1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Esa1 protein
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
3MQ0A 3CXSA 4U7DA 1IUYA 2FS5A 3JUWA 2FIAA 2HQYA 2QIRA 2FA5A 5LGNA 3O6BB 2DPDA 3FNCA 4OIOF 3E6BA 4RS2A 1IZ1A 3KP4A 1XSXA 3LAPA 4KOYA 4GCVA 3BOQA 1P4WA 2Z33A 2B4BA 5FFXA 3E97A 2GAUA 1WWXA 2RQPA 2E7WA 3BY6A 4O6JA 4E2AA 5L3BA 1V0CA 4KOUA 1UB9A 4A2UA 5L3CA 1MJAA 4MY0A 1ON0A 4IHSA 5FD6A 3F6VA 4J3GA 4UA3A 1NE9A 3R96A 2Q7BA 5HLGA 2XAHA 2OZUA 3TE4A 4HW0A 1G3WA 1IB1E 1K7AA 2HGCA 4XSXF 1F5TA 2H6BA 1IXCA 3P9CA 4LUAA 4U9ZA 4OIPF 1IN4A 4QC6A 5LLQA 3SZPA 1Y9KA 1DPUA 4UV8A 4PK3A 3G8WA 4JD6A 2B4DA 5D4RA 1MZBA 2CFXA 2HV2A 1PP8F 3Q5FA 3IWZA 2FCKA 3EFAA 2HZTA 3C1DA 3RI4A 2O03A 2OB0A 3TTHA 4KIGA 3E5UA 4QWQA 4JQFA 3PQJA 2OD5A 2GA1A 4LLNA 2KRFA 3RPUA 3U9GA 3ECOA 4L18B 1PU9A 3SXYA 1REPC 3FZVA 2M30A 5EBVA 5DD4A 3F8FA 3QP5A 2P6SA 2ADUA 5ICEA 4HQEA 2VC1A 5AIQA 4CDGA 3MWMA 1P6RA 1B9NA 2A07F 4ENKA 3GFIA 4A0XA 1ODDA 5K5OA 3F5BA 1JHHA 1Z4EA 2HKXA 1BI1A 1S7OA 4R8HA 4Y49B 4LG0A 2P6EA 2F5CA 1KU7A 4NXYA 1FWZA 2O3FA 4U0VA 2FXFA 3HSRA 2I79A 3J81K 5BMZA 1HKSA 2MD5A 4EM0B 1R5GA 1J4JA 2G3TA 1M44A 3ZMDA 1RZ4A 2PJPA 5DCMA 4M72A 4HOBA 2EJRA 1ZREA 3HRSA 2L01A 2CNTA 2VODA 3TOAA 2FIWA 2BGCA 3IWFA 4XNHC 3TT2A 2A68F 1W7PA 1BI3A 2G7UA 3M8EA 1SFUA 2NAZA 3LQQA 3QU6A 4A12A 3EYYA 5HS7A 2IT0A 5K5QA 4MI4A 1R7JA 1BI0A 3R1KA 4L89A 4CHUA 1L0OC 1G4DA 4KN4X 2QQAA 1P4NA 1IN7A 2PN6A 3JVNA 2EFOA 2Y48A 2UZKA 2BUEA 3O3KA 4WK8F 2XASA 4HLXA 2LKPA 4PCQA 3JAMK 3RKXA 2AE6A 2PR1A 3GF2A 4H6UA 5L3EA 2BSWA 4KYWA 1F4KA 5BQTA 1NSLA 2L4MA 4FT8A 3WU0A 3M1EA 3V4GA 3B8GA 5LHHA 1FYLA 2DXQA 1I27A 2OZHA 3ERED 1OR7A 2D1VA 4RB3C 1DDNA 3LA3A 2FMYA 1ZRDA 2YX4A 2RV8A 4YRHA 2B3UA 3S2WA 2ARHA 2Y0MA 3GO5A 5BOXA 2NNNA 2VOPA 1YYVA 2VZZA 4MTEA 3CUQA 5FD5A 1XCBA 1GXQA 2MBFA 1OPCA 2AJ6A 1LDKB 3E3VA 2PEXA 3K9TA 2W24A 4EJOA 5HS9A 3T90A 2F5DA 2Y75A 2K7LA 1Q2YA 4A6DA 1J2XA 4HDVA 3W6KB 4FD4A 2NMTA 5D4SA 1XMKA 4N9HA 4ETSA 3FX3A 3P9KA 4HLYA 3HRUA 4ZYGA 4G7HF 2X7BA 1KZFA 3GKRA 1IYKA 4RAZA 4O5VA 2XAQA 2EFWA 2L54A 3FXTA 4KLVA 3W6SA 4EMSA 3F21A 3E6MA 1OYYA 4PGGA 2D45A 2PMHA 2QWWA 1ZN2A 4HV5A 1K6OA 4LMYA 4CAWA 1O7FA 1I21A 2QBYB 3ELKA 4CRYB 2Q4VA 1LNWA 3RYOA 5H6QA 5HDNA 1MDMB 3K1NA 1UFHA 1Z1DA 3ABTA 3FXQA 2L3DA 1YR0A 2DTRA 2O8XA 2EFPA 1T38A 2RKHA 4Q4ZF 3VFZA 1LQ1A 3JW4A 1YS7A 2ZKZA 4K2EA 4QLCU 5D5VB 1U6MA 3BWGA 3VWEA 3J80K 3E5QA 1J59A 3QU3A 1D3YA 1USSA 5AONA 4KA4A 4UWIA 2K4JA 3K0LA 3RPQA 5DUKA 3KP5A 3I53A 3FM3A 1J7KA 2QVOA 1S7LA 1XGOA 4G9YA 1WKMA 1J0RA 5HOOA 2Z0ZA 4ORFA 1KUVA 4X5KA 5LRSA 1Z7UA 4RAYA 1PP7U 2VOOA 2VXZA 3HUGA 2BBYA 3L9FA 3HTSB 3HSEA 4WXHA 2HQNA 3V8IA 2UXNA 3W6JB 4FHTA 3LA2A 4IXAA 2KIMA 3IHUA 2ZXVA 1BO4A 4ZBGA 3ZMZA 3D8PA 4CICA 4B5PA 4IF4A 4WWCA 4B09A 2ELHA 4HF1A 1WQ2A 2QUFA 1Z05A 1MGTA 2KJBA 3JTGA 3KCCA 1T6SA 2B0LA 2R3SA 1S3JA 4G94A 2O28A 4YIIA 4H0EA 4OIQF 4KORA 4NB5A 5CVIA 3FIXA 3GFJA 1MJBA 1IIDA 3E6DA 3H3ZA 1QBJA 3I64A 3G73A 2FE3A 4H89A 2OAZA 1I1SA 3T9YA 1UCRA 4MQVA 5L3GA 3EYIA 2Q0OA 2OQGA 3LA7A 4QBJA 1R36A 1RXTA 2JRTA 3PFIA 2WPWA 3CLOA 4LK0F 3ZMTA 4OLLA 2W85A 4MNUA 2XHKA 4EJWA 1TBXA 2BEIA 3PP9A 2ZPAA 1PDNC 4NCZA 2GA2A 4UUVA 4I7HA 3WR7A 2GZWA 4HF0A 4OOIA 2V1XA 1KUXA 4ENMA 4ZZLA 2A6EF 3OOPA 3PQKA 3WTZA 2VC0A 5FLXZ 2EFNA 5LEJA 4AG9A 3WGGA 3LSTA 3QOPA 3S6GA 2JTVA 1OMIA 1D8JA 3D2PA 3ULQB 2VE9A 2ISZA 2Q4YA 2DU9A 2D2WA 1S60A 4AIKA 5JVTA 2FT0A 2X0LA 1TQMA 1XE4A 2IP2A 4KIBA 3IGRA 1T98A 2QBYA 1XDSA 1YTYA 2ISYA 4RGRA 1U5TA 3C7JA 3GYHX 4ZYHA 2Q8KA 5D8KB 1S5KA 3ML6A 4I02A 3L7WA 2OU2A 1FYKA 2K4BA 1IYLA 1MKMA 2A3SA 1YW7A 1WRJA 2V1UA 4IRIA 1HSJA 3V7RA 4M6XA 4YFJA 3N7ZA 2FBHA 4MJ8A 3WTXC 3HYIA 4G6DA 1KUYA 3U2RA 3P2FA 4A5MA 1OKRA 2X4HA 2KCWA 3H3UA 4B5PB 4WCGA 4QUSA 2J8NA 4KMUX 3ZJ0A 5IV0A 5EEGA 3SHFA 4KLWA 4ENJA 4IRGA 5H84A 2ZBKA 1OZPA 2CO5A 1JGSA 1ON1A 3R9GA 1ZAOA 3Q9SA 5KTAA 1HSTA 1B59A 1TQIA 1WWZA 2HOEA 3F6OA 5F64A 2CWEA 2IA1A 5D6FA 2Q44A 1HXDA 2PC1A 3ROUA 5D5WB 1SQHA 4HBLA 5CJ9A 2FSWA 1D8KA 2WPXA 1HBXG 2R98A 1S7KA 4LD5A 3EO4A 2R7DA 2R8VA 1RUOA 4LB6B 3JSPA 3TKYA 2C27A 4L9VA 3HRMA 2V6CA 4G7ZF 2PI0A 3QPTA 3BP8A 3I0TA 4HDUA 4KVME 5ISVA 4UV9A 5DWMA 1QQIA 1LRZA 2IPQX 2ZO4A 5F6FA 1IXRC 1J75A 2OH1A 4CYDA 3KLOA 1TIQA 3CJNA 4XRFA 4ZZDA 4HF2A 2FE7A 4UWJA 1TTYA 1XGSA 2GE3A 4R1HA 3PZJA 5DV5A 5FGMA 4AIHA 2ZJ2A 2V79A 3P2HA 2VN2A 1FBSA 2G0BA 2XROA 2MLKA 4RS8A 3F8MA 2YPRA 3IRQA 3DV8A 1G6NA 3B73A 5DDGA 2Z5UA 4N0BA 1BC7C 4AVAA 4GYIA 2GXGA 1UHMA 4UNOA 3GFLA 3T8TA 1KGSA 3FBUA 4ON0A 3WG9A 2IA2A 1QZZA 2QZ8A 2EUIA 3HRTA 1P4XA 3FMRA 2NNYA 3SZTA 3CXQA 3R0JA 2I00A 1V3FA 1XSVA 3C3WA 3DQVC 1LVAA 2WTEA 3EDPA 3W91A 3CO7C 3WGHA 2PBIA 4DQ2A 2OZ6A 1YW9A 3P9IA 3D3SA 4KOVA 4PSXA 2YX7A 3F8KA 2JZYA 1T0FA 5E17F 4HNXB 3TO7A 2EVNA 4YFXF 1I12A 1W5SA 2PFBA 3DEUA 4KIFA 3FRMA 2W25A 4ONUA 3T5XA 4I98B 2EFQA 2CQKA 2IVMA 1F9NA 1S6LA 1O3QA 1BBYA 3Q9VA 4EJVA 2BV6A 1IRGA 4JWPA 1I1GA 1SFEA 1I1DA 2HTJA 3I59B 4OAEA 1R00A 2HWVA 3HOSA 3IL2A 1JHFA 2EB7A 2D4OA 2IJLA 3DSBA 2B4DB 1HQCA 4CO8A 1ZHFA 2FEZA 3M9AA 3V8LA 2HUZA 