDA 1K4SA 1XMAA 3NH8A 1X3WB 3H35A 2ZELA 5LYDA 4AVPA 1TC3C 4M6HA 4KOXA 3GUDA 3HYIA 1LR7A 2HV2A 5FO5A 1ZHFA 3BY6A 1KBFA 2C27A 4MFDA 4OAYA 4MJ8A 2EZKA 4AUXA 2JBJA 1BN5A 1SMYF 1QSMA 5IP6A 2HDCA 2ZEEA 3IH4A 2JW6A 1S7FA 1BOBA 4UB6C 4ZDPA 4J00A 1R58A 2Y9ZA 1VQKI 1IY7A 2IW5A 4XNFA 1FLIA 2CNMA 4NSQA 3F22A 4I0AA 5HLHA 3V38A 5HVGA 5C3EJ 4LQGA 1S5KA 1SGDI 1WKMA 2X48A 2IEKA 2XVCA 3CUOA 3COAC 3HOYJ 4JYWA 1YU6C 2OUMA 3BCAA 5GADJ 2NVTJ 1U5TA 2L8EA 3JTKA 4AG7A 2GWRA 2O9LA 1SGEI 2W00A 3PFOA 2P81A 1G59A 4OIOF 2XIGA 1CF7B 4G1PA 2FA5A 2VOPA 3GTJJ 2PMZA 5EZHA 3OYKA 3KYLA 2FF4A 5LGTA 3A4CA 3REOA 1CX8A 2CMPA 3C7JA 3CO6C 2Y69H 2XPUA 3C2GA 3PNVA 2AS5F 2O28A 1B72A 4YGOA 2KPMA 2ZFUA 4ESJA 1VQ6I 1ULMA 3IHUA 4ETSA 2Z1DA 3ABUA 3QOEA 3CJQB 1PCEA 3GTMJ 1G3TA 4AVCA 1LKXA 3KEOA 5HH1A 2EFQA 4XSXF 2VUMJ 4BXXJ 1XRYA 2IMOA 2WPWA 2ZEMA 2H94A 2WB1A 1TWHJ 3TE4A 2ID6A 4PPZA 1RETA 2DA5A 3O8GA 4RGSA 4EEFG 3F9KA 1VQ9I 3BZCA 4XLPF 3F6OA 3D00A 3BZKA 2IGKA 1B72B 4IF5A 1TWGJ 2MBFA 4U5YA 2RVCA 3BR5A 3FK7A 3RIRA 1ERDA 2JYYA 3UY5A 2A3SA 5K7FA 3HOTA 2BXZA 2F5DA 3P2FA 3LODA 5ILSA 1F2OA 2A4NA 4OLLA 4KNYA 3PBBA 1QSNA 1WGCA 4JX4A 1BIBA 4DZJA 4CGOA 4A3LJ 5EEAA 5FKOA 1ETXA 1XSDA 1QSRA 3BT9A 5GPCA 3CTAA 2N17A 3G1OA 5F64A 3PEIA 2E1NA 5DCFA 1PU9A 2PDOA 1USTA 3BJOA 1OYVI 4RLFA 3K70C 3HSRA 3HGYA 1VQ8I 1MZBA 2MLKA 2DPSA 1RUOA 1DU0A 1DGWY 1E3HA 2OH1A 5LHIA 3C3WA 4HF0A 4ON0A 1TLHB 2FL4A 1DGRM 1XB4A 1FTZA 2NVQJ 2OB0A 3BG5A 2ODFA 2DDAA 2DOAA 1ARMA 3ZZIA 3UGIA 5C88A 4KYWA 1PPFI 4MFLA 2L7FP 2LG4A 1J4JA 4M85A 2HYFA 3ZQQA 2PG4A 4CPAA 1U78A 2E5ZA 1MNEA 2OTJI 2BY3A 3OY9A 4DUKA 4XSZF 1YJ9I 2X1CA 1TF8A 4B48A 2QQEA 3RO0A 4DYQA 5ILVA 3MZHA 1ZG7A 2NVUB 4R79A 3PB9X 1F4KA 3NFZA 4WF2A 3JRAA 5IT9K 4A3KJ 3GYAA 2DA2A 3ZQFA 3O8HA 5M5WJ 2R93J 4DIQA 1IY6A 2A6HF 2O0YA 2VBXA 1SGPI 2VRWB 4X5KA 1H9GA 2L54A 3NH5A 2M7AA 1HOMA 5K8MA 1I3QJ 4CO8A 5DM7F 3O2PE 2EB7A 3ABLH 2ICWG 5G22A 2QQ9A 3ELKA 3IUOA 2EWNA 3WGHA 3ZQHA 1M8CA 2PJ3A 2PSWA 2F4MB 2P5VA 3L2UA 2CY2A 2OZUA 1Q7LA 3IP4B 1J7KA 3OL4A 2E60A 2YSRA 3S2DJ 4BQNA 1NMTA 1YJNI 3KR4A 2K85A 2HNHA 3EXNA 5B1BH 1QGPA 2A68F 1RO5A 4PSWA 1FBUA 3V7CA 1XE4A 1TBQR 4ANJA 3ZMSA 1ZTRA 1ZG5A 5D8KB 2ZW4A 4B3XA 1I1GA 4KIGA 1IYKA 5HDKA 1TF9A 3IAS2 4C7HA 1CPXA 1T0FA 1VIXA 3C1DA 1P2FA 2WAFA 3H1CA 5KAFC 1UVGA 1NE9A 3BG3A 2HQ5A 5EG0A 4PXBA 5K5QA 3IC7A 4AVBA 3LSTA 4NB5A 2LB7A 2OJED 2Q44A 3B3WA 5LRRA 5EC4A 3HSFA 3TKYA 1J75A 4TNUA 4FTHA 2G7UA 3R5DA 5FRMA 4BUPA 2ZNZA 2QVOA 4BGDA 2EILH 1EF4A 1KUXA 4HLYA 3VOEA 4L5JA 1K79A 1WWXA 2BUEA 1FMWA 4MCQA 2A5WA 4OINF 3WTSC 4A12A 1Y8RB 2EV5A 4CGMA 2CQKA 1UELB 2KMQA 3F8KA 2ZC2A 2RDPA 3H9GA 1V54H 3VYSB 2B3UA 3FB3A 1XSXA 2R5ZB 5HMNA 3FYNA 4PJJA 3R95A 5LRKA 2GAUA 1IICA 4FETA 3PSIA 5IP9J 1YW9A 3KIOA 2C6PA 2OD1A 3HEFA 5TISC 1ETQA 2EIJH 2KIQA 4DGWB 4KVME 3U9GA 1MKMA 3WTZA 4OVOA 2OA4A 2PBIA 5L3CA 2XAQA 2I10A 1IGNA 4UVAA 5BOXA 2A07F 2DPUA 1P92A 4RI1A 1NSAA 4I0BA 4KOTA 3M7GA 1CE3A 2FXAA 3CC4I 5HS8A 2E2IJ 3FISA 5F1JA 1BA5A 3BI1A 3AAFA 4R3LA 3DV8A 1XX6A 4RGRA 3BQZA 3VSLA 4E7IA 3CJTB 2RB7A 1I1DA 1Z8XA 4ZTJA 1QPIA 1Q9BA 2BSWA 2CO5A 4IAVA 4CAVA 2LYCA 1KONA 4B11A 1A04A 3DCFA 5FD6A 3CESA 1YITI 4IHMA 4LITA 2JVHA 4MGRA 4KVOE 3NWSA 1XF8A 2B0LA 1TBNA 4BBRJ 3HOWJ 3CT9A 1YFHA 3HRSA 1XTAA 2DOEA 4L18B 4OC3A 2Q1ZB 3W6VA 1VHOA 2GA1A 1YW8A 2R4GA 4L5IA 3E5QA 3TQNA 3CJNA 3FXRA 4A39A 4Z65A 1JTXA 2K9QA 4LFUA 2FSRA 4IUSA 4C9YA 1YLOA 1X4SA 2AJ6A 1OJLA 1LVAA 1ZRDA 5IYDJ 3CJRB 1CG2A 