4MHDA 5D8LB 4KT5C 2LF8A 1Z6TA 3CUQC 4FX0A 2A61A 2KJCA 2IW5A 1R57A 5KTDA 3ZMSA 3BJ8A 3L00A 4QVTA 1YS6A 4AB7A 3F8NA 5E18F 2OBPA 2DLLA 2RGVA 3IC7A 5L3DA 3V7CA 5L3FA 2QLZA 2J8MA 1ZRFA 5LGUA 1ZH5A 1QSMA 3SXNA 3WGIA 4QB9A 4BH9A 1W7PB 2ZCWA 3DF8A 3QP6A 5F47A 2FMLA 1FSHA 4U7BA 2MLGA 3VOEA 1CGPA 5F46A 3G3SA 4EV0A 4CRZB 1H0MA 4U9YA 3RTRA 5ILUA 1LDJA 3KP2A 3I9SA 2VI7A 4IPAA 4EJTA 5CNPA 4MQ9F 3KP6A 4P5OA 4FD7A 2M8EA 5I0CA 1S7AA 3T8RA 1FP2A 4RGXA 4JK1X 3ZP5A 4KOTA 4BMHA 1YVKA 3KP7A 1I5ZA 4FD6A 4LX9A 3K1PA 4XBFA 4AIJA 3ZZIA 3TDZC 1XIXA 2JEVA 2VEZA 2DBBA 3KP3A 4AVPA 4I0BA 1W5TA 1YO5C 2L02A 5LBQA 1RIOH 2P4WA 3D0SA 2BE5F 4UVCA 4WXDA 2J5OA 4EM2A 1SMTA 3QRFF 2MH2A 2F5IA 4B8XA 4ZH4F 2XVCA 3J81Z 2R7FA 2XAFA 4ENNA 4CGZA 2TDXA 1U6GA 2VT3A 5K1YA 4A0YA 1XN7A 1SFXA 2EV5A 4RI1A 3TO6A 3GW2A 1OYWA 5D5XB 4M6YA 1BM9A 2GIVA 1EH7A 5J8FA 3J7AO 1KQ0A 4HQMA 5E1WA 1MK4A 3ZQ7A 1E17A 4ASNA 1MD0A 2G9WA 1SD5A 5ICGA 1P0HA 1NMTA 4F0YA 3WU1B 1JE8A 4U0WA 3COAC 2UWMA 3REOA 4YFKF 1KQ8A 3N97A 2WWYA 2YR2A 2DT5A 1UFMA 3KLNA 3LD2A 1VHSA 2VQYA 3UY5A 3DPLC 3AAFA 4M85A 5AIPA 2P5LC 4GYGA 5IT9Z 2VBZA 1OYIA 3WTWC 1O3TA 2EA4A 4RB2C 4WF2A 2K27A 2QYOA 4U0YA 4AWXB 3H92A 4L9JA 5E8IA 2ZXJA 1BOAA 2DO7A 1XMAA 5GCNA 1KU3A 4OMZA 4BAYA 4PV6A 3SHPA 1VTNC 1SMYF 3TO9A 5C88A 1GXPA 5FB2A 2YSRA 1YLFA 1LJ9A 1Z9UA 3VB2A 3FMQA 4UXNA 2RN7A 3FMSA 5ERIA 2CY2A 4YGOA 5DCFA 2K5TA 2PR8A 4KUMA 1B87A 2LNBA 4R3KA 4HA8A 1RI7A 1QNTA 3R60A 3TGNA 5H20A 1HW2A 4Q5SF 4FD5A 1S7FA 1ULYA 5KVRA 1Y7RA 4R87A 1G3YA 2VBQA 2HFHA 1YIOA 3NRVA 5DCMB 3S6KA 6PAXA 3KEQA 2E1NA 2P8TA 5F48A 4I09A 4KOSA 3DKWA 5ICCA 1T39A 3HHHA 1B1BA 2PG4A 3E5XA 4G7OF 4IJAA 2B58A 3WTVC 4GGGA 3LFKA 1IW7F 4OIRF 1MDMA 4LJZF 2NYXA 4CZZA 1STZA 4G6QA 2HQRA 5J8CA 3SQNA 5HVQC 1TW2A 3R95A 1M4IA 1Q2DA 2KIUA 3DPTA 1QSOA 2XGXA 5H6RA 4ZYDA 3R9EA 1TNTA 3KETA 5E1XA 1AWCA 4MY3A 1TW3A 2M45A 4M71A 3IRRA 2E7XA 3RDIA 4S05A 4Y49C 3IKVA 2J5PA 5FVJA 2L4AA 2ZW5A 4NEXA 1LEAA 1WI9A 4A5NA 3EETA 5BS6A 2KIFA 3MFKA 1BJAA 2AS5F 3I58A 1Q1HA 4LB5A 2R1IA 1U8RA 3I5UA 3K9UA 3J80Z 1Y0UA 2A6HF 1GHEA 5H86A 4XLPF 3HIFA 1M4GA 2QECA 1Y9WA 4KZTA 1LDDA 1AOYA 1Z4RA 3CUQB 1DUXC 3KE2A 1S8NA 2STTA 4XNHB 1R1TA 4GXOA 1E2XA 2BYVE 5ICFA 4KOWA 3K69A 1H9TA 2B3VA 3JAMZ 4PGHA 1ZG5A 4L9NA 1ZYRF 1SAXA 4L8AA 1KYWA 1O3RA 1CJWA 5JPHA 2CYYA 4EVYA 2LF7A 1QPMA 1S29A 3RIRA 1YK3A 5DEQA 2FF4A 2PSWA 1FSEA 4HX8A 2F5EA 3GX4X 2IA0A 4WX9A 2PLYA 2FRHA 3HOTA 1K78A 1B9MA 3S6FA 3IKTA 4XPDC 3F3XA 1O57A 1FYMA 1XCVA 2FU4A 3CDHA 3BJOA 2OQRA 4HAMA 4II9A 3BLNA 2ZFWA 1WSUA 2CW0F 1V4RA 2EK5A 2WV0A 1C0WA 1DPRA 2VBWA 3SFZA 3TFYA 3GYAA 3V8JA 3WTYC 2H94A 2GQQA 2FL4A 3R61A 1BIAA 2GWRA 1U5TC 5HDKA 2ZW7A 5ILVA 5JI6A 1I6XA 2DK8A 1D5VA 4MEYF 1K79A 4KMFA 2NRAC 1SD4A 1FBUA 5JQ4A 2O61A 2DQLA 3NE7A 5KTCA 4I0AA 2EV0A 5CVUA 5TJJA 2K86A 1DP7P 3V8KA 5C82A 1YW8A 1KYZA 2HTSA 3HHGA 1ON2A 5HLIA 1FOKA 1QSNA 5EC4A 2DW4A 2HYGD 2XUBA 3CO6C 3CXPA 2R7HA 4KNYA 1XB4A 4NHJA 5D5UB 3B02A 1YREA 1FPQA 3C18A 3GLXA 1FY7A 4KUBA 4YG2F 1FBQA 1S3ZA 4PDKA 3ZMVA 4M9SA 5DWNA 1P2FA 1WK4A 3D5LA 1LB2A 1IAWA 1F1ZA 3F72A 2ZNZA 2ACJA 2P6FA 4KOXA 1RUNA 1B6AA 5TRDA 4Q48A 3GVAA 1YGHA 1R5HA 4EQQA 1X3UA 2RNJA 1QGPA 4MGRA 1ZGAA 4BNCA 1SD6A 3QPHA 2Z9OA 2CG4A 4HYEA 2DQRA 2HS5A 1B6BA 3DDDA 4IUSA 4K30A 4P9FA 3FWEA 2HYFA 1HW5A 3GFMA 5A2QK 2PDOA 4P9UA 5CVRA 3R9FA 1ZGJA 1EV7A 3OWCA 1ZRCA 4XLNF 4CAXA 4G8XA 3FF5A 4HX4A 1M4DA 2CGPA 2REFA 5HMNA 1YG2A 5F1RA 1L0CA 3TOBA 3I3GA 4L0ZB 5CLSA 2D1HA 2LDUA 5E8GA 2G3AA 3I71A 3DR8A 1U3EM 3MEXA 2V1DA 1ONVA 3DXJF 3K2ZA 5IT3A 4Y15A 3PGPA 1Z9CA 3VODA 3BJ7A 4XPKA 1J9IA 5F49A 2RVCA 4MTDA 4M3SA 1PUAA 3LWFA 3ECHA 2FQ3A 4BQAA 2C6YA 2W57A 3O2PE 2JSCA 3M8FA 1KA8A 3FXRA 5HDGA 2BL1A 4L5IA 2REEA 1XEBA 1XGMA 1P92A 4BHBA 2H6CA 3DFGA 4O3MA 3MZHA 2VONA 4R9MA 4H6ZA 5ED4A 4MHGA 1O3SA 4P55A 3E0KA 2XKPA 3FB3A 5CYVA 4RB1A 1HKTA 3VWDA 3QAHA 2FBKA 3MCZA 2JT1A 1L3LA 2XAGA 4R79A 3BPVA 3BJAA 3JTHA 2PMUA 3EC4A 3TCVA 2XRNA 5IB0A 3FXUA 3N4MA 1U78A 2FNAA 3NEUA 3I4PA 2WC2A 1MJ9A 2XV4S 4EGYA 4E8OA 5ILSA 2VXKA 1P4AA 5E96A 1UHWA 1ZLJA 4DNCA 2OA4A 4PK2A 2VBYA 2HDCA 3DP7A 1HKQA 2RC4A 1GVJA 3TQNA 4UVBA 1FNNA 4RB0A 3KZYA 3S6HA 4YIFA 2UXXA 2XAJA 3L2CA 3GUDA 2VT2A 1B4AA 1BI2A 2YU3A 4CXFA 5BPDA 2JLMA 2V9VA 2FBIA 4HZFA 3RKWA 4BHPA 2ZNYA 5FFZA 1G3SA 2Q0YA 4ESFA 3FHZA 5HH1A 5D6EA 5LHGA 1IN8A 1GHCA 2A4NA 4U88A 2ZMEA 3FYNA 2QM3A 5LRRA 1YQAA 3ZN0A 3D2MA 3W6XA 1M1DA 2DI3A 4JBAA 1J5YA 3KEOA 4AD9A 1Q2CA 1RO5A 1T2KA 1FC3A 2Z11A 1KQ9A 5LHIA 4ESJA 2P5VA 5E1ZB 3F23A 4I49A 5FO5A 2LSOA 3GXOA 2KKOA 3RYRA 4AVCA 2K02A 2A5YB 1CF7A 4U5YA 4XPDB 1BN5A 3R6SA 1KU9A 2ZW6A 4L9TA 4Y13A 2QENA 4JJXA 2QMLA 5DUIA 1W7PD 5JFRA 1LEBA 5DYMA 2PRBA 4IVNA 4UVAA 4EM1A 1JXSA 1FX7A 4LGWA 4E70A 1O7LA 1EH8A 4R3LA 2XKOA 5JHUA 4AG7A 1YLEA 4XSZF 1U5TB 2D4PA 4HNYB 2B5GB 1IRFA 3ZMUA 2JPCA 4Z2YA 4P96A 1FLIA 4KN7X 3F22A 3IWGA 1Z91A 2M87A 4HV6A 4BXUA 3TDUC 2GXBA 1IICA 2IL4A 4M9XA 2G7HA 4AVBA 3WE3A 1R23A 2Q04A 1SD7A 3R4KA 2ZMEB 1K78B 1FT9A 1QZYA 1CF7B 3SXOA 1YFHA 4LK1F 2MC3A 1NHAA 2W84A 4ZYEA 1QSTA 4CAVA 2P0WA 3BJ6A 4F6AA 1R1UA 4YFNF 3G3ZA 1IN5A 2STWA 4JXQA 2CNSA 2DFIA 3L09A 3BROA 3KZZA 4M9ZA 2GANA 3E6CC 2HEOA 2QQ9A 5DD8A 2F2EA 4B5OA 3T1BA 5FLXK 1ZG3A 4OADA 3MAJA 1ZARA 1ZG1A 1H9GA 4RGSA 3EY5A 2JDDA 3ZPLA 5IX3A 5E20A 4TV7A 3MZYA 4IRHA 2DK5A 3ZN1A 4CS0B 2EV6A 2F5FA 3RKYA 1YX0A 3DNSA 4Y17A 2FNPA 5LGTA 4NF1A 3WTUC 3LQRA 3MGDA 3QB8A 4RGUA 2NS0A 3U1DA 1CM0A 2P6GA 3BDDA 4KVOE 2EA2A 2A69F 2MA3A 3ABUA 1USTA 4OU0A 1VKCA 1IN6A 3C26A 5HS8A 2VBXA 4N9IA 2H27A 4L0YB 1TNSA 2RDPA 1TLHB 4IF5A 4MBUA 4A6EA 4JXRA 1RNLA 4OINF 4UHTA 3ISPA 2P7CB 3RJPA 2H5MA 3BPXA 2Z10A 2P5KA 3F8CA 1XSDA 4BYYA 4FX4A 1K4JA 3V7SA 1KU2A 1R22A 4KFCA 2CNMA 2E1CA 1YVOA 4KUAA 2BEOA 1BC8C 4BHCA 2ATRA 4I01A 4HX7A 3GWZA 4NQWA 4ESBA 3KKWA 1BIBA 5EEHA 2OZGA 4EGZA 2O6GE 4XPLA 3H4QA 1R1VA 2AXLA 2ZW4A 4HKFA 5JR3A 4WXCA 4S04A 3GZ6A 2HR3A 2ESNA 2XIGA 3I59A 1XMTA 4R57A 1FZPB 4KICA 4PZJA 2JPBA 5CVVA 4LLGF 4LFUA 1W4MA 4PSWA 4IHTA 3EXNA 2ESHA 2IRFG 1BOBA 1G3TA 2M5WA 3JSOA 2FSRA 5J6XA 4EJUA 1N71A 1TQPA 4UBRA 3LAJA 4A0ZA 4GS4A 1FP1D 2Q2EA 4LLLA 3F0AA 2FXAA 3NQOA 5A2QZ 2HKOA 3VEPA 2P6TA 1Z6RA 1QSRA 4LG0B 3DR6A 4NSQA 3F8BA 2FOKA 2MH9A 3WODF 4E0AA 4I2OA 4JLYA 3WTSC 3GY9A 3KFWX 3LODA 2CSOA 2ETHA 3GZ5A 2PQ8A 3WE2A 2DPUA 4MEXF 1XD7A 4KVXA 4EVIA 2O0YA 1ZLKA 1IXSB 3OV8A 4OMYA 1U2WA 5BPIA 3T0YA 2H09A 4F7ZA 5LEKA 3EQLF 5KK1A 3K1MA 4L5JA 3CTAA 2DAOA 3I54A 1S7NA 2EWNA 3P7NA 1PUEE 1HW1A 2Z3YA 3HSFA 1R58A 1XGNA 3R0AA 4KDPA 3CUOA 3EUHA 1IF1A 3RYPA 2M1BA 3M7GA 5K5RA 4M74A 3FM5A 2VZYA 1A04A 4M73A 1QO0D 3HTUA 1XF8A 2JDCA 4GO1A 3WTTC 3BZ6A 3GEZA 5CVJA 2VE8A 5HLHA 2J8RA 4Q47A 2P7VB 2Z99A 2B5GA 4HNWB 4D0PA 2COMA 1XDUA 1EH6A 5IT9K 2QQBA
chains in the Genus database with same CATH superfamily
3MQ0A 4YEJA 3CXSA 4U7DA 3I56I 1IUYA 2R7RA 1WJFA 2HVRA 2FS5A 3JUWA 1K6YA 2EZLA 2FIAA 2X6XA 2HQYA 2KHMA 2DA5A 2PX9A 2QIRA 2R92J 2FA5A 3CCLI 3OR1C 5LGNA 4DZPA 3O6BB 2YQPA 4P4JA 2DPDA 1S5LC 3FNCA 4OIOF 3E6BA 2EQRA 3ZQFA 1IZ1A 1HEEA 3KP4A 4RS2A 2EILH 1XSXA 3LAPA 5E3RA 2QSGX 2JA6J 3QWLA 4GCVA 1R4NB 4KOYA 2XRLA 1P4WA 1X1BA 3BOQA 2Z33A 1VQ8I 2B4BA 3R5CA 5FFXA 3E97A 4HEA2 2GAUA 1WWXA 2RQPA 3HOXJ 3DTIA 2ID3A 2E7WA 1VQLI 1ENHA 3BY6A 1WJAA 3PFOA 4A93J 1P7JA 4O6JA 4E2AA 5L3BA 1V0CA 4KOUA 1UB9A 3B3CA 1MBHA 4DGWB 3BR0A 3UNGC 4A2UA 1MJAA 3F0CA 5L3CA 2ODDA 1YW4A 1ON0A 4IHSA 2IMOA 3NE8A 4MY0A 2FD5A 5LRKA 5FD6A 3F6VA 3LSIA 4J3GA 2IS6A 3LNQA 2AO9A 3R5BA 4UA3A 1NE9A 3CQZJ 1JKRC 4M3FA 2WCYA 3R96A 2R7SA 2Q7BA 2M9HA 5HLGA 1R79A 2XAHA 2OZUA 2LBFB 3LWUA 2ZMEC 4HW0A 3TE4A 4F93B 1G3WA 2VQLA 1IB1E 1K7AA 2IGOA 2HGCA 3ABLH 4XSXF 1F5TA 2H6BA 5J40A 2PJ7A 1IXCA 1QVTA 2F6CA 3P9CA 4U87A 4DJAA 2OTLI 1FMWA 4CCJA 3I3LA 2RIJA 4LUAA 4U9ZA 4ZI6A 4DBQA 4I99C 1K83J 2CTCA 4OIPF 1IN4A 4QC6A 5LLQA 1ERDA 3SZPA 5EX0A 1IY7A 2QJ8A 1Y9KA 2DF5A 2I3CA 1DPUA 1CGJI 4UV8A 1CP6A 2XEIA 4PK3A 2F7VA 2OPTA 3G8WA 4JD6A 2QF7A 2B4DA 4XM3A 5D4RA 1MZBA 2CFXA 2HV2A 1PP8F 2O53A 3PNVA 3Q5FA 3IWZA 2MC4A 2FCKA 3EFAA 2HPMA 2JJ7A 4PUSA 3NWSA 2HZTA 3G1LA 3C1DA 3RI4A 2O03A 5DS0A 3A0BC 2J9AA 2OB0A 3BT9A 3TTHA 5IB9A 9WGAA 4KIGA 3O8HA 3E5UA 4K3NA 4QWQA 4JQFA 3PQJA 2OD5A 2HI3A 4XKVA 3RQIA 2L5QA 2GA1A 2LC2A 4B4CA 3CC2I 4LLNA 2KRFA 3UFFA 2JMWA 3RPUA 3U9GA 4NNJA 3ECOA 3LSGA 4L18B 2XPVA 1PU9A 3SXYA 2RAEA 1XTAA 1REPC 3FZVA 2H1LA 1W5CC 2M30A 5GADJ 5EBVA 1TC3C 2DJIA 5DD4A 3F8FA 3QP5A 2YNEA 2P6SA 4XL9A 2ADUA 5CQEA 1VHOA 3V38A 1PVEA 2HPIA 1PYTB 4JX6A 3M3YJ 5ICEA 4HQEA 3KASA 2VC1A 5AIQA 4CDGA 2W0TA 2Y2ZA 4A3FJ 3SEZA 1IGNA 2EZIA 1LFPA 1Z8TA 1T0FC 4BQNA 3MWMA 1P6RA 2E19A 4B6DA 1YX3A 2Q51A 4B14A 1B9NA 2A07F 4ENKA 5A28A 3GFIA 1QVUA 4A0XA 1ODDA 5K5OA 3MVPA 4XMYA 1JHHA 1Z4EA 3F5BA 4X2TA 3KI9A 2HKXA 1BI1A 1S7OA 2EBIA 4R8HA 4Y49B 4LG0A 7WGAA 2P6EA 2F5CA 1XPXA 3VPRA 1KU7A 4NXYA 1VF9A 1FWZA 1XG1A 2O3FA 4U0VA 2FXFA 3HSRA 3S9MA 3ZCOA 1HC8A 2SGQI 2I79A 3KQXA 1XOVA 4ANJA 1LR7A 3J81K 5BMZA 1HKSA 2GOXB 2MD5A 4EM0B 1R5GA 1Y39A 1MSEC 1J4JA 1M44A 3ZMDA 2G3TA 1GYTA 1RZ4A 2BZTA 2K5CA 5DCMA 2PJPA 4M72A 4HOBA 2EJRA 1ZREA 4Y52J 3HRSA 3VSLA 1APLC 2L01A 2CNTA 2VODA 2HXIA 4RDUA 1GT0C 3TOAA 4CGOA 3DU5A 4OC2A 1YJWI 4BDZA 2FIWA 1MNEA 4LOCA 2DT6A 2BGCA 1F57A 3RQ4A 3IWFA 2GVIA 4XNHC 3MZ8A 2HDDA 3TT2A 2A68F 2ZFUA 3U21A 1W7PA 1BI3A 2G7UA 4E7HA 3M8EA 3AFHA 2N71A 1SFUA 2NAZA 3LQQA 3QU6A 4A12A 1R49A 2AFOA 3EYYA 2YUSA 5HS7A 3LFUA 3H0DA 2IT0A 5K5QA 3L2NA 4B13A 3G4SI 4D5FA 5FKNA 4I6ZA 4A3IJ 4M6GA 4MI4A 1S9HA 1R7JA 1Y56A 1ZLIA 2AFSA 1BI0A 1U9NA 3JRCA 3C2GA 3I9V2 2G9DA 3R1KA 4L89A 4CHUA 1L0OC 4M3GA 1TUSA 1G4DA 4KN4X 1BAVA 2QQAA 1NH3A 1P9ZA 1P4NA 1IN7A 2PN6A 3ABMH 3S15J 3JVNA 5IYDJ 4F0XA 2EFOA 2W00A 2Y48A 5FKMA 3I1UA 5LYDA 2UZKA 4KSAA 2BUEA 3O3KA 1UJ8A 2M4KA 3WHBA 2HQAA 4WK8F 2XASA 4HLXA 2LKPA 4PCQA 4ZX8A 3JAMK 2L9SA 1M8CA 3DTKA 2DA6A 4W9YA 3RKXA 2AE6A 3BR5A 2PR1A 5J1YA 3GF2A 4H6UA 1D1AA 3CCMI 5L3EA 2BSWA 2OOTA 3WT4A 3S1MJ 2L9RA 1EJ9A 4KYWA 1F4KA 3BCBA 5BQTA 4NUBA 1TP4A 1NSLA 2L4MA 3KYDB 3DBLB 4FT8A 4YELA 2QEXI 3WU0A 3M1EA 2KRHA 3V4GA 3HM5A 4FWUA 3B8GA 4MFKA 3DEEA 1OCPA 5DM7F 1D1CA 1NG6A 5LHHA 1FYLA 5E79C 