3MN8A 1BI2A 2AQFA 3K9TA 1U2WA 2O7OA 1YRNA 7WGAA 4WWCA 1GLNA 3VPRA 2XEGA 4MHNA 1GXQA 3QNVA 1IUFA 4P4JA 2FMYA 4Q38A 1Z21A 2XDVA 2FXFA 4KMFA 2PRBA 1L3LA 1Z4RA 2VZZA 4A3MJ 1CGPA 1P6RA 3HGGA 2DW4A 2D2WA 2E1MB 2KJBA 3R60A 1HKSA 5J4VA 3GF2A 1A31A 2GLJA 3D4UA 1SD7A 2E5RA 4KOYA 4MMOA 3R5CA 3E59A 4KOWA 1JT6A 5F1RA 2ENZA 3OXLA 4DJLA 5F0HA 1LR8A 2D1VA 3HOUJ 4KS9A 1VZ0A 1AUGA 4AYBN 2QQAA 4NGTA 4II3A 1MJBA 1E3OC 3RPUA 3WHCA 3P9CA 3MEXA 4RGXA 4YRHA 2CV1A 4NGNA 2X6WA 5BNGA 1SEUA 3BOQA 1P7JA 3TO6A 2D1HA 2NU0I 3S3NA 4Y15A 1GUUA 3RYPA 1ZQ3P 3K4KA 4LGWA 1XX5A 2ISYA 1REPC 2R7SA 2QWWA 4EGZA 2O8XA 2V9KA 3DLLF 4JZ0A 3V8KA 3GWZA 2CW0F 2KZVA 1NK3P 2K86A 4C7IA 4BEHA 3MMYB 3PRTA 2ECCA 4AIDA 3E0KA 2F7VA 2FIWA 3F23A 2X1EA 4U0WA 4M6XA 2LP0A 5AG6A 3HOVJ 1HEVA 2H6BA 1GDTA 3PQKA 4CAXA 1R23A 4BDZA 2JUCA 3BJ7A 5F6FA 4F3QA 4PK3A 2OTLI 4WWVA 3J81K 4XRSG 5GTIC 4GO1A 4A3EJ 3UEJA 4CZCA 2CH0A 4I01A 5DWNA 1SD4A 4OKOA 1X2MA 3DWLE 3KHZA 3NE8A 3GFLA 4ESBA 2FE3A 4G12A 4UIBA 4RAZA 1W0TA 3VEPA 3OWTA 3EFAA 3IWGA 2X6XA 1CF7A 1Z4EA 1V1IA 3OXGA 1Y9KA 1ULYA 2G0BA 3IL2A 2ZCWA 2UUZA 4S05A 3GOXA 4UXNA 2ZOGA 2RGVA 3K2ZA 3K69A 3K4LA 4Q48A 4KJZA 4A3FJ 2ZXJA 5E3PA 3CCJI 1KYWA 1MBFA 4J01A 4ZI6A 5CVRA 4HA8A 2G7HA 2EZIA 2FD5A 1R43A 2LSOA 3M07A 1ZG1A 5E1ZB 4CS0B 2M5WA 2CQ7A 3RZOJ 2E36A 3MQ0A 1WPKA 2LMDA 1XMBA 3DEWA 3FXJA 3HBLA 3WE3A 4AVAA 2G9WA 2MD5A 1BLLE 1WKXA 4L9TA 2YR2A 1Z6TA 3ECOA 4FX0A 4XRSA 3ISZA 3BPXA 4F0YA 3VSKA 1F57A 3JRUA 4B44A 3NQOA 2FRHA 4A93J 2LD5A 3MEKA 2PJ4A 4CCNA 5EJCA 1RZ4A 4HV6A 3VE5A 1LFUP 2Z3OA 4QB9A 2CUEA 1I12A 2COMA 3LQRA 4XN3A 3AL0B 4MCPA 6PAXA 2KT0A 2IL4A 2GKTI 3KYCB 2CIJA 1ZGAA 1IY5A 2C6GA 1WFXA 1KU9A 2PCUA 1A5JA 4B12A 1POGA 1DUXC 2MGQA 3FMCA 5BMZA 2F4OB 4MI4A 3CQZJ 1S7LA 3SI0A 4UEFA 4CYPA 1S5LC 1FNNA 1Q2CA 1X1CA 1ELLP 1IXRC 4RM2A 5HNHA 4MTDA 2HI3A 1PJRA 4BH9A 3OOUA 3BG9A 1L0OC 4ZYQA 5KAIC 3TL4X 2ZSIB 2KIFA 3B6AA 3CO7C 5JR3A 2KIMA 3DKWA 5FKKA 2STTA 4NJQA 2P7CB 2HGCA 3DLAA 4E7JA 1AOYA 4KOUA 4E7KA 3A01A 2L0KA 1TWAJ 3E97A 1DPRA 1H9TA 5FLMJ 4UFXA 2JZYA 4XPKA 2BEIA 2P6FA 1G8XA 5E17F 4PUSA 2JA1A 3R4KA 1UWYA 4OC4A 4CYNA 1XN7A 2RQPA 3IH2A 1YSJA 1Y0UA 3IAM2 4KT6A 3OS1A 2R5ZA 5JVGF 2P6GA 1J5YA 4AC0A 5DD8A 2DOFA 3T5XA 2DTRA 5DTDA 4NGPA 5E18F 2EIMH 2XGEA 1T98A 3DGVA 4Z6YA 3EQLF 4E8OA 1B9MA 1RR7A 3M1EA 3GKRA 3BG6A 1Z6RA 5IY5H 3LQQA 1RUNA 3NA6A 3DTIA 4V2GA 1QO0D 1Z67A 3F8MA 2SGDI 4YFJA 5FLVA 4ZX9A 4MBUA 4U0YA 2MH9A 3CLOA 5AG4A 3ZN1A 3FXMA 1LEAA 3ISPA 3M8FA 2ZW5A 2OR4A 3WABA 3G1LA 2UZKA 1SGNI 2OZ6A 3LA2A 1Y6IA 2R5YB 2XAGA 3S32A 3S16J 4M3DA 2R7DA 2XUBA 1BMOA 1OKRA 4JP0A 1DQUA 3J7ZI 3R5AA 2FNAA 1QSTA 4YFKF 1P9QC 2FBKA 4UUSB 3R9FA 4B14A 3D1NI 3SYTA 2LVSA 4CAEA 2V26A 5FKLA 2HTSA 3E5UA 5FLXZ 2GKVA 5G21A 2AFOA 2E7WA 2GBYA 3UKGA 4M9SA 3DKYA 2Q2EB 1B8IA 1NXUA 3VYRB 4EJOA 3E2IA 2D4PA 3JUWA 2JT1A 5KK1A 2KIUA 1TBRR 4YIIA 4CAFA 2XKOA 2CWFA 3L7WA 4II9A 1N77A 2RAEA 2XPWA 2LC2A 2IA0A 3KP6A 5L3EA 3LA7A 3CUQC 1IOFA 1JWQA 3IWEA 2KMOA 4RS8A 3L2NA 4HDUA 3GZNB 3V8JA 4BHCA 3QAYA 4XKWA 5E1XA 5AONA 4FD5A 3OSGA 4D5FA 2BY2A 4IQ4A 1I21A 3DU6A 2R7VA 2YNCA 2M8GX 4I98B 4CAWA 2WY7Q 4ZYAA 4HYEA 2NSMA 1IO2A 3BQYA 3OMYA 3DNSA 3TOAA 1PP8F 5JQ4A 1YW4A 3SDBA 1OYWA 3R61A 4H4KC 2XROA 1X1BA 3C2BA 3DBHB 5A2QK 1T39A 1SFKA 4RAYA 4G6QA 1QA6A 1WI9A 3TGNA 5A2QZ 2I8DA 4P55A 1OQYA 1YOVB 5J6XA 2IXSA 4RM3A 4XLFA 1ULKA 4AG9A 4AM3A 3U1DA 5CVUA 1UHMA 5KTAA 1U8RA 4P9UA 1ETWA 1IN7A 2M0CA 2PEXA 1V5EA 4LJZF 5DYMA 4BQAA 