2XAUA 1H89C 2DXQA 4P4IA 1I27A 3D5SC 2MGQA 3QODA 2OZHA 1K7TA 4PJNA 3Q3SA 5EZGA 4PXDA 2V53A 2CV0A 3ERED 1OR7A 2D1VA 2MG4A 4RB3C 1DDNA 3LA3A 2FMYA 1NK3P 1HA8A 1ZRDA 2YX4A 4BACA 3DGVA 4A2ZA 2RV8A 4YRHA 2B3UA 3K4LA 2LR8A 3S2WA 4F55A 2ARHA 1RPWA 2Y0MA 3GO5A 1JTYA 3HUGB 2JUCA 1HOMA 3MEKA 5BOXA 1ZELA 2V8DA 2O7OA 2NNNA 2JA2A 2GXAA 2PCUA 3PSIA 2YS9A 2VOPA 1YYVA 4BDYA 3PDNA 1CX8A 1OCCH 2VZZA 2ZSIB 4NGPA 5JGFA 2JBJA 4JYKA 3S32A 4MTEA 1X1CA 3CUQA 3JRUA 5FD5A 2XGCA 1YITI 1XCBA 3B2YA 2LUYA 4KJZA 3BR1A 1GXQA 1V5EA 2RB7A 2MBFA 1OPCA 2AJ6A 1LDKB 3E3VA 2PEXA 3K9TA 5K7FA 2W24A 3D66A 4EJOA 4UFWA 5HS9A 3T90A 1HPTA 2F5DA 2Y75A 2BXYA 2G0EA 2K7LA 1N13A 1Q2YA 1TKFA 4A6DA 3DLLF 1J2XA 2Q4ZA 4HDVA 4G6TB 3W6KB 1KMAA 4FD4A 3CMYA 2ELKA 2NMTA 1EE3P 2DMUA 2CFOA 2KCXA 5D4SA 2FVGA 2OC6A 1XMKA 4N9HA 4ETSA 3VATA 1VDDA 1IOFA 2W1OA 2WA0A 3MKZA 3FX3A 1VQ4I 1YRNB 3H8EA 3FDYA 5K8NA 3IV5A 3OIPA 3P9KA 3CT9A 3HLPA 1HJAI 4HLYA 3MN8A 3HRUA 4HSRA 4ZYGA 4G7HF 2X7BA 1KZFA 3GKRA 1IYKA 3SI1A 2GFQA 3S1RJ 4RAZA 4O5VA 2XAQA 2KPMA 2EFWA 1ULNA 2X51A 5HNHA 3OYAA 3BLYA 2L54A 4BL0B 1CT4I 4CCOA 3FXTA 3OYLA 4UF4A 3BG7A 4KLVA 3JTKA 3W6SA 4EMSA 3F21A 3E6MA 1OYYA 1ZR2A 4PGGA 2D45A 3UOEA 2PMHA 3AL0C 2QWWA 1ZN2A 4HV5A 1K6OA 4MCRA 3BXMA 2XDVA 3LSHA 2X3TA 1RTQA 4LMYA 5E3NA 2CWGA 3BTCA 4CAWA 1O7FA 1I21A 3RAMA 2QBYB 3ELKA 2K9SA 3CZ6A 4JOMA 4NGQA 2BO9A 4MXUA 3CPXA 4CRYB 2FJ1A 3GTPJ 2K3FA 2Q4VA 4FASD 1LNWA 3RYOA 2N1AB 5H6QA 5HDNA 1MDMB 3FXOA 1WJEA 3K1NA 1K61A 4EEFG 1UFHA 3OSGA 2O4HA 2IQ6A 1Z1DA 3W2AA 3ABTA 3FXQA 2KMUA 2ZELA 4YIRX 2L3DA 1YR0A 2DTRA 1X4OA 4QTRA 2O8XA 2EFPA 4DIQA 1T38A 5E3PA 1N25A 2X48A 1AN1I 4ZDPA 2RKHA 4Q4ZF 3TP0A 1OLTA 3VFZA 3OYCA 3JW4A 1LQ1A 3LSPA 1Z7KB 3L2UA 1YS7A 1JKPC 2ZKZA 4K2EA 4QLCU 3KIOA 4ZY0A 5D5VB 1U6MA 3BWGA 4JYWA 3VWEA 3J80K 1ELMP 1ZR4A 2IAIA 3E5QA 5KHDA 2WB1N 1J59A 3QU3A 1D3YA 1TIHA 3H1CA 1USSA 5AONA 2ME0A 4KA4A 4UWIA 2K4JA 3K0LA 1JUPA 3RPQA 4B3XA 2VPRA 3KP5A 5DUKA 3I53A 3FM3A 1J7KA 2QVOA 3HOWJ 1XGOA 1MBEA 2EIJH 3H9GA 3LSJA 4G9YA 1FMVA 2MD0A 3A2KA 1WKMA 1IDZA 3FC3A 2DEAA 2EK8A 1J0RA 2E2IJ 5HOOA 4MHNA 3PL8A 2Z0ZA 5AG5A 2L2OA 5FLMJ 4ORFA 5LFAA 3FISA 1KUVA 4X5KA 5LRSA 5ELYA 3VSKA 1Z7UA 3OIQA 4RAYA 4E7ZA 1PP7U 3RO0A 3BTIA 2VOOA 2VXZA 3HUGA 2BBYA 2OUMA 3L9FA 3WG7H 5EF6A 3HSEA 1VI0A 3HTSB 5FUWA 1WCMJ 4WXHA 2LKXA 1R6RA 2HQNA 2KQRA 5JHFA 3V8IA 2UXNA 3FXJA 4C30A 5M3MJ 3W6JB 4FHTA 3LA2A 4IXAA 4DOZA 2KIMA 3IHUA 5EGOB 2ZXVA 3NA6A 4GXHA 1BJZA 1BO4A 2CH0A 5FKOA 5FKKA 3ZMZA 4ZBGA 3D8PA 4CICA 4XN3A 4B5PA 4NBQA 3VE5A 1UG2A 1NUBA 4MFLA 2PJCA 3DLJA 4MHZA 1LPQA 4IF4A 4BBRJ 4B09A 4WWCA 2ELHA 3HOVJ 4HF1A 4GI3C 5FRNA 4CYQA 1WQ2A 4PK4A 2QUFA 3A1YA 1Z05A 1MGTA 3HBLA 2KJBA 2BXZA 3C2BA 3KCCA 1GV5A 3JTGA 1T6SA 1ZG7A 4RUHA 2B0LA 4PJJA 2R3SA 3H5AA 2Y0SA 3PJRA 2IEKA 3OYHA 1S3JA 4G94A 4J01A 2O28A 2Z3OA 4YIIA 1ETQA 1IC8A 3CMMA 2YNDA 4C7IA 4H0EA 4OIQF 4KORA 4NB5A 5CVIA 3FIXA 3GFJA 2FOWA 3CF2A 3H35A 1MJBA 1WGTA 1IIDA 2ZEGA 2BHZA 2R5YA 2YU9J 3E6DA 3H3ZA 1QBJA 3I64A 1NK2P 2DT7B 3G73A 3CCEI 2V26A 2FE3A 2ZXHA 4ZX9A 4H89A 2OAZA 1I1SA 1Z8WA 3T9YA 5FUVA 4AYBN 4MCSA 4A3EJ 2R5ZA 3S16J 3ONQA 1UCRA 4MQVA 4FUUA 5L3GA 2XF5A 3LL7A 5CCLA 3EYIA 4WP4A 1ELLP 2Q0OA 2OQGA 3LA7A 4QBJA 1TBQR 1R36A 1ZK8A 5C3EJ 4FKDA 1RXTA 2JRTA 4RM3A 3PFIA 1NG7A 3FHNA 3Q0WA 3PSFA 3LSRA 3CLOA 4LK0F 2VLAA 2WPWA 3IU2A 3KZWA 4Z65A 3ZMTA 4OLLA 1MIJA 2W85A 4MNUA 1J09A 1A6IA 1G8XA 2XHKA 1OVOA 4IHMA 4EJWA 1TBXA 1IOIA 1WTJA 2WGCA 2ZEPA 2BEIA 3PP9A 4KSIA 2ZPAA 1PDNC 4NCZA 2GA2A 4UUVA 4I7HA 4ZDOA 1NTCA 3WR7A 4HSTA 4FAIA 2GZWA 4HF0A 4OOIA 2V1XA 1KUXA 3TMOA 4ENMA 1K7UA 2E2JJ 2DPTA 4ZZLA 1JJ6C 4NGMA 2A6EF 2AFWA 5C4XJ 2DTZA 1FJLA 3CDIA 4AIDA 1TL8A 1ULMA 3OOPA 1B8IB 3ISZA 4XOPA 1WH5A 1S72I 1OCRH 1R4MB 1FT7A 3SJMA 1BPNA 3PQKA 4CAFA 3WTZA 4CSWA 2VC0A 3H9JA 5FLXZ 1W36D 2EFNA 1S20A 2PIZA 4DZJA 2KISA 1SVMA 4XKWA 5LEJA 5D29A 4AG9A 3WGGA 3LSTA 3QOPA 5IP7J 2IS4A 5KCMA 3S6GA 2PJAA 1OCZH 1OMIA 2JTVA 1D8JA 3D2PA 4A95A 3ULQB 4QPQA 3A4CA 2VE9A 2ISZA 3G71I 2UVOA 1WPKA 2JN6A 2Q4YA 4E7IA 1A6QA 1Z77A 2DU9A 2D2WA 1S60A 3BR3A 4AIKA 4CAEA 1WFXA 5JVTA 2X0LA 2FT0A 2GOMA 1TQMA 4OP4A 1XE4A 2IP2A 1RR7A 2Q1ZB 4KIBA 3K7AJ 4BS9A 1T98A 1YI2I 2CIJA 3IGRA 4TWEA 2QBYA 1XDSA 5EG0A 2CU7A 4B10A 1YTYA 2ISYA 4RGRA 2DB6A 2KL4A 4D1QA 3H5RA 4IOCF 1U5TA 2CS3A 3HZJA 4R7MA 3FMCA 3C7JA 3GYHX 1JT0A 5LRJA 1FNOA 5THWA 4ZYHA 2Q8KA 2EIKH 5D8KB 1S5KA 3ML6A 1BUSA 4I02A 3L7WA 4CCMA 4IZZA 2OU2A 1FYKA 2K4BA 1IYLA 1MKMA 2A3SA 4MRIA 4C2YA 1YW7A 1WRJA 2QSFX 2V1UA 1T08B 2XGDA 4IRIA 1HSJA 3V7RA 1Y8RB 4M6XA 2W48A 3OYDA 4YFJA 3N7ZA 2FBHA 1XA6A 2L8EA 3WTXC 4MJ8A 2Z2SB 1BPMA 2EK9A 3GIUA 1BMOA 3HYIA 3L2VA 2ODFA 4G6DA 1KUYA 2PJ2A 3U2RA 3P2FA 3VYUB 4A3LJ 4A5MA 1OKRA 2X4HA 1VQNI 2KCWA 3H3UA 4B5PB 4WCGA 4QUSA 2H8WA 2HNHA 5H2FC 4HPQA 3PBEA 2J8NA 1UG0A 3AG4H 4AMLA 1HDDC 3WC7A 4KMUX 4CYCB 1YIJI 3ZJ0A 4C2UA 5IV0A 4M3EA 5EEGA 3RKQA 2NU4I 1SFKA 1PCEA 1KBFA 2HDWA 3SHFA 4CA0A 3RZDJ 4KLWA 3K4KA 1IU8A 4ENJA 1MBFA 4IRGA 4XLFA 2DA4A 5H84A 2ZBKA 2ZEMA 3KL9A 1OZPA 2CO5A 1JGSA 4FETA 1ON1A 