3HH2C 2QBYA 2QECA 4F8ZA 1K6YA 5DUKA 2V8GA 2M8EA 3QPSA 3BLYA 2WYRA 1YI2I 5EYRA 2QKMB 3WGGA 1UHAA 4KSAA 1I1SA 4DYOA 3FEDA 4IEJA 4GS4A 1FYLA 2VJIA 3HHHA 1WGTA 2N1AB 5BPDA 3G6EI 1R9TJ 2BY1A 2ZW6A 3OYFA 2KRFA 3V8LA 1E17A 3BXMA 3WR7A 3D68A 3FM3A 5CCLA 3RTRA 4MCRA 4EM1A 2KLOA 3G1MA 2HUZA 3SJEA 4A5NA 2X3TA 1W4MA 1UZCA 1KWMA 1HDQA 3GY9A 5K7HA 2DAOA 4FD6A 2FT0A 3RQIA 3V4GA 3HTUA 2FQ4A 3FJUA 2EFOA 2ZEDA 2CV0A 1MJAA 4M3EA 4BYYA 1QHHD 5IX3A 1WQ2A 2L02A 1I39A 5A27A 1FT7A 4BE1A 1B59A 4MLOA 4IX7A 4GYIA 1OMUA 2QSFX 2J9RA 2B9SA 2BZTA 4CYCA 1ZG9A 2NU4I 4CUGA 3MVPA 2H8WA 1KYZA 5FUXA 3KP7A 3SEKC 2D4OA 2OCEA 4U88A 1D0ZA 1WI3A 2R0QC 1K7TA 1ZN2A 3VYUB 3UOEA 5J1QA 1SANA 2UVOA 2GLFA 1BC8C 3FK6A 3OXFA 3LWUA 1XS9A 1K4TA 2ZPAA 3EPZA 4EGYA 3IWFA 1I6HJ 2K9LA 4YRVA 4YG2F 1OR7C 3Q0UA 1UCRA 1BOAA 3DEUA 2IJLA 3V7ZA 3G8WA 3FMSA 4ENJA 4XMYA 3I71A 4LLGF 2GOMA 1UUCA 3JRDA 3MRUA 2WSAA 3I58A 4FISA 2DFIA 4OIWA 1YE9A 3S15J 4D1QA 3PNYA 2F5IA 3TTHA 2KZGA 4RB2C 2NYQA 1IIDA 1VF9A 4P4FA 2M7BA 3HHGA 4IXAA 4BXFA 2IGNA 4DQ2A 2EH3A 3HM5A 2F6CA 3FXOA 1SFOJ 1C0WA 4C30A 1ZRFA 3DPUA 1RXTA 2HR3A 1XGMA 3R0JA 2ACJA 3KY9A 2CG4A 4N4NB 3UGDA 2VE8A 4UCMA 3FIWA 1UAAA 1U6MA 4CGNA 4NNJA 3LSPA 3EC4A 1NG6A 2SGQI 5LYIA 5D8LB 3D2PA 2MW8A 1XG1A 5CLSA 3GMEA 1Y1CA 1TT5B 2GXGA 4P6YA 2X9DA 4NBQA 1IW7F 1MMAA 3B73A 3LAJA 2O4HA 1MW7A 4ZYDA 2EFNA 4FASD 2BHZA 3A9LA 4RLQA 1SQHA 1P9GA 1IOIA 2E34A 4B3AA 1O3QA 2I3CA 2DMUA 1OMTA 3GZ6A 1H0ZA 4OC1A 3KQZA 1R00A 5LGUA 1TW2A 4HSTA 1AMPA 4ZH4F 3W6JB 2P7VB 3I9V2 1WVRA 3I59B 2EVNA 5FFZA 3L2VA 1Z7UA 1BIAA 2EV0A 2VI6A 1RPWA 2QQCA 3PUBA 4FCYA 2E1MC 4DBQA 3K10A 3CMAI 2L9VA 2NU1I 2G9DA 2OZHA 2PR1A 4JJXA 2JWTA 5J40A 1OLTA 1Q2DA 4E1PA 3SZTA 3S9MA 1YTPA 1WH5A 2QQ0A 3GLJA 1O7FA 4UUVA 3FHZA 2PR8A 4BU2A 4BMHA 2DA6A 5JVTA 1XCVA 1YX0A 4H6UA 2B5GB 2NAZA 3JTHA 1Q1VA 3VYTB 5CVVA 5E20A 4B10A 1Y7RA 1K78A 1TKFA 5G1ZA 4N9HA 4UFWA 1N75A 2ZNYA 1WJBA 1MD0A 3K4MA 2FX0A 1SGRI 2K5TA 3WODF 1UHSA 1ZRCA 2ZMEB 3GYHX 1QQIA 2DN0A 2ABZA 2WVJA 1ODDA 4G94A 2Y48A 2WWYA 1JUPA 3K2KA 1XA6A 3RZAA 3VFZA 3KI9A 1U9OA 1Y1BA 4CGZA 4XPLA 1NHAA 4A3JJ 2XEIA 1W7PB 5D6FA 2ZO4A 1LR9A 1EH7A 3R9GA 2DA1A 2PJ5A 3KKWA 3RPQA 3HXLA 2ATRA 1F2PA 2YU9J 2XF7A 2ZJRF 2XEJA 4NGQA 3A0HC 4E7SA 1YO5C 3GTPJ 2QPOA 3MZ8A 5AIPA 3ZMUA 4EMSA 2V1CA 4CYOA 2PN6A 1XMKA 4UBRA 1IN4A 2DTZA 4RAFA 1F5TA 2KKOA 1W36C 2DQLA 2JXDA 4EWTA 5FD5A 4Z2YA 1K6OA 2A05A 2M30A 3FZVA 4M9XA 4A6DA 3S3OA 4Y33A 2DJIA 1WTJA 3CCMI 2CTCA 3CUQB 4EJWA 3DR6A 4JX5A 2KMRA 3EY5A 2M4GA 4P4IA 4R76A 4B47A 1AU7A 2DA3A 3LACA 3MAJA 4A69C 4G8XA 2IS4A 2UXNA 4RMNA 1BL0A 5B66C 2FUG2 2V1NA 5IV0A 3JRIA 1JKOC 1LE8A 3S2HJ 2EUIA 4B6ZA 3R1KA 3D0SA 3TW6A 1R79A 2R7XA 4MIMA 1XEBA 2JEWA 3PUFA 3FX6A 1TNTA 5K7ZA 3V7SA 5CNPA 2QIRA 3LFKA 5HLTA 1QBJA 1GHCA 2P5LC 1AKHA 5IOYA 4KISA 3GUXA 5JHFA 2I00A 3D7FA 4OIDA 3FXQA 3PSFA 5ICCA 4BINA 3QWPA 2LFBA 4PJNA 2WAQN 1IJWC 5L3FA 3L09A 1D1AA 3TDZC 2BXYA 4L0ZB 4MRIA 3SJMA 2Q0OA 5HDGA 3JRCA 2RNJA 4ENNA 3FH4A 1HDDC 4QUSA 3R9EA 1LFPA 1DU6A 1FYBA 2HPIA 2IQ6A 1V3FA 5D4SA 2CNSA 2M0MA 3HRUA 1IGBA 3S1RJ 4QPQA 3TC8A 3ESWB 4WXHA 1XC5A 1LUJB 4ONWA 1ARLA 1G6NA 1FSHA 3E5XA 3WU0A 1XFOA 1R36A 2FOKA 2R3SA 4M6IA 1HKQA 4J19A 1AYEA 1ELMP 1OCTC 3MCZA 1ORKA 3HJEA 4HAMA 2QQBA 1OISA 2BE5F 3BTIA 4LIVA 3TBIA 4HNTA 1S60A 4CYCB 4Y4RA 3D5LA 1S29A 1STZA 5KCMA 1W3SA 5D6EA 5EEGA 2E2HJ 2Q51A 5HNFA 1I6XA 1JQGA 5CBMA 1TW3A 3GFIA 1HC8A 2Y0MA 1SFEA 3P5JA 4XLNF 1XCBA 4ASNA 2ID3A 2VBWA 