1OCTC 1I39A 3R9GA 1UAAA 2Y30A 1TKHA 1ZAOA 1K4TA 4O23A 2HZDA 3Q9SA 1FTZA 1CT2I 1YE9A 1HSTA 5KTAA 1B59A 1WVRA 1FOXA 1TQIA 4UXHA 1WWZA 1ZKGA 2HOEA 3F6OA 4MIMA 5E3OA 2Q43A 2GIZA 5F64A 5FUYA 2CWEA 4UEFA 2IA1A 1KZHA 2X6WA 1DU6A 5D6FA 2Q44A 1HXDA 2PC1A 3IAS2 5AG7A 3ROUA 5D5WB 1SQHA 3KHZA 3SYTA 4R76A 3PO2J 4HBLA 4ZTJA 4A3MJ 1WJBA 5CJ9A 2ORVA 2OVOA 2FSWA 1D8KA 1FTTA 2VRWB 2Z16A 2WPXA 1LE8B 1HBXG 2R98A 2DMQA 3IH2A 1S7KA 4P44A 4LD5A 3EO4A 4J00A 1SEUA 2R7DA 2R8VA 1RUOA 2F48A 2DKVA 4LB6B 3JSPA 3TKYA 3LSMA 4L9VA 1V55H 2C27A 2MSYA 1T33A 3HRMA 5E3LA 2R7TA 2V6CA 4G7ZF 4MCQA 3GUXA 2PI0A 3QPTA 3BP8A 5HODA 3I0TA 2BHYA 3S14J 4HDUA 3R95A 5FJ8J 4KVME 4H2KA 4UCMA 4UV9A 3D1NI 5DWMA 5ISVA 1XMXA 3FEDA 1QQIA 1LRZA 2IPQX 2ZO4A 5F6FA 3PNTA 1IXRC 4XQFA 1J75A 2OH1A 4UB8C 2F8HA 4CYDA 1CQTA 2PJ4A 4OC4A 3KLOA 3CCJI 3CJNA 5JLWA 1TIQA 1RFHA 4XRFA 4ZZDA 4HF2A 1GLNA 2FE7A 1ZGWA 3OIOA 4P10A 2DXIA 3OL3A 4UWJA 5G20A 1YJ9I 1TTYA 5G22A 1XGSA 2GE3A 4R1HA 3OL4A 1Y8QB 3PZJA 5DV5A 2WAQN 3CZXA 3G2BA 4BGDA 5FGMA 2DFHA 4CGPA 2E36A 2ZJ2A 4AIHA 2V79A 3P2HA 3IWWA 2VN2A 2P6AC 1FBSA 3HPGA 2BY3A 2G0BA 4C9YA 3TEDA 1OCOH 4ZC3A 2XROA 1I6HJ 3L2RA 2MLKA 4RS8A 3F8MA 2YPRA 3HB9A 3IRQA 4HNTA 2VXDA 3DV8A 1G6NA 2E1OA 3B73A 3HGGA 1GUUA 1V54H 3S17J 5DDGA 2Z5UA 2ECCA 4N0BA 1BC7C 2JW6A 2OD1A 4AVAA 4GYIA 2GXGA 1UHMA 3DBRB 5B1AH 4C2MJ 4UNOA 2Y0SN 1JTXA 3GFLA 3T8TA 1KGSA 4IHWA 1IG7A 2GBYA 3FBUA 2UUZA 4AC0A 2F5VA 2KZVA 3IFEA 3FF3A 1S7EA 3SI0A 4ON0A 3WG9A 4CUGA 2IA2A 1QZZA 2QZ8A 2R0QC 2EUIA 1BLLE 3HRTA 1P4XA 3FMRA 2L7XA 3PFEA 2WZNA 2CW8A 4W97A 2NNYA 1X19A 3ASNH 3SZTA 1LR9A 3CXQA 3B4VC 3R0JA 5K7HA 1Y0RA 2I00A 3PM1A 1HDQA 5J1QA 2CUZA 2B0UC 1V3FA 1XSVA 3C3WA 2FUG2 3DPUA 3S9LA 3OYBA 5JM6A 3DQVC 1LVAA 3TJQA 3ZGKA 2WTEA 1PTQA 3EDPA 2LVSA 3W91A 3CO7C 4PFPA 1MMAA 3WGHA 2OF7A 1AU7A 3CESA 3LOCA 4OWRB 1LANA 1U0JA 2PBIA 3PB9X 4DQ2A 2OZ6A 1YX5A 1YW9A 3P9IA 4PSXA 3D3SA 4KOVA 2ENZA 5EDNA 2YX7A 3CMEI 1X4SA 3F8KA 1JGGA 1XFOA 2OR4A 4PXEA 3RZAA 3SEKC 1D1BA 2JZYA 4DJLA 3B6AA 1A5JA 1T0FA 5E17F 2NYQA 4HNXB 2HC9A 3TO7A 1CE3A 2EVNA 4IX7A 4YFXF 1I12A 1W5SA 2PFBA 3DEUA 3NAUA 4KIFA 3FRMA 4FE4A 2L7KA 4XKCA 2W25A 4HPSA 4ONUA 4Q36A 3T5XA 4CYPA 4I98B 2EFQA 2CQKA 3S3MA 5G1ZA 2NS8A 2OCCH 2IVMA 1F9NA 1S6LA 1MBGA 3PFYA 1O3QA 4BY7J 1BBYA 2M0MA 4HRIA 1CPXA 3NARA 4JX4A 3Q9VA 2CQXA 4EJVA 2BV6A 1P9QC 4NC8A 1I1GA 1IRGA 4A3JJ 4JWPA 1SFEA 1I1DA 2HTJA 3I59B 1T8IA 1AKHA 4CGNA 1HF0A 2I5UA 4OAEA 2YNCA 1R00A 2HWVA 3RPUD 1F43A 4F91B 3IL2A 3HOSA 1JHFA 2PVWA 4H4KC 2EB7A 4MO7A 2D4OA 1ETVA 2IJLA 3DSBA 2MFZA 3FXLA 2B4DB 3NH4A 1HQCA 4CO8A 4XK4A 1ZHFA 2FEZA 3M9AA 3FEEA 1XC5A 3V8LA 3LSKA 4B43A 2HUZA 5EMIA 4MFPA 1CGII 4MHDA 5D8LB 2Q2EB 4MHPA 4JX5A 4KT5C 1W0UA 2LF8A 1Z6TA 5F27A 2PJ5A 4IK2A 3CUQC 4FX0A 2A61A 5K8OA 2KJCA 3B3SA 2IW5A 2DFEA 5HQ8A 3W2WA 1R57A 3TC8A 2KMPA 5KTDA 3ZMSA 3BJ8A 1HCRA 1EA3A 3L00A 3ZQIA 3CP8A 4QVTA 1YS6A 4XORA 4AB7A 5J3LA 3OYEA 3F8NA 3D68A 5E18F 3KHXA 2OBPA 1EF4A 2ZXIA 2DLLA 3DKXA 3N05A 2RGVA 3IC7A 1IY5A 3GB0A 5L3DA 3V7CA 5LYLA 5L3FA 1R43A 2QLZA 3CCSI 1LE8A 2JUGA 2J8MA 1ZRFA 4OC0A 5LGUA 3WABA 5M5YJ 1ZH5A 1QSMA 4XIDA 1W0TA 2UV1A 2HOAA 3SXNA 5J1UA 4ONWA 3WGIA 3L1PA 2H8RA 2NVTJ 4QB9A 4BH9A 5E3MA 1W7PB 2DA1A 2ZCWA 2E5RA 2E34A 3DF8A 2UZ3A 2F4OB 2EWBA 3QP6A 5F47A 3OYNA 2FMLA 1QMUA 2MYSA 3BZCA 4ZTFA 1FSHA 1RKTA 4U7BA 3HDDA 2MLGA 3VOEA 1CGPA 5F46A 3G3SA 4EV0A 1XX5A 1K4SA 2M8GX 4GRIA 4CRZB 1BR4A 3K10A 1H0MA 4QPOA 1B72B 2DIPA 4U9YA 3RTRA 5ILUA 1CP7A 1LDJA 3KP2A 1EKEA 3I9SA 4C3JJ 2YNCC 3K4BA 1AYEA 2PJ0A 1XBTA 3G1MA 4IPAA 4XKBA 1VQPI 4EJTA 2VI7A 4PXCA 3JRHA 5CNPA 4MQ9F 3KP6A 4A37A 1VQOI 4P5OA 1Y7EA 3K4NA 2VJ4A 4FD7A 2M8EA 1BW6A 3PB4X 1SGEI 5IP6A 4A39A 5I0CA 1S7AA 3T8RA 3GTLJ 1FP2A 1IV6A 4RGXA 4JK1X 2VKEA 3ZP5A 1KBEA 4KOTA 1ZO0A 4BMHA 1YVKA 2V8GA 2X1EA 3KP7A 5J1RA 1I5ZA 4FD6A 4LX9A 1W4RA 3K1PA 4XBFA 1X3ZB 4AIJA 3HL2A 1PUFB 3ZZIA 1ORKA 3TDZC 3PUFA 1XIXA 2KZGA 2JEVA 2VEZA 4NGNA 2DBBA 3KP3A 2VJIA 4AVPA 3S3OA 3AG3H 1CPSA 4I0BA 1W5TA 1YO5C 3OXFA 3SDBA 3FK7A 2L02A 5LBQA 1RIOH 2BUSA 2P4WA 3D0SA 2BE5F 2WBMA 2EIMH 4BEHB 2RFHA 2ID6A 3HXLA 4UVCA 4WXDA 2J5OA 4EM2A 1SMTA 1N77A 5AG6A 4UB6C 3QRFF 2MH2A 2F5IA 4B8XA 4ZH4F 2XVCA 3ZQQA 2R7FA 3J81Z 2XAFA 4ENNA 1SAUA 4CGZA 1Y6IA 4LG3A 1JI8A 1WH7A 1XJOA 2TDXA 2V1CC 1U6GA 2VT3A 2R7XA 2NVUB 2BY1A 4C7HA 5K1YA 4A0YA 1FIAA 1ARMA 2AFMA 4G12A 1XN7A 4Y3OA 4UIBA 2E73A 4XNFA 1SFXA 2EV5A 3BC8A 4RI1A 3FECA 2IGKA 3TO6A 2E2HJ 3GW2A 4NC6A 1OYWA 4EFDA 5IY5H 5K7ZA 2LP0A 5D5XB 3P5JA 4M6YA 6CPAA 1BM9A 2GIVA 4XLHA 3UR3C 1EH7A 2V4JC 5J8FA 3J7AO 1VHEA 4WWVA 1P9GA 1KQ0A 4HQMA 5E1WA 4NGRA 4PJMA 1MK4A 3ZQ7A 5HLTA 1E17A 1XBUA 1R5ID 4KSFA 4E1PA 9ANTA 4RAFA 3RBUA 3G6EI 3J7AY 1LOKA 2PIYA 4ASNA 1MD0A 2BOAA 2G9WA 2CJSC 1SD5A 2CMPA 4A32A 3A0HC 4G1PA 5ICGA 1P0HA 3E7LA 3KEYA 1NMTA 3IEHA 4F0YA 5K8MA 2LBFA 3WU1B 1JE8A 4U0WA 2L7MP 3COAC 2UWMA 5JLXA 2PJ1A 4FQGA 3REOA 4YFKF 3I55I 1BL0A 1KQ8A 3N97A 2X6OA 4DYCA 4NFRA 4CGMA 4RLFA 2CQNA 2WWYA 1Y1BA 3PB8X 2YR2A 2M0CA 4GFBA 1DQUA 1UFMA 2DT5A 2LY9A 3SI2A 5FUXA 4F8ZA 