1Z9CA 3W2VA 2K27A 3RPUD 3PFEA 2O53A 4DBRA 3CZXA 2LUYA 3DP7A 5I4MA 4XR6A 3TEDA 4IHSA 2I5UA 2OV7A 3ZQIA 5E3QA 4UXHA 5B5EC 3W91A 4RB3C 1N13A 3ZPLA 1DE4C 2V77A 4FE7A 4HV5A 3HPGA 2G0EA 4M6YA 1JJ8C 2HEOA 1TKJA 5DM6F 2C6YA 2K9SA 3OOPA 2VJ4A 4JYKA 3ZOBA 4EJVA 1QSOA 3FECA 3DQVC 4EMEA 3W6KB 4BY1J 4FQGA 3EDPA 2J8NA 2E7XA 3GLLA 4BHBA 4OU0A 2DJNA 3IV5A 4CCKA 4IQJA 1RIOH 1KMAA 4L5EA 2EINH 5TGTA 4I6ZA 5EDNA 3HOSA 2VXKA 5EF6A 2HB6A 3RCOA 2XB0X 1IN8A 1D1CA 1MT1A 3J7AO 1VQMI 1U5KA 1S7OA 1P7IA 1G3SA 4XICA 1D5YA 2RREA 3O3KA 5J47A 3CXLA 1ZARA 4XNHC 2K9MA 1TUSA 2HZTA 3N5FA 4U7DA 1P4WA 4HKFA 4F9VA 1BI1A 2DYSH 2F5EA 3SXYA 2L9RA 2HDDA 3ZP5A 2W85A 3CP8A 3LSIA 3WTUC 2Y2ZA 2Z0ZA 5DCMA 1PUFB 4M6GA 3SXNA 2OQRA 4LD5A 3DU5A 2IS1A 2MA3A 1Z2IA 1IYLA 5FRNA 2B5GA 2EZHA 3QPLA 4A33A 2B4DB 1CT2I 2P4WA 1LCPA 2CS3A 3GCMA 1YX3A 4GFBA 2AFXA 1KBEA 2Z16A 1XGOA 3H5RA 5CJ9A 4XK4A 3FXLA 1WJAA 2CQXA 2K4BA 2KQRA 2W82A 3QPTA 3E6MA 4XKBA 5DV5A 2Q4ZA 5FKNA 2IP2A 2E5NA 3KFWX 4CRZB 5G20A 2PMHA 1YK3A 3SJGA 3RKXA 1Y7EA 4PK4A 2DFFA 4UNOA 1QRYA 4M3FA 4O23A 5DD4A 2L7ZA 3LWFA 5GAGJ 3CZ6A 5JI6A 3BHXA 1UJ8A 5HVHA 1WCMJ 3FWEA 2R7RA 2DU9A 3OYJA 3AFHA 1B8IB 2P6AC 1Y0YA 4CSWA 1TIQA 4AMLA 3QU6A 2XHKA 1IAWA 1IW4A 2Z11A 4KORA 1S3JA 2AFUA 4QVTA 2WAEA 2XSJC 1BJZA 2ZXWH 1R49A 3OL0A 4QTRA 1ETVA 1XSVA 3SQNA 1W5CC 3TW7A 2AFSA 1SD5A 2CQNA 2V79A 3WTWC 4Y3OA 4A3CJ 3B02A 1T6SA 4UA3A 4NXYA 3ML6A 1UMQA 1D8JA 2OF7A 3RDIA 4TWEA 2XKPA 2O8KA 1O3RA 4I09A 4BXUA 2WCYA 2YX7A 4F7ZA 1Y1WJ 3T90A 1QPMA 1Z05A 1K78B 3UFFA 2EBJA 1TTYA 3GTLJ 3A2KA 2KMUA 4ITVA 3GEZA 3QYFA 2QQ8A 4AYBA 2FCKA 1VHEA 2WPXA 3D8PA 4C2XA 2COBA 3ZR8X 2EZLA 4MPIA 5FVJA 3BR6A 1R57A 4I49A 1Y0NA 1NK2P 3ZQGA 1FTTA 2B8TA 3F8CA 3FMQA 1GVDA 4IHXA 2Q43A 3FRMA 3BR0A 5D5WB 1X1AA 4BE0A 2P5KA 2QZ8A 4C68A 1U3EM 2NYXA 2PJ9A 2CWHA 5IB9A 2OC6A 4LG0B 2L7KA 5JLWA 1TP4A 5LRJA 2NU3I 2DT7B 1V5FA 4K30A 2VPRA 2VQLA 1RC9A 5D5VB 2ROWA 2HTJA 3HC7A 2CW8A 4JX6A 3UEYA 1BC7C 2XC7A 3JRBA 3MWMA 3W6XA 2FNPA 1MH3A 3R6SA 1CSOI 3R5BA 4HOBA 4JWPA 2HQAA 1X3UA 3CF2A 4M72A 5GPAA 3OYEA 2BVLA 4OWRB 2VIXA 5HI7A 3UGLA 3D66A 1FWZA 5H6RA 3EYIA 1ZG8A 2XAHA 4KUAA 2F2EA 1IUYA 1NUBA 3OWCA 5DWMA 2V1DA 3GTOJ 3SHPA 3RKQA 1ZR4A 1OZPA 3OYIA 3B35A 1UHWA 3BJ6A 3U1KA 1J59A 1ZLHA 4OIRF 5HDNA 1TURA 4S0HB 2VQHA 1VQNI 2JDDA 2LBFB 3EUKL 4U7BA 2X6YA 3K70D 4YU9A 3HL2A 4KOSA 3I9SA 1D8KA 2CJSC 1MDMB 2K4JA 3FXUA 4XLEA 2ZJQF 4R3KA 4D0PA 1IN5A 2BL1A 1M4DA 2L01A 3QB8A 3TCVA 1FC3A 2N8GA 3NAUA 2R92J 2J9AA 3TJQA 3GTQJ 2EWBA 1SVLA 4H89A 3TO7A 2DCEA 1BO4A 3ROUA 1LJ9A 2HOEA 3WHBA 5IYCJ 5FUYA 1PYTB 1KZHA 3LOCA 2K3PA 2JPBA 3I0TA 3FVLA 1XMXA 4E70A 1TWCJ 1XGSA 3H0DA 5H86A 4JXRA 3E1SA 2KFDA 3QQAA 2HXOA 1YG2A 1R1VA 2HOSA 4AD9A 1ZYRF 3L2RA 2VPLA 3H8EA 4LIUA 1FOWA 4EV0A 3PB8X 5EGOB 1IDYA 3HOZJ 3BTCA 3N7ZA 4ENMA 2PX9A 4MEXF 5FUVA 2WY8Q 5D5UB 2ZB9A 4UFVA 2QF7A 3D5SC 5F0FA 3LMSA 3FM5A 1TXRA 1SVMA 4U9YA 5HS7A 4LX9A 2DK5A 1T95A 1ON1A 1PVEA 5FKMA 4TV7A 3K1NA 1S72I 3B3VA 3TT2A 1X3ZB 3CCLI 1BI0A 1BW5A 2Z3MA 2BHYA 4ZY1A 1YX5A 3MKLA 2Z99A 3FXKA 3EETA 2O5RA 4F9UA 4BJTA 1APLC 2JQ7A 1FX7A 2Z3YA 2V6EA 3E6CC 3E3VA 2L4AA 3GBGA 3TP3A 1U0JA 5BPIA 2HOTA 2GVIA 1XPXA 4P1WA 4BQQA 1LANA 2RC4A 3CC2I 4HEA2 1MIJA 3IRQA 5J1UA 2ZXIA 1HA8A 2X85A 2JUGA 3KYDB 3GTKJ 1MGTA 1Y9WA 2QVPA 2FU4A 2HDWA 4BD9A 1R71A 3ERED 3S1MJ 2Y75A 4ZYGA 3J81Z 3DFGA 4UV9A 4XN0A 3H3UA 3GLXA 2KMPA 1R22A 4XQFA 1KQ8A 1Z3YA 4A0XA 2XF6A 1FBSA 2OQGA 2P6SA 2YNCC 1V0CA 3ECHA 5FROA 