3GTOJ 3KLNA 2N8GA 3LD2A 1F36A 1BR2A 1VHSA 3CDXA 5JHWC 2VQYA 3UY5A 3DPLC 3AAFA 4M85A 2LK2A 2JWTA 5AIPA 3ASOH 2W82A 4GYGA 2P5LC 5IT9Z 2VBZA 2QVPA 1WJDA 1OYIA 1XMBA 4A24A 4BBSJ 3L2QA 1X2MA 3QYBA 2VI6A 3WTWC 1O3TA 2GLOA 5M5WJ 2EA4A 4RB2C 2ME6A 4WF2A 5GAEJ 1TWCJ 2K27A 3FSXA 2QYOA 2GM4A 4B1RA 4CH7A 4U0YA 4AWXB 1AHDP 3H92A 2EINH 3GTMJ 1Y0YA 5EGOA 2RNGA 4L9JA 5E8IA 4XRMA 3D5RC 5EJCA 4B11A 2NS7A 1D0XA 2FNFX 2EBJA 3CF5F 2KDOA 2ZXJA 1BOAA 3DWLE 1E3OC 3VH9A 2H1KA 3IIBA 2DO7A 1XMAA 5GCNA 1KU3A 4OMZA 4BAYA 2AFXA 4PV6A 1VTNC 3SHPA 1SMYF 3TO9A 4XOTA 5C88A 1ETWA 1GXPA 5FB2A 4ABZA 2YSRA 3GLLA 1YLFA 3PO3J 4BINA 2XPUA 3S93A 7CPAA 5CQGA 1O4XA 3PIPF 2A5WA 1LJ9A 3PBBA 1Z9UA 2CW7A 3VB2A 1TBOA 1Z8LA 4CZCA 2K9NA 3FMQA 2ENNA 4ZY1A 3QTLD 4UXNA 2RN7A 3FMSA 3H5NA 1ZG9A 3GTJJ 5ERIA 1Q1VA 2CY2A 4YGOA 2V9PA 5DCFA 2K5TA 4UFXA 2KP6A 2NVYJ 3ZQHA 3QQAA 2PR8A 3DBHB 1R0RI 3ABKH 5HNFA 1JUMA 4KUMA 2PRQA 1B87A 2LNBA 2CXAA 4R3KA 4UEZA 1MMNA 2IJZA 4HA8A 3Q0VA 5LD2C 4MFEA 4A30A 2ZEDA 1RI7A 3H36A 3ZQCA 1QNTA 3R60A 3TGNA 3BR2A 5H20A 1CG2A 1Y0NA 1HW2A 3CP2A 4Q5SF 4UUSA 2HQ5A 1S7FA 4FD5A 1ETXA 1ULYA 2C6PA 5KVRA 3OYFA 1Y7RA 2XEGA 1G3YA 4R87A 3JRBA 3FKIJ 2HFHA 3W6VA 2VBQA 2Z3NA 1YIOA 3NRVA 5DCMB 1QA6A 2Y9YA 2JYYA 4GM5A 3S6KA 4OAYA 6PAXA 2VPLA 3KEQA 1X2NA 3IU1A 4NF1A 2E1NA 4NGTA 2P8TA 5F48A 3EUHC 4QIWN 2PJRA 4I09A 2NVXJ 1Z21A 3DKWA 5GTHC 1A31A 1CBXA 4KOSA 5ICCA 1T39A 3FIWA 1MMSA 3HHHA 4A33A 3IH4A 4X8IA 4L5EA 1B1BA 2PG4A 3E5XA 3B3WA 1K7VA 4G7OF 4IJAA 1T95A 2MW8A 2B58A 3WTVC 2LH9A 4GGGA 3ZOBA 1R3NA 3CCUI 4MFDA 3LFKA 1IW7F 4OIRF 1MDMA 1JKQC 4LJZF 2QCOA 2NYXA 4CZZA 1AUGA 1IDYA 1STZA 1ITYA 4G6QA 1M8BA 2HQRA 5J8CA 2AFUA 3JRAA 2NOJB 4CCNA 3DKYA 3AG2H 3SQNA 1VQ9I 5DS9A 1ETOA 2JQ7A 5HVQC 1VQMI 1TW2A 2M34A 4KISA 2ZJPF 3QWPA 1M4IA 1Q2DA 3BHXA 2KIUA 1LFBA 3DPTA 2Y9ZA 1YHQI 2SGPI 1AMPA 1QSOA 2XGXA 4XLEA 5H6RA 4ZYDA 2CV2A 4UY8I 3R9EA 1HDLA 2JZMA 5LYIA 1TNTA 3AG1H 3OXLA 5K8PA 3KETA 4OVOA 1MT1A 5E1XA 2NVQJ 2LOOA 1UWYA 1AWCA 2X9DA 1MSFC 4MY3A 1TW3A 2M45A 4Y4RA 3T8WA 1OMTA 3TX8A 2QQEA 3WU2C 2CWHA 4M71A 4MFJA 2OCEA 3IRRA 2E7XA 4P1WA 3RDIA 3FVLA 2ECBA 4S05A 1SVLA 2XB0X 3DLAA 4Y49C 2CQ7A 2WY8Q 1Z2IA 2DN0A 3QYEA 2KIQA 3IKVA 2FQ4A 4UIAA 2J5PA 4FTHA 1BW5A 5FVJA 2L4AA 2ZW5A 2XSJC 4NEXA 2K9MA 1LEAA 4P45A 1E3HA 2LRDA 1WI9A 1VNDA 2ZOFA 2CUFA 1SGRI 4A5NA 3EETA 3GOXA 5BS6A 1ZLHA 1ETKA 2VASA 2KIFA 3MFKA 1BJAA 2AS5F 3OVOA 2GU2A 5KNLA 1MH4A 3I58A 3QPLA 2QQDA 1Q1HA 4LB5A 4R6TA 3S8PA 2DPSA 1I50J 2R1IA 2V77A 2SGFI 1U8RA 3D7HA 3I5UA 3K9UA 2ZOGA 3J80Z 1Y0UA 2A6HF 1GHEA 2CWFA 2XC7A 2GLJA 5H86A 4XLPF 3CJTB 3HIFA 5M5XJ 1M4GA 3JRGA 5IPAA 2QECA 2CTBA 1Y9WA 3RU0A 5GPAA 4KZTA 1LDDA 1TT5B 1AOYA 1Z4RA 2DMNA 3CUQB 4HG2A 1DUXC 2WV1A 3KE2A 4UUSB 1TURA 1S8NA 2STTA 4NQWB 4XNHB 1R1TA 1PYVA 2GLFA 4NDLA 3I4MJ 4GXOA 5IYCJ 1E2XA 2BYVE 5ICFA 4KOWA 4OC5A 3K69A 1H9TA 4UXJA 2B3VA 1RETA 3JAMZ 4PGHA 1ZG5A 3NH5A 5CPRB 3SJEA 4L9NA 1ZYRF 1JQGA 1JUSA 1SAXA 3KY9A 5CPAA 2C1CA 1D0YA 4L8AA 1SGYI 3CMAI 1KYWA 3S1NJ 1O3RA 1CJWA 1LCPA 3BTLA 3OS1A 4MHYA 5JPHA 2CYYA 3SEQA 3JRDA 4EVYA 1W3SA 5FRMA 2LF7A 3BR6A 1QPMA 3PEIA 1S29A 4I76A 3RIRA 1UHAA 2OJED 2RREA 4UUTA 1YK3A 4D9JA 2DOAA 2KMQA 5DEQA 2ICWG 3K2AA 2FF4A 2VL8A 2PSWA 1FSEA 4HX8A 2VQHA 2CJJA 2L9NA 2F5EA 3L2WA 3GX4X 1SGNI 4M6VA 2IA0A 3V42A 4WX9A 3D7FA 4CYOA 2PLYA 2FRHA 5C4JJ 3HOTA 1K78A 1B9MA 8CPAA 2ELIA 3WHCA 3S6FA 3BI1A 3IKTA 1NXUA 4XPDC 3F3XA 2NSMA 3OS2A 1O57A 2QQ0A 4ZJZA 1FYMA 1XCVA 2FU4A 2HVSA 1WI3A 2PMZA 3CDHA 3BJOA 3ZQGA 2OQRA 4HAMA 3CDLA 2O9LA 1XRYA 4II9A 3BLNA 4ZY2A 1MH3A 2ZFWA 4M6HA 1WSUA 3VDUA 1DGWY 1TXRA 2CW0F 1V4RA 2KMRA 2WV0A 2EK5A 1C0WA 1DPRA 3CCVI 1PTRA 4RN7A 2VBWA 3SFZA 3TFYA 3GYAA 3V8JA 4A3GJ 3WTYC 1PJRA 3CXLA 4AU7A 2CV1A 3FSYA 2H94A 2BVMA 2X6YA 5J47A 3RCOA 2GQQA 2YGWA 3HEFA 2FL4A 3HG9A 3R61A 4KS9A 2M5XA 2DMPA 2WAQA 1BIAA 2GWRA 1U5TC 1YOVB 5HDKA 3KYLA 2JXDA 1Y1CA 2ZW7A 2LEOA 3A02A 1M4LA 5ILVA 5JI6A 2HOSA 2VJJA 4CYCA 2N17A 1I6XA 2DK8A 1D5VA 4MEYF 2VB6A 3IO1A 3GTKJ 1K79A 4KMFA 2NRAC 1SD4A 1FBUA 4BQOA 2O61A 2DQLA 1FARA 5JQ4A 2HU9A 3NE7A 5KTCA 3LMMA 1LAMA 3A9LA 4I0AA 2EV0A 3M8JA 5CVUA 5TJJA 2K86A 2E5NA 4F92B 2P81A 1DP7P 3BJIA 3V8KA 5C82A 1YW8A 3H8FA 3BG9A 4IL6C 1KYZA 2HTSA 4BEHA 1G2HA 3GBGA 3HHGA 4XLAA 5E3QA 1ON2A 5HLIA 1FOKA 4N4NB 1NSAA 4ZDLA 1QSNA 5EC4A 4BJ5C 2DW4A 4PJ0C 2HYGD 2XUBA 5IYBJ 3CLQA 3CO6C 2A20A 4FCYA 3CXPA 2DOEA 1HLVA 5M3FJ 2R7HA 4C3HJ 4KNYA 2B7EA 3DEWA 4P6YA 3KZIC 4MMOA 5G21A 1XB4A 3UGLA 1ZTRA 4NHJA 5D5UB 2JK3A 3CC7I 3B02A 1R71A 4JP0A 3U1KA 1FPQA 3C18A 1YREA 3GLXA 1FY7A 2R7ZJ 3NH8A 4YG2F 4KUBA 1FBQA 2CF4A 3FK6A 5GTIC 1S3ZA 4PDKA 1TWGJ 4Z6YA 3ZMVA 2CRGA 2LLKA 3GZNB 4M9SA 3W2VA 3X2QH 2LMDA 5DWNA 1P2FA 2ZEHA 1V5GA 3FBIB 5KAIC 1WK4A 3MRUA 3D5LA 4DYOA 4IQ4A 1LB2A 1CHOI 1IAWA 2C6GA 1F1ZA 3F72A 3KR4A 2ZNZA 3CCYA 2ACJA 2P6FA 4Q38A 2Y31A 2E1MB 4X6AJ 4JZ0A 4KOXA 1RUNA 1B6AA 2DYSH 2O5RA 1YRNA 4GDFA 1MMDA 1OISA 2V1NA 5TRDA 1SC7A 3DTEA 4Q48A 4OAZA 3GVAA 1YGHA 1R5HA 3S2HJ 4EQQA 5CBMA 1TF9A 2SGEI 1X3UA 2RNJA 1RRJA 3KGQA 2LKSA 4HNVA 5HVFA 