2PQ8A 4CHUA 1ZLJA 1MMNA 5C82A 4KFCA 1UG2A 4UF4A 5AIQA 1XIXA 3G3ZA 4C2YA 1MSFC 4IRGA 2BW3A 2X51A 4NUBA 1FIPA 1UB9A 2QYVA 3PBEA 2XGCA 4ZGYB 1JUSA 3L9FA 3DTEA 2HPMA 2B4DA 4XNHB 5F46A 4B6DA 4UVBA 4NF1A 1IRZA 2VT2A 1WJ5A 5LRGA 5D4RA 3K1PA 4FBEA 1H8LA 4FE4A 4A3BJ 1IRXA 4A0YA 1WSUA 1IXCA 2EIKH 4CH7A 2EV6A 3WTTC 2RFHA 2ZKZA 1CGII 3SJFA 4A2UA 1UVFA 2W1OA 2E35A 5BQTA 3AG1H 4Y17A 3OR1C 1IDZA 2HKXA 2CUJA 2H1LA 2E1CA 1XBUA 5FFXA 4ZC3A 2NRAC 5EBVA 2ETHA 3VDXA 4XLAA 3L2CA 1PUAA 4NCZA 4MFQA 2HQRA 4HZFA 2X6OA 3PB4X 2J8RA 3NH4A 2XB5A 3H0GJ 2A6EF 4UUTA 1YIJI 5FLXK 3S1QJ 2AFMA 1MBGA 3LSKA 3H9QA 5JLXA 2M2EA 4KUMA 5LRSA 3D3SA 2PMUA 2ZMEA 3ABMH 3VARA 3VDUA 2LDUA 1HEEA 4PV6A 3KLNA 3PL8A 2HVQA 1F1ZA 4P5OA 1ZK8A 3ABKH 4A32A 4R8FA 1QVTA 2ME0A 1DS3I 5E3LA 1KUVA 4LG3A 1FYMA 1HKTA 1E3PA 4HF1A 1HPTA 3QP6A 4OC2A 1F9NA 4BBHA 2V9PA 2KCXA 4WXDA 5M3FJ 2YPRA 1R0RI 2W84A 3DBRB 4XLHA 4ZZDA 4IO9F 4PFPA 3B4VC 3WC7A 2AQEA 4DJAA 4ZYHA 4X2TA 1B9NA 1TKHA 3DBLB 4PSXA 2CJJA 4NC6A 3OYMA 4F55A 4HX8A 1CGJI 5ICFA 3H4QA 4D7NA 1CT0I 3CPXA 3IC1A 2Q8KA 5L3BA 1OCRH 2MD0A 4KOVA 4IZZA 1W4RA 5BWAB 5KTDA 2QYOA 3QYBA 1A35A 3KP3A 1HW1A 2Z2SB 3WGIA 3FDYA 2QUFA 1CP7A 4BJ6C 4HX7A 1NH3A 3H3VK 3DSBA 1AKHB 3BR1A 2FBIA 2O3FA 1OCCH 2EA4A 3BTLA 3A01B 2LF7A 3I5UA 4BS9A 4CZZA 3OS2A 2YGWA 4OC5A 1IN6A 4OIPF 4D7MA 4UEEA 1F43A 4IF4A 1W0UA 4AVZA 1GVJA 3OV8A 2REFA 4GYGA 1O57A 3S93A 3BJ8A 2IJZA 2OOTA 5K5RA 3TDUC 5EX3A 5IT9Z 3PM1A 3OSFA 4ZBGA 2A6TA 5GTHC 1FOXA 4UB8C 5F48A 3FHNA 1VQ5I 1MK4A 1OMIA 1K61A 3LL7A 2VL8A 4RBOA 3QU3A 4KMUX 5CYVA 4A31A 2DQRA 2W0TA 4BY7J 4PK2A 3VWEA 3P9IA 5DCMB 1PUFA 1YQEA 1JT0A 1MMGA 1VNDA 1B87A 2GIVA 4I7HA 1KU7A 2Y30A 3FBNB 1YVKA 2MC4A 1TWFJ 2Q7SA 5D5XB 4GXOA 3S3MA 3EUAA 2P0WA 1K7AA 2V1CC 1XJOA 4P45A 4IL6C 2JVGA 3N05A 3HSEA 4XOTA 4P44A 1PUEE 2VXDA 1VQPI 2RIJA 3KZIC 4XORA 3HUGB 3ZRGA 3I53A 2VE9A 3HRTA 3HKZA 4MFZA 1MBJA 1X4OA 1R1TA 4AIHA 4MY0A 1A6IA 1G3YA 2NU2I 3MZYA 2JA2A 4B1RA 2VL1A 4GDFA 4CYQA 3IRRA 2BV6A 2EA2A 4KIBA 4S04A 2OCCH 3FNCA 2VQGA 4GM5A 1SAXA 1EE3P 4L9JA 4HPSA 1TQIA 2YX4A 4E0AA 3BPVA 2ODDA 1FOYA 4IJAA 8CPAA 1ZH5A 1WRJA 3BJIA 2K02A 3F0CA 5CVIA 2L9NA 2GE3A 4FT8A 3B6CA 4LK0F 4OOIA 4YEJA 3BP8A 2EPFA 2JTVA 5EMIA 1MSEC 1Z91A 3ZQ7A 1ETYA 5K8OA 5CQGA 2HOAA 3HKZN 3JSOA 5TJJA 2DIPA 1UFHA 4Q7AA 1X74A 2Z5UA 3OYAA 1R6RA 4NQWB 4MEYF 2K9NA 2PJ6A 3FF3A 4HNUA 1OFCX 1Z77A 4F91B 2EJRA 2HQYA 2KDOA 2H27A 3PDNA 3FSXA 3P7NA 4JD6A 5F49A 1FMVA 1EH6A 2E1OA 2LBFA 2JJ7A 2KP6A 4EJTA 4CCMA 2XAFA 3JRFA 3CXSA 1HQCA 4NC7A 5HVFA 2JSPA 3K6GA 4QBJA 4NDLA 3CD6I 4OMYA 3KEQA 3OYNA 3MKZA 9ANTA 4SGBI 2VQYA 4G7OF 3CCEI 1IXSB 3M9AA 3EUHA 1JGGA 4U87A 4ZY0A 2B63J 2HYJA 1RR8C 4LB6B 1HW5A 2X7BA 1W5TA 2CW7A 2VJJA 5AGEA 3S6HA 2V4JC 5C44J 1H88C 5JHWC 2R7ZJ 2AXLA 3OYGA 4BDYA 1OCPA 2ZENA 3F8FA 2FOWA 2VBZA 4II2A 3DXJF 3A02A 4R8HA 1JKQC 3I4MJ 5FUWA 3H3ZA 3RJPA 4EQQA 2LTPA 1I50J 2QGUA 4ZYEA 5M5XJ 3OYBA 2QSGX 2F8HA 3B8GA 4E7LA 3G3SA 1HW2A 3IKVA 2MC3A 1LB2A 1TOTA 5E79C 2GKRI 2LH9A 4FAIA 2DPTA 1HDLA 4BL0B 5C4JJ 2OVOA 2F48A 2QA4I 2IA1A 1W36D 2B58A 3IGRA 6CPAA 5CPRB 2SGEI 2JA8J 3I55I 4OMEA 1RRJA 1WJEA 1QNTA 1N25A 5EGOA 1TGSI 1FPQA 1ZAOA 3T8TA 3ZCOA 4C2TA 2ZXHA 3S6FA 1TL8A 4QC6A 2I79A 3AG3H 3F72A 5ED4A 4AXVA 3W6SA 1J09A 1A2ZA 3CMEI 4EM0B 5L3GA 4KDPA 3BC8A 4L89A 5H84A 4IHYA 1FJLA 3KASA 4PZJA 4A2ZA 3JVNA 1M44A 4PJLA 4XLCA 3CPAA 2FNFX 1O3TA 3CC7I 2GREA 4XRMA 3CP2A 2IRFG 1QQ9A 1XOVA 1I5ZA 2ZBKA 1TT0A 5FGMA 2VC0A 4ABZA 1HBXG 1YW6A 2AFWA 5A28A 4A3DJ 2QEXI 2XV4S 1ZG3A 2VQCA 4G9YA 4RDUA 1A36A 2ERWA 2VB6A 2L2OA 2UWMA 1Z2LA 1Z8LA 2W48A 2XSDC 3PP9A 4Y49B 1Y8QB 3H92A 2XASA 1D0XA 3C18A 2F4IA 3OIOA 3TO9A 3T1BA 1HSJA 3OYDA 1SFUA 1CM0A 4EVYA 3EYYA 1VQ4I 2AE6A 1M8BA 3WC5A 4CXFA 2BYVE 2TCTA 3LD2A 2V8VA 4MFKA 2QJ8A 2IA2A 4NGRA 3MGDA 3O6BB 4AIKA 4R7MA 2ZEHA 1Z7LA 2KRHA 4IHVA 4YFXF 2P6TA 4CGPA 2IBDA 2GM4A 2M3AA 2QCOA 4XKVA 3JRGA 4R1HA 1GHEA 1KZFA 2A61A 3WTVC 1VTNC 4J3GA 3TFYA 1H8AC 3F8NA 2JN6A 1X1PA 3RU0A 2FVGA 1QZEA 3PB7X 3GW2A 1VHSA 2V8HA 4F52A 2F5CA 4KLWA 4F93B 4DW6A 3S9LA 4AIJA 2DMTA 1W5SA 3WU2C 4U9ZA 2V1XA 5H20A 2YQPA 2IGOA 3W2AA 5LEKA 5E3RA 2DF5A 1E0EA 2PIZA 4Q36A 3CCUI 1LFWA 4KITB 3JTGA 3GB0A 2Q7BA 2WA0A 4JK1X 4Y52J 1FARA 3K1MA 2DK8A 4B5PA 3R0AA 2FJ1A 3FBUA 3QRFF 1ULNA 1EA3A 3JR9A 4MTEA 4EM2A 2PJ1A 4ZX8A 3GX4X 2VASA 1R4MB 4M6VA 4MHPA 4IPAA 3KE2A 1TQMA 2V6CA 3OIQA 3OYCA 2VEZA 4O3MA 3K4CA 3HZJA 4CDGA 5ILUA 1JJ6C 3U21A 5KTCA 1P0HA 2EK5A 1V1HA 2K5CA 2LK2A 1MJ9A 3E6BA 4F6AA 2BW3B 1TNSA 1AA7A 1A6QA 3I4PA 3JREA 1JKRC 4WCGA 4BE2A 1Z8TA 4CGLA 3AL0C 5LLQA 3LNQA 3F0AA 3K4JA 5LYLA 3FF5A 1K83J 2PJPA 2VKHA 4KSFA 3ZN0A 4HDVA 3S14J 1KGSA 2QM3A 2KISA 4F92B 2AHQA 2DMQA 4A3IJ 3NRVA 2R7UA 1IRGA 9WGAA 1G2HA 4UIAA 3K2AA 1T33A 4CCJA 3HTSB 4IKFA 3LA3A 3GZ5A 3SEQA 1ENHA 1LNWA 2FE7A 4L9NA 4G6TB 1S7KA 5KNLA 4RAGA 5FJ8J 1Z8WA 3SHFA 2GIZA 3BR2A 5DDGA 5EZGA 3HIFA 3OIPA 5K8PA 2LRDA 1BJAA 2IGMA 3SEZA 4C3HJ 2RV8A 3GVAA 1OVOA 1PYVA 2KRCA 1LEBA 4KT5C 4KVXA 3EO4A 2GXAA 4GRIA 4KICA 2JSCA 1WJCA 2BOLA 4UXIA 1BW6A 4BEHB 1I3AA 1R5GA 3SXOA 2C6CA 4LMYA 1ONVA 4KN4X 1HXDA 2ESNA 2ZJ2A 3T8WA 3CCSI 2G3TA 3BI0A 1T8IA 3SI2A 4HPQA 1YLFA 2JDCA 1WGXA 5DS0A 2JRMA 3MD2A 1Z3XA 2R1IA 1TZLA 3J80K 2PE3A 4MFPA 4M73A 3CXPA 3QYEA 3BDDA 1WJFA 4DZPA 3V42A 1H0MA 4NGMA 1E2XA 3PIOF 3M8EA 1SC7A 3UNGC 1MDMA 3S1NJ 2VN2A 2WTEA 4K2EA 3KQXA 3IIBA 2DFEA 3CDIA 2GQQA 3ERMA 1V5GA 5ERIA 3KGQA 3X2QH 4CCOA 2XGXA 3A03A 4NHJA 1Z7KB 2BEOA 2ZSHB 2CFXA 2BUSA 1HLVA 4XPDB 3VH9A 1PTRA 4UCPA 4JLYA 1N71A 1DDNA 4WJBA 2L9SA 3WT4A 4RGUA 2WAQA 1M4IA 3NEUA 2CWGA 2PJBA 3F5BA 4P4DA 2EQRA 2KCWA 1J0RA 1FY7A 2LR8A 2ARHA 3RYOA 1MBKA 2KJCA 5BS6A 1WZ2A 3S17J 4PGGA 1R5ID 4HGUA 3SFZA 2IT0A 4G7ZF 1CPSA 2NNYA 3IU2A 1YW7A 4JCVE 3JW4A 5E1WA 1YJWI 1LDJA 2O6GE 3H36A 5EG0B 2FIAA 4ORFA 3VODA 1SFXA 1W7PA 1RFHA 1S6LA 1GT0C 2ENNA 2POKA 1LQ1A 2DO7A 1IZ1A 2K40A 4BACA 2JA5J 3HLPA 2Q0YA 2OZGA 4KSIA 3CCYA 2YU3A 2J8MA 1D0YA 4M74A 3PNTA 4MY3A 4IK2A 2Y0SN 5HXDA 2DBBA 3FKJA 2NMTA 4XRFA 1CQTA 4DYRA 1L0CA 1FZPB 1MNDA 1BM9A 2PJ2A 5GAEJ 2R7OA 2L4MA 4P9FA 4C2MJ 1JTYA 1ETOA 1T56A 1XD7A 1W1WE 3OYHA 4QWQA 4MHZA 1VI0A 1W7PD 4RB0A 2ECBA 3HUVA 1R5HA 5E8IA 2GZWA 2ELJA 4HNWB 1M4LA 3WG9A 5JGFA 4UVCA 4ZDLA 3CLQA 4HNVA 1ITYA 3NWTA 1G4DA 1VQLI 3AG2H 2J87A 4EATA 1ZR2A 3I4NJ 3DKXA 2YNEA 4JOMA 3MKWB 2LEOA 2OD5A 1P4XA 2D45A 5LGNA 2WGCA 1DTDA 2BGCA 2Z9OA 4HNXB 4CRYB 4EFDA 1PDNC 2C1CA 3T8RA 1UG0A 1M1EB 3Q0WA 2VODA 1FP2A 2CYYA 1YGHA 2LKXA 2HZDA 1FIAA 2H5MA 4K3NA 3N97A 1X19A 1IV8A 3B3SA 2CGPA 2O03A 4EVIA 5J8FA 5GCNA 2IVMA 3FBIB 1FNOA 3Q5FA 4B8XA 3RAMA 2E73A 3BLNA 5H6QA 3MKYB 3GFMA 2KL4A 4PFOA 2BVMA 2PJCA 3PZJA 4P96A 1T08B 5HLIA 3KL9A 3D7HA 4CCLA 3FEEA 3RI4A 3A0BC 2ADUA 1WWZA 2P8TA 2X0LA 2X4HA 1IG7A 3T9YA 3FIXA 3GXOA 3IKTA 4NEXA 4OC0A 3I54A 4KN7X 1Z0XA 4LLLA 2PI0A 3SGQI 1S7NA 2ANPA 2H8RA 3H5ZA 1XDUA 1DPUA 2GXBA 3V8IA 4DYCA 3W3CA 1QU3A 2HWVA 4KA4A 3QWLA 1LAMA 3KZWA 2H6CA 2GOXB 1G3WA 