1QGPA 4MGRA 2LREA 1ZGAA 1B8IA 4BNCA 1H8AC 1SD6A 1OMUA 3QPHA 2Z9OA 3OYKA 2JA5J 2CG4A 2ZJRF 4HYEA 5CCMA 1MMGA 3FBNB 2ROWA 2DQRA 1KONA 2HS5A 4RLQA 1B6BA 1DTDA 3DDDA 2BY2A 4IUSA 4K30A 2AQFA 2XSDC 1VZ0A 4P9FA 5J4YA 3FWEA 2POKA 2HYFA 4CCKA 1HW5A 3GFMA 5A2QK 2PDOA 4P9UA 5CVRA 4DW6A 3R9FA 1Q9BA 1QZEA 2TRTA 1ZGJA 2OTJI 1EV7A 3K6GA 3OWCA 4BE2A 1ZRCA 4A38A 4XLNF 2WADA 1OBRA 4CAXA 1LFWA 3MKLA 3FF5A 4G8XA 4KT6A 4MLOA 4D7MA 4HX4A 4AUXA 5IP9J 1Z8XA 2JBKA 3A01A 1M4DA 2PJBA 2CGPA 2V6EA 2REFA 5HMNA 4AVZA 1YG2A 2COBA 4LQGA 5F1RA 1OR7C 4UEEA 1L0CA 3OOUA 3TOBA 1OQYA 2HB6A 3I3GA 4L0ZB 5CLSA 2D1HA 2LDUA 2X85A 5E8GA 2G3AA 1A36A 1ARLA 3E1SA 4M3BA 3HOZJ 3HOYJ 3I71A 3MD2A 4RA2A 2B63J 3DR8A 2KLOA 5GAGJ 1WJ5A 5B66C 1VQ6I 2R5YB 1U3EM 1UUCA 3BQYA 3MEXA 4CYNA 2V1DA 1ONVA 2TCTA 3DXJF 3K2ZA 2KFDA 1OJLA 5IT3A 2PJ6A 4Y15A 3PGPA 1Z9CA 3VODA 4X1EA 1WKXA 1UELB 1ETYA 1ZG8A 3BJ7A 3OSFA 4XPKA 1J9IA 2WY7Q 5F49A 5I4MA 1CT0I 2V8HA 2RVCA 2QA4I 1GVDA 3VYRB 4MPIA 4MTDA 2HXOA 4M3SA 1UHSA 2R7OA 1PUAA 1A2ZA 4LIUA 1UVFA 2NU3I 3E2IA 2OV7A 3ECHA 3LWFA 1X58A 2FQ3A 3MKWB 1YMEA 5BNGA 4E1RA 2C6YA 2W57A 4BQAA 1AA7A 4XONA 3O2PE 1Z2LA 5HVGA 2JSCA 1U5KA 4EATA 3ESWB 3B6CA 3QOEA 1QRYA 3M8FA 4E7SA 4IO9F 2DJNA 4IHVA 1KA8A 2K9HA 2QQCA 4C2XA 2PMZN 3FXRA 3PB6X 1FIPA 5HDGA 2BL1A 3LMSA 2IGNA 4L5IA 2DYRH 4B48A 4LITA 2REEA 4PXBA 3CJRB 4BY1J 1XEBA 1XGMA 1P92A 3NFZA 4BHBA 4E4HA 4P4DA 2EO8A 2H6CA 2M7BA 3DFGA 4O3MA 3MZHA 2VONA 2VL1A 4FISA 1QHHD 1IO2A 4R9MA 4DYQA 1ACIA 3OWTA 2L0KA 2AQEA 4H6ZA 5ED4A 4MHGA 1O3SA 2BCOA 3HC7A 3ZXSA 3K4CA 1RC9A 4P55A 2ANPA 3E0KA 4IAVA 5FLVA 2A6TA 1E3PA 3GLJA 2I8DA 2V1CA 2XKPA 3FB3A 4DYRA 5CYVA 4RB1A 4SGBI 1HKTA 2VQCA 4UXIA 2V8VA 2YUUA 4OKOA 3VWDA 4IEJA 3QAHA 3J7ZI 2FBKA 3MCZA 2JT1A 1LVKA 1L3LA 2R93J 2XAGA 4R79A 3BPVA 3PNYA 3BJAA 2QPOA 3SGBI 3JTHA 3S9NA 3Q0UA 5EG0B 2PMUA 3MN2A 2XEJA 4EMEA 3EC4A 3TCVA 2XRNA 5IB0A 2R7WA 3CCRI 3ERMA 3FXUA 3N4MA 2WAEA 3TL4X 1U78A 2FNAA 3NEUA 4BU2A 3RZOJ 3FKJA 3I4PA 1XS9A 2WC2A 5HI7A 3D7GA 3B3TA 1MJ9A 2XV4S 4B47A 4EGYA 4E8OA 1YSJA 1JJ8C 2L9VA 5ILSA 1YQEA 2VXKA 1OYVI 4RBOA 1WJCA 1Y1WJ 1D5YA 1P4AA 1I3QJ 1UHWA 1ZLJA 5E96A 4BJTA 2CUEA 2E71A 1TWFJ 2EPFA 4DNCA 3OS0A 4F9UA 3TW6A 2ZXWH 2WSAA 2OA4A 2L7ZA 4PK2A 3OYMA 2LYCA 1DE4C 2VBYA 3HPHA 2O8KA 2HDCA 3DP7A 1HKQA 2RC4A 1GVJA 3TQNA 4NC7A 2ORWA 2X52A 1UMQA 1ZQ3P 4UVBA 3HH2C 1IGBA 1MBKA 1FNNA 3K4MA 3KZYA 4RB0A 4P4FA 3S3NA 3S6HA 4AYBA 4YIFA 2UXXA 2XAJA 3L2CA 3OYGA 3GUDA 5JVGF 2VT2A 1B4AA 4RM2A 1BI2A 2YU3A 3K4JA 3ZQLA 2AXTC 4CXFA 5BPDA 2JLMA 2DA3A 3IH3A 2V9VA 4A94A 2FBIA 4Y33A 4YU9A 1IV8A 4HZFA 4PPZA 1VQ7I 3OL0A 2X1DA 3RKWA 4BHPA 2ZNYA 3H5ZA 5FFZA 1R9TJ 1G3SA 1X1DA 2Q0YA 4IQJA 2FX0A 4ESFA 3FHZA 5HH1A 3FJUA 2QQ8A 2LD5A 5D6EA 5LHGA 1IN8A 1GHCA 2DA7A 2A4NA 4U88A 3OYIA 2ZMEA 2KDZA 4BQQA 2XPWA 3FYNA 3SJFA 1OFCX 2QM3A 5LRRA 1YQAA 1IY6A 3ZN0A 2M4GA 3D2MA 2Y69H 4X3RA 3LACA 3W6XA 1DU0A 1U9OA 1CSOI 1DP3A 2ZENA 1M1DA 1IJWC 2AHQA 1HEVA 2DI3A 4JBAA 1J5YA 3NWTA 3KEOA 4AD9A 1Q2CA 2BW3A 3OMYA 1RO5A 1T2KA 3OXGA 4L9MA 2K9LA 4MFQA 4C68A 2PVVA 1FC3A 2Z11A 1V5FA 2F4IA 2R7UA 2QKMB 5F08A 4HGUA 1FYBA 4BUPA 3N5FA 4NJQA 3IP4B 1KQ9A 5LHIA 3HJEA 4ESJA 2P5VA 5E1ZB 4W1UA 3F23A 4I49A 1UVGA 5FO5A 3ISXA 2LSOA 2W4SA 3FXMA 2R4GA 2R7QA 2ZJQF 2E60A 3SJGA 1TOTA 4NGSA 3GXOA 3D7DA 2F3CI 2A05A 2R5ZB 4BBHA 4E7LA 5GAHJ 2KKOA 3RYRA 2Z3PA 2PJ8A 1X10A 4FE7A 5TGTA 2M2EA 4AVCA 1X1PA 3AKZA 2B9SA 2K02A 1XX6A 2A5YB 1CF7A 4U5YA 2LB7A 4XPDB 4ZYQA 4R8FA 1BN5A 2QKLB 3R6SA 1KU9A 2ZW6A 2BOLA 4L9TA 4Y13A 1DGRM 1TWHJ 2QENA 2EZHA 2X1CA 4BKXA 3UEYA 2QMLA 1LUJB 5DUIA 4OC1A 1POGA 2IS2A 1W7PD 3C2HA 2XB5A 2B8TA 5A27A 3IAM2 3KR5A 3IUOA 3SZGA 3SFIA 5JFRA 1LEBA 2EZKA 5DYMA 2PRBA 5AG4A 4IVNA 4UVAA 4EM1A 1JXSA 1FX7A 4LGWA 4XN0A 4E70A 2HOTA 3M4OJ 4BXFA 3K70D 1B72A 2WUUA 1TWAJ 2BVLA 5F09A 5HXDA 3M1CA 4UCPA 3A01B 1O7LA 1EH8A 4OIWA 1MNMC 4R3LA 2XKOA 4ZYAA 4BD9A 5JHUA 4AG7A 1YLEA 3TW7A 4XSZF 1U5TB 2HVQA 4RAGA 3VYTB 2NOGA 2N52A 2D4PA 4HNYB 1JWQA 3DU6A 2B5GB 1IRFA 3SDGA 3ZMUA 2JPCA 4Z2YA 4P96A 1FLIA 3DCFA 4KN7X 3F22A 3IWGA 1X12A 2C6CA 2I10A 1Z91A 2M87A 2EH3A 2JVHA 4HV6A 2ZEOA 2QGUA 3SJXA 3BG5A 3TDUC 4BXUA 4BE0A 2IXSA 2GXBA 1IICA 2IL4A 4M9XA 2G7HA 2VJ5A 4AVBA 3WE3A 1R23A 2Q04A 1SD7A 3R4KA 2ZMEB 1Z67A 2HYJA 3EPZA 1VQ5I 1N78A 1SGPI 2ABZA 5LYFA 1K78B 3FX6A 3EUKL 1FT9A 1H0ZA 2VQGA 1QZYA 1SANA 4S0HB 3JR9A 1CF7B 3F9KA 1VQKI 1Q7LA 4Q7AA 2K3PA 1YFHA 4NJRA 4AM3A 3UKGA 4LK1F 2MC3A 1NHAA 3V7ZA 4JCVE 2W84A 1TGSI 4ZYEA 1D0ZA 3KX2A 2P0WA 1QSTA 4CAVA 3BJ6A 1BA5A 4UFVA 4F6AA 1R1UA 4YFNF 4II3A 4PQAA 5KAFC 1FEXA 2K40A 4P4EA 3G3ZA 3PB7X 1IN5A 1LKXA 2ZC2A 1V1IA 1GV2A 3K70C 5GP9A 2STWA 4JXQA 4FBEA 2CNSA 3ZR8X 3E59A 2DFIA 4V19K 2D5VA 3L09A 4D7NA 3MKYB 2JSPA 1IRXA 2MABA 3BROA 3KZZA 4M9ZA 2GANA 3E6CC 5AGEA 2WVJA 2HEOA 2QQ9A 3H3VK 5DD8A 2Z3LA 2F2EA 4J19A 4F3QA 1MW7A 3TBIA 4B5OA 2ZEFA 4A69C 4CPAA 3E0JB 5B5EC 3T1BA 5FLXK 2DCEA 1QHGA 4KITB 1Z0XA 3VDPA 1ZG3A 3QNVA 3M07A 4OADA 1JT6A 3R5DA 3MAJA 1RR8C 2JA8J 1ZARA 2CQQA 3JCUC 1ZG1A 2GKTI 1IRZA 3HKZA 1H9GA 2RQQA 2VKHA 