1MBEA 2NS8A 4D9JA 3SDGA 2Z33A 3FSYA 2VT3A 2L3DA 2LNBA 3CCQI 5E3MA 3PIPF 2V9VA 1JUMA 4GI3C 2PRQA 4ONUA 5HQ8A 3OS0A 1K7VA 3F21A 1S20A 1AN1I 3IFEA 2A20A 2W4SA 4MHYA 3QAHA 1QZYA 2ZXVA 1BI3A 3SFIA 2XRCA 2V1UA 2GU2A 3D2MA 2JLMA 2CFOA 2MABA 2M5XA 2LKSA 3RYRA 2VKVA 2LOOA 2VJ5A 3OL3A 4QSHA 3WG7H 1OPCA 1OR7A 2STWA 1TBXA 1HDUA 1J2XA 5F04A 2GFQA 5THWA 1CJWA 1VQOI 1EH8A 1SVOA 4AWXB 3CMYA 3OR2C 2A5YB 4FKDA 1QZZA 3BR3A 5DEQA 3LAPA 5IOZA 5IYBJ 1LRZA 4B5OA 4A95A 4LQ6A 4NJRA 3LSMA 2AXTC 3E0JB 2N71A 2LY2A 3J7AY 3AKZA 1X10A 2Z10A 5F47A 1VDDA 4MNUA 3RSNA 2JA6J 4MHGA 2VBYA 1P4NA 1EV7A 2CU7A 1MMDA 3KP4A 5HLGA 2P6EA 2XAJA 2SGFI 3C2HA 5JPHA 3L2WA 1OCOH 4H2KA 2UV1A 1Y39A 2K9HA 3K7AJ 1ZO0A 1Z1DA 1X2NA 1D1BA 4E4HA 2LKPA 4ZJZA 1HJAI 2Q4YA 4A30A 4D5CA 1ZREA 4MFEA 2FEZA 3TOBA 3HOXJ 1HCRA 2PJ8A 3RKWA 2HKOA 4FX4A 1LPQA 2ZEOA 2CRGA 5D8NA 1JGSA 4RS2A 4L8AA 1X1DA 3LSRA 4A38A 2WV0A 4GCVA 2FSWA 1VFCA 4UEZA 2YUSA 5J1RA 4WX9A 2DMPA 4NQWA 3D5RC 2H1KA 4PXEA 2HQNA 2B0UC 4P10A 2HVRA 2HXIA 2PMZN 2RN7A 4XOPA 4CYDA 2DT6A 1T0FC 2Z3LA 4G6DA 3LFUA 4PXDA 2HFHA 2B4BA 3DLJA 3SZGA 1N78A 4BJ5C 4L9VA 5CQEA 4ENKA 1T38A 3QOPA 3B7IA 3AG4H 1MMSA 5HOOA 3G73A 1O4XA 2W25A 3BZ6A 3PO3J 1P9ZA 2PC1A 1FYKA 3B3CA 4I76A 1Y8FA 1FOKA 2DKVA 2IS6A 4Q47A 3HRMA 1LFBA 3Q3SA 3JAMK 2ZOFA 2DPDA 3DF8A 3CMMA 1K4JA 2VI7A 4ZY2A 3WC6A 4RB1A 3BWGA 4YFNF 4FD7A 1CP6A 5EX0A 3R96A 2A69F 1XGNA 2BOAA 4WXCA 3KX2A 2F3CI 2DT5A 3KETA 1U5TB 1USSA 5B3SH 4X1EA 5ISVA 1YR0A 3LSJA 2DXQA 5JFRA 3PQJA 2ARPF 2JA7J 2X1DA 2VBQA 4OADA 2FBHA 4R57A 3PFIA 2OU2A 3ZMDA 3CCVI 3QODA 1GV5A 3GO5A 2LY1A 4YIRX 2ZJPF 1D3YA 1HF0A 1KUYA 4RUHA 2CNTA 4XL9A 5LFAA 1PCAA 2SGPI 3ZMVA 1KA8A 2LY9A 1KQ0A 2F5FA 4UHTA 5K5OA 1YYVA 2MFZA 3LSHA 3T0YA 2Q4VA 1S9HA 1YS7A 3HB9A 1YMEA 3KPHA 5JHUA 4XIDA 2NS0A 1R1UA 1WK4A 3S6GA 4NGSA 2TRTA 4UWIA 4XM3A 5IB0A 2DA7A 2WADA 1MNMC 4XKCA 3L1PA 1B6BA 4LUAA 1MH4A 1H89C 4BQOA 3BROA 5J3LA 1Q2YA 1JHFA 3WTXC 2QENA 2Q2EA 2PVVA 1YHQI 1S7EA 3HG9A 5LEJA 4X0GA 2RNGA 1K7UA 1LDKB 4Y7NJ 2QQDA 3SZPA 2H09A 2CUZA 1BBYA 4KLVA 1V4RA 3ULQB 1MBHA 3E6DA 5ICEA 5FB2A 4I2OA 1NTCA 3DTKA 3CF5F 3QPHA 2QSHX 3H9JA 2R98A 1R3NA 1KQ9A 3I64A 1PJUA 4A5MA 1IB1E 2DDBA 2J5PA 4B13A 4B09A 4XBFA 4E6KG 2DB6A 1RKTA 5ICGA 1S3ZA 1RESA 4QIWN 1FT9A 2Z3PA 1JXSA 3IJ3A 2QLZA 2CSOA 4UXJA 2RQQA 4PJMA 5K1YA 1S8NA 1PP7U 2VC1A 3D67A 2MH2A 4Y49C 1AHDP 3VB2A 3OVOA 5J1YA 1TIHA 4YELA 4E7ZA 3I56I 5F0CA 1LOKA 2Z3KA 2CTBA 5I0CA 3TP0A 1QMUA 3HDDA 2OBPA 3KR5A 1X58A 3JCUC 2VXZA 4X6AJ 1SMTA 5D29A 4MFJA 4ESFA 1ZKGA 3C26A 4PGHA 2R7QA 5HS9A 4IHWA 1I27A 3HPHA 2DEAA 3PB6X 2QBYB 4F0XA 4OP4A 4BKXA 4M3GA 4R6TA 3BTJA 1DP3A 1FSEA 1YTYA 4AB7A 3GFJA 1RTQA 1U9NA 3KZZA 1IF1A 4ZDOA 2L7MP 3K4BA 1ZGJA 1FEXA 3DEEA 3RNZA 2ORWA 2VONA 4B5PB 2DMNA 5K8NA 1VKCA 1DS2I 1KU3A 1GYTA 3KCCA 3K0LA 2K3FA 2EK9A 4R87A 5E96A 4HX4A 1VGYA 3M1CA 4LLNA 3P9KA 4IRHA 3ZQLA 5DS9A 3F3XA 2EFPA 3NE7A 4CA0A 1YVOA 1YIOA 2CV2A 5AG5A 2W24A 1JKPC 2Y0SA 1JHHA 2UZ3A 3PGPA 1TBOA 2DI3A 4KIFA 4DNCA 2WZNA 2M87A 2VKDA 5HVQC 1ACIA 3JRHA 3I3LA 5LHHA 5EEHA 1BR2A 1U8BA 5CKTA 2CXAA 2VZYA 1O7LA 3HUGA 3DPTA 4ZTFA 2UXXA 4PQAA 5F09A 2YNDA 4NC8A 1EKEA 1YS6A 3S2WA 2XF5A 3Q9VA 4G7HF 2NVXJ 2ZEGA 3S6KA 4JBAA 2ELHA 2RKHA 2ESHA 1XDSA 2DXIA 1BPMA 4KUBA 1V55H 3S9NA 1YQAA 5J4YA 4YWYA 4JXQA 2K7LA 4N9IA 5LHGA 4B43A 4A94A 2Y31A 1LDDA 2MYSA 1SD6A 1LVKA 4OMZA 1P4AA 3JAMZ 2PLYA 2L7XA 1M1DA 4BAYA 4BHPA 4C3IJ 1BR4A 3CDHA 2MSYA 3BJAA 4PCQA 1BR1A 2G3AA 2HU9A 3K9UA 3VWBA 2B7EA 5CPAA 1ZGWA 5IT3A 2CQQA 2E71A 2FS5A 5JH9A 1Y1VJ 2ZFWA 1LAPA 1Z5RA 3TX8A 2PJRB 3UR3C 1BUSA 3H8FA 2O61A 4Q4ZF 3PFYA 1GV2A 2GA2A 4HSRA 4GXHA 4LG0A 2DODA 4IHTA 5M5YJ 4QPOA 1OYIA 2DLLA 2GLOA 4LOCA 3JSPA 2WV1A 5DUIA 4R9MA 2NXNB 1B6AA 1X4PA 1SAUA 4E1RA 1FP1D 1CT4I 3CXQA 3KEYA 1PTQA 1OBRA 2XEFA 2XAUA 3DR8A 4O6JA 3SJXA 2R8VA 2LF8A 4A3GJ 3M8JA 1EJ9A 2ORVA 4IOAF 3W2WA 5LD2C 2L5QA 4C3JJ 4IOCF 5F27A 4H0EA 4Q5SF 1BAVA 2HVSA 3ONQA 1ETKA 3NARA 1DP7P 2Z3NA 3Q9SA 4A6EA 3CDLA 3PJRA 2JZMA 4PJ0C 3BG7A 3F6VA 5J8CA 1OCZH 3KHXA 1XBTA 3A1YA 2V7FA 3G2BA 2IAIA 2CWEA 2W7NA 1ZLIA 4MQ9F 3WTYC 3G4SI 1WHUA 2JK3A 2LREA 3GTGJ 4FD4A 1S7AA 2WBMA 5KVRA 3BCBA 2R7HA 3SGBI 1F36A 2V53A 2Q04A 3ASNH 3KP2A 3WE2A 4FWUA 4M3SA 4XPDC 4OAZA 4M3BA 1RI7A 3FKIJ 4MQVA 1GXPA 4WP4A 2BCOA 3G71I 4YIFA 3OYLA 2CUFA 3LSGA 2X52A 2R7FA 1IC8A 3RZDJ 2DA4A 3SI1A 2XRNA 5B1AH 1AWCA 5CVJA 1O3SA 3RBUA 3CCRI 2WUUA 4HG2A 3IWZA 2MLGA 3N4MA 4UV8A 1U5TC 4PDKA 5DAEA 3RKYA 3D7GA 2QMLA 4MXUA 2DFHA 2M45A 2M4KA 3ABTA 3KP5A 3KZYA 4JQFA 3EUHC 4U0VA 3PO2J 1YLEA 2PIYA 2VLAA 2PVWA 3IU1A 3B3TA 4NFRA 4XONA 3L2QA 5F08A 4UCNA 5LBQA 5ELYA 1SGQI 3J80Z 3LMMA 2VOOA 3L00A 2FMLA 4WK8F 3D7DA 4E2AA 2QKLB 5E3NA 4AU7A 1TQPA 2PJ7A 4PXCA 4EJUA 4I99C 2EFWA 1R4NB 2PJAA 3F8BA 2YS9A 1JE8A 4C2ZA 5IPAA 2REEA 3B2YA 4HNYB 2BY0A 2R7TA 5IP7J 1NG7A 4N0BA 3ZQCA 3FXTA 3ZJ0A 1M4GA 4LK1F 4LB5A 2HYGD 3MFKA 2E2JJ 3DDDA 2GANA 4W9YA 1Z9UA 2IPQX 2YUUA 2WB1N 3CDXA 1QHGA 2ME6A 2VKEA 3ZMZA 1CHOI 5LYFA 3I1UA 1WJDA 4HW0A 4QLCU 2JBKA 7CPAA 3CUQA 4P4BA 4M9ZA 5E3OA 1ZELA 1CBXA 3IEHA 3IO1A 4C2UA 4A24A 1J9IA 1R7JA 1BPNA 2PJ0A 1KU2A 3ISXA 1U6GA 5L3DA 3GIUA 2MG4A 2EO8A 2TDXA 1WH7A 2JMWA 2R5YA 3FX3A 2EK8A 5GP9A 4HBLA 4UY8I 2FQ3A 1IU8A 1QVUA 3RQ4A 4MO7A 4FHTA 3K4NA 1D5VA 3P2HA 4GGGA 5E8GA 1X12A 2M1BA 4UUSA 1YREA 4V2FA 1UFMA 3U2RA 3V7RA 1NSLA 2NNNA 3ZMTA 4HQMA 4ZZLA 1ZLKA 2ELKA 2J5OA 1B1BA 3M3YJ 1XMTA 2AFZA 5M3MJ 1IV6A 2OAZA 3VDPA 1FBQA 2M34A
chains in the Genus database with same CATH topology
3FMRA 4KZTA 4H6ZA 2JRTA 4M71A 2JPCA 5TRDA 2PFBA 3DPLC 4O5VA 4Y13A 5AG7A 1IRFA 2W57A 4MHDA 2JEVA 3VWDA 2ISZA 4IRIA 3QP5A 1B4AA 1HSTA 1ON0A 1RNLA 3I59A 4HF2A 2WC2A 4A0ZA 4L0YB 3WU1B 4BNCA 2B3VA 2ZW7A 4OAEA 4HLXA 1ON2A 1T2KA 4HQEA 1Q1HA 4UWJA 3I3GA 4CICA 1OYYA 4IVNA 3KLOA 2HS5A 4I02A 2BBYA 4OIQF 1XMAA 4AVPA 4KOXA 3GUDA 3HYIA 2HV2A 5FO5A 1ZHFA 3BY6A 2C27A 4MJ8A 1BN5A 1SMYF 1QSMA 2HDCA 1S7FA 1BOBA 2ZW5A 1R58A 2IW5A 2CNMA 1FLIA 4NSQA 3F22A 4I0AA 5HLHA 1S5KA 1WKMA 2XVCA 3CUOA 3COAC 1U5TA 3JTKA 4AG7A 2GWRA 4OIOF 2XIGA 1CF7B 2FA5A 2VOPA 2FF4A 5LGTA 3REOA 4J3GA 3CO6C 3C7JA 2O28A 4YGOA 2AS5F 4ESJA 3IHUA 4ETSA 3ABUA 1G3TA 4AVCA 3KEOA 5HH1A 2EFQA 4XSXF 2WPWA 2H94A 3TE4A 4RGSA 4XLPF 3F6OA 4IF5A 2MBFA 4U5YA 2RVCA 3RIRA 3UY5A 2A3SA 3HOTA 3P2FA 2F5DA 3LODA 5ILSA 2A4NA 4OLLA 4KNYA 1QSNA 1BIBA 4CGOA 1XSDA 1QSRA 3CTAA 5F64A 2E1NA 5DCFA 1PU9A 2PDOA 1USTA 3BJOA 3HSRA 1MZBA 2MLKA 2DPSA 1RUOA 2OH1A 5LHIA 3C3WA 4HF0A 4ON0A 1TLHB 2FL4A 1XB4A 2OB0A 3ZZIA 5C88A 4KYWA 4MFLA 1J4JA 4M85A 2HYFA 2PG4A 1U78A 4XSZF 5ILVA 3MZHA 4R79A 1F4KA 4WF2A 5IT9K 3GYAA 2A6HF 2O0YA 2VBXA 4X5KA 1H9GA 2L54A 4CO8A 3O2PE 2EB7A 5G22A 2QQ9A 3ELKA 3WGHA 2EWNA 2PSWA 2P5VA 2CY2A 2OZUA 1J7KA 2YSRA 1NMTA 3EXNA 1QGPA 2A68F 1RO5A 4PSWA 1FBUA 3V7CA 1XE4A 3ZMSA 1ZG5A 5D8KB 2ZW4A 1I1GA 4KIGA 1IYKA 5HDKA 4C7HA 1T0FA 3C1DA 1P2FA 1NE9A 5K5QA 3IC7A 4AVBA 3LSTA 4NB5A 2Q44A 5LRRA 5EC4A 3HSFA 3TKYA 1J75A