1X3WB 4RGSA 3VDXA 2WB1A 3EY5A 2JDDA 1YLOA 4ZGYB 1H8LA 1HDUA 3ZPLA 5IX3A 3R5AA 1VIXA 5EYRA 2XRCA 5E20A 4TV7A 1H88C 3MZYA 2XF7A 4IRHA 4QSHA 2GKRI 1SVOA 2DK5A 4XICA 3ZN1A 4CS0B 2EV6A 2QYVA 2F5FA 5F0FA 1WGXA 2ZB9A 3RSNA 1FOWA 3RKYA 2DDAA 1JKOC 4Y17A 2W7NA 4C2TA 1YX0A 2FNPA 3H0GJ 5LGTA 3WTUC 2Z1DA 3LQRA 1E0EA 5DAEA 5EX3A 3MGDA 3QB8A 3SXOA 3PUBA 2CUJA 2LFBA 1WGCA 4RGUA 2NS0A 3U1DA 1CM0A 2P6GA 2XGEA 3HOUJ 3BDDA 2ZSHB 3H8GA 5D8NA 4B3AA 4D5CA 4KVOE 2EA2A 4PFOA 4X0GA 5B3SH 2JVGA 2L7FP 1TBNA 1VGYA 2A69F 2KMOA 2MA3A 3ABUA 1USTA 4OU0A 2ARPF 2IBDA 2NU0I 1VKCA 4CGLA 1IN6A 3C26A 5HS8A 1Z5RA 4JJXA 2VBXA 4N9IA 2Q7SA 1LR8A 2PJ9A 1RESA 2H27A 4L0YB 3IJ3A 1TNSA 2KRCA 2RDPA 1TLHB 4IF5A 4MBUA 1U8BA 4A6EA 3FXKA 2K9QA 2VUMJ 3CCQI 1X74A 4JXRA 1RNLA 4MFZA 1P7IA 2PJ3A 1TT0A 2VKDA 4OINF 4M6IA 2LTPA 4UHTA 1TF8A 3ISPA 2P7CB 1PJUA 1A35A 3RJPA 3S1QJ 1W1WE 3BPXA 2H5MA 4XRSA 1Y1VJ 2Z10A 2P5KA 3F8CA 3QPSA 2GKVA 3KPHA 2V7FA 3H9QA 5F04A 1S7LA 1XSDA 4BYYA 1LAPA 3IC1A 4LQ6A 4FX4A 1K4JA 2LG4A 3V7SA 4DBRA 1KU2A 1R22A 4KFCA 2CNMA 1MNDA 2E1CA 1YVOA 1N75A 4KUAA 5EEAA 2BEOA 1BC8C 1SGQI 4BHCA 1F2OA 2ATRA 4I01A 5LRGA 4HX7A 2NU1I 4C3IJ 3WC5A 3GWZA 4NQWA 4ESBA 4II2A 3S2DJ 1FAQA 3KKWA 1BIBA 5C44J 2F4MB 2M7AA 2J9RA 1BR1A 2WAFA 5EEHA 2OZGA 4EGZA 3A03A 2O6GE 1GDTA 4XPLA 3H4QA 2BY0A 1R1VA 2AXLA 2V9KA 2ZW4A 4HKFA 2BW3B 5JR3A 5DTDA 3UEJA 1SGDI 4WXCA 3KYCB 4S04A 3JRIA 3QAYA 3OY9A 3GZ6A 2HR3A 2ESNA 2XIGA 3ZRGA 1QQ9A 3I59A 4F52A 4E7JA 1XMTA 2GREA 1FZPB 2WYRA 4R57A 3TP3A 4KICA 4PZJA 4E6KG 4HNUA 2JPBA 2R7VA 2DMTA 5CVVA 3BQZA 1Z7LA 2JA1A 2ZEEA 4A3DJ 4LLGF 4LFUA 2NXNB 4LIVA 2K85A 1W4MA 1M1EB 5TISC 3UGDA 2Z3MA 3RNZA 4PSWA 3VARA 5J4VA 4IHTA 2VKVA 5IT9K 3BZKA 3VWBA 2ESHA 3EXNA 1X4PA 4V2GA 3CC4I 3GTQJ 1Z3XA 3GCMA 2IRFG 5B1BH 1BOBA 4XRSG 1YW6A 1G3TA 1WZ2A 2LY1A 2M5WA 3JSOA 4B12A 2LY2A 4EWTA 2XEFA 1W36C 1TBRR 1RKWA 2FSRA 3GTGJ 2DODA 3EUAA 4RMNA 1X1AA 5J6XA 5F0HA 4EJUA 1N71A 5F0CA 1TQPA 2IGMA 3VYSB 4UBRA 4DUKA 3LAJA 5IOYA 4XR6A 4A0ZA 5F1JA 1DS3I 4GS4A 2DDBA 4A31A 1FP1D 2DFFA 4IHXA 2Q2EA 5DM6F 3J7YJ 3B35A 4LLLA 3F0AA 2FXAA 3GMEA 3HKZN 3NQOA 1HDPA 5A2QZ 2HKOA 1PCAA 3VEPA 2P6TA 1Z6RA 4M3DA 1QSRA 4LG0B 3DR6A 3HUVA 3JRFA 1QPIA 4NSQA 5CKTA 1SFOJ 3UGIA 2JEWA 5BWAB 3F8BA 2FOKA 3BCAA 2MH9A 4BE1A 4E7KA 1AKHB 1TKJA 3WODF 4IHYA 4IOAF 4E0AA 4I2OA 4B44A 4JLYA 3FH4A 2SGDI 1IW4A 3WTSC 3GY9A 3KFWX 3LODA 4CCLA 2CSOA 3KQZA 1IUFA 2ETHA 3GZ5A 4WJBA 2DA2A 2PQ8A 5JH9A 3G1OA 3WE2A 2QSHX 4UCNA 2DPUA 1Z3YA 4MEXF 1XD7A 1DS2I 4KVXA 4A3BJ 3B7IA 2AFZA 4A3CJ 4EVIA 2O0YA 4V2FA 1IXSB 3OV8A 1ZLKA 1U2WA 3BTJA 4PJLA 4OMYA 1V1HA 5BPIA 3T0YA 1TZLA 2H09A 1UZCA 4F7ZA 3EQLF 1T56A 5KK1A 3K1MA 5LEKA 3K2KA 3CPAA 4L5JA 4AXVA 5FKLA 3CTAA 2DAOA 5GPCA 2IS1A 3I54A 3OR2C 3AL0B 3D4UA 1S7NA 4P4BA 3DNSA 4XLCA 2EWNA 3P7NA 1YTPA 5EZHA 3W3CA 1PUEE 1HW1A 3HGYA 1G59A 1KWMA 5FROA 3PIOF 1ULKA 4B6ZA 4YRVA 4OMEA 2Z3YA 3HSFA 1R58A 1XGNA 3R0AA 4KDPA 3D67A 2ERWA 3CUOA 1LFUP 2VIXA 3EUHA 1IF1A 3BG6A 4ITVA 3BI0A 1PPFI 3RYPA 1MBJA 2E1MC 3MMYB 2JA7J 4IKFA 2M1BA 3M7GA 4YWYA 3WC6A 1Y8FA 5IOZA 5K5RA 1YU6C 3IWEA 4M74A 2M3AA 4C2ZA 3JREA 3SGQI 3B3VA 2E35A 3FM5A 3I4NJ 2VZYA 2PE3A 2DOFA 3OYJA 1A04A 3D00A 4M73A 1QO0D 2ELJA 3HTUA 5HVHA 3BG3A 3O8GA 3CD6I 1XF8A 4OIDA 2JDCA 1YJNI 4GO1A 3WTTC 3CJQB 4BJ6C 4OC3A 3BZ6A 3GEZA 1PUFA 2Z3KA 2E5ZA 5CVJA 1WHUA 2VE8A 5HLHA 4N4OB 2J8RA 2PJRB 4Y7NJ 3QYFA 4A3KJ 2JRMA 2NU2I 2KT0A 4Q47A 1FOYA 2P7VB 1I3AA 2Z99A 2B5GA 2J87A 4HNWB 4D0PA 4TNUA 2COMA 4MCPA 3PRTA 2XF6A 1VFCA 1QU3A 1XDUA 1EH6A 4F9VA 4BXXJ 2QQBA 1F2PA
chains in the Genus database with same CATH topology
3MQ0A 3CXSA 4U7DA 1IUYA 2FS5A 3JUWA 2FIAA 2HQYA 2QIRA 2FA5A 5LGNA 3O6BB 2DPDA 3FNCA 4OIOF 3E6BA 4RS2A 1IZ1A 3KP4A 1XSXA 3LAPA 4KOYA 4GCVA 3BOQA 1P4WA 2Z33A 2B4BA 5FFXA 3E97A 2GAUA 1WWXA 2RQPA 2E7WA 3BY6A 4O6JA 4E2AA 5L3BA 1V0CA 4KOUA 1UB9A 4A2UA 5L3CA 1MJAA 4MY0A 1ON0A 4IHSA 5FD6A 3F6VA 4J3GA 4UA3A 1NE9A 3R96A 2Q7BA 5HLGA 2XAHA 2OZUA 3TE4A 4HW0A 1G3WA 1IB1E 1K7AA 2HGCA 4XSXF 1F5TA 2H6BA 1IXCA 3P9CA 4LUAA 4U9ZA 4OIPF 1IN4A 4QC6A 5LLQA 3SZPA 1Y9KA 1DPUA 4UV8A 4PK3A 3G8WA 4JD6A 2B4DA 5D4RA 1MZBA 2CFXA 2HV2A 1PP8F 3Q5FA 3IWZA 2FCKA 3EFAA 2HZTA 3C1DA 3RI4A 2O03A 2OB0A 3TTHA 4KIGA 3E5UA 4QWQA 4JQFA 3PQJA 2OD5A 2GA1A 4LLNA 2KRFA 3RPUA 3U9GA 3ECOA 4L18B 1PU9A 3SXYA 1REPC 3FZVA 2M30A 5EBVA 5DD4A 3F8FA 3QP5A 2YNEA 2P6SA 2ADUA 5ICEA 4HQEA 2VC1A 5AIQA 4CDGA 3MWMA 1P6RA 4B14A 1B9NA 2A07F 4ENKA 5A28A 3GFIA 4A0XA 1ODDA 5K5OA 3F5BA 1JHHA 1Z4EA 2HKXA 1BI1A 1S7OA 4R8HA 4Y49B 4LG0A 2P6EA 2F5CA 1KU7A 4NXYA 1FWZA 2O3FA 4U0VA 2FXFA 3HSRA 2I79A 3J81K 5BMZA 1HKSA 2MD5A 4EM0B 1R5GA 1J4JA 2G3TA 1M44A 3ZMDA 1RZ4A 2PJPA 5DCMA 4M72A 4HOBA 2EJRA 1ZREA 3HRSA 2L01A 2CNTA 2VODA 3TOAA 4CGOA 2FIWA 2BGCA 3IWFA 4XNHC 3TT2A 2A68F 1W7PA 1BI3A 2G7UA 3M8EA 1SFUA 2NAZA 3LQQA 3QU6A 4A12A 3EYYA 5HS7A 2IT0A 5K5QA 4B13A 4MI4A 1R7JA 1BI0A 3R1KA 4L89A 4CHUA 1L0OC 1G4DA 4KN4X 2QQAA 1P4NA 1IN7A 2PN6A 3JVNA 4F0XA 2EFOA 2Y48A 2UZKA 4KSAA 2BUEA 3O3KA 4WK8F 2XASA 4HLXA 2LKPA 4PCQA 3JAMK