1MJAA

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esa1 protein
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjaA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjaA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjaA02
3G8WA 2FF4A 4QB9A 1I21A 4QBJA 1OZPA 5KTAA 3BJ6A 3M7GA 4K30A 3WTYC 4KOSA 1XEBA 1HSTA 4G7OF 4M72A 2Z0ZA 2FBIA 1LDDA 5HMNA 2LF8A 2OQGA 4QLCU 2EFPA 2IP2A 1ON2A 3I4PA 4M9SA 1PUEE 3S6FA 2B58A 2IJLA 4M74A 4IJAA 4MHGA 1MDMA 2R98A 2AJ6A 4Y49C 4PGHA 2JLMA 2O03A 4HX7A 3GWZA 4RB0A 1XSXA 1XMKA 4XLNF 4U7DA 3DR8A 1EH7A 1LDJA 4JK1X 1QSNA 1OYYA 2AE6A 2HYFA 4LK0F 4AD9A 2EFQA 2EFOA 5HS8A 2VC0A 1Q1HA 3DDDA 4OU0A 2L02A 3R95A 1S6LA 4E8OA 4OINF 2COMA 4RGXA 5BS6A 4QVTA 3LQQA 5F64A 4LG0A 1VHSA 3PQJA 1HQCA 1KA8A 4KOVA 1HXDA 4UNOA 1DPRA 5F49A 2QIRA 3GVAA 3PQKA 3LODA 4WWCA 1ZH5A 4AVAA 3U9GA 4KOTA 4MTDA 1P4AA 3R1KA 3M9AA 3WTXC 1UFMA 4Q5SF 3BROA 1LDKB 2H5MA 2FBHA 4MQ9F 1S60A 2F5IA 5H6RA 2MH2A 4IF4A 5K5OA 1BBYA 2NNYA 1YR0A 4KN4X 3B73A 4KIGA 3D8PA 1R00A 5JHUA 3J80K 2FRHA 3GEZA 3E5XA 2P6TA 3ZPLA 5F48A 4ESJA 1O3RA 4I02A 1S7KA 1JXSA 1HBXG 4UVAA 1YVKA 4L9JA 1R58A 1S3JA 2BSWA 3IWZA 2JDDA 3W91A 2K27A 2W24A 3I0TA 3E6CC 5JVTA 1USSA 5DUIA 4CS0B 1KQ8A 3VB2A 3WTTC 1RUNA 1S29A 3TFYA 2O28A 2XKPA 3HSEA 3I5UA 1AWCA 2QUFA 3WR7A 4P9FA 4CYDA 3QP6A 2TDXA 1Y9WA 5LGUA 4P5OA 3MAJA 1USTA 3QPTA 1IF1A 3HUGA 3HRUA 1FC3A 2DK8A 2ISYA 1R1VA 2EV5A 1J75A 1S7OA 5HLIA 3RPUA 2VZYA 2VBXA 4RB2C 2ZO4A 3IC7A 4HDUA 3HHGA 1BN5A 3R0JA 4G94A 4R87A 5LGNA 4LB5A 4ZYEA 3CDHA 2GA1A 1XMAA 4UHTA 3DFGA 2DAOA 1U3EM 1ODDA 4CDGA 1YYVA 4ZYGA 3V7SA 1ULYA 1GVJA 1NMTA 1IN7A 1K78A 2K7LA 4KIFA 1CF7B 3R96A 3TT2A 1D3YA 2DQRA 1T39A 5BQTA 4DQ2A 2VQYA 2HFHA 3WGHA 2QENA 2Q04A 5L3CA 3RTRA 2FXAA 1ZRDA 6PAXA 3D2MA 5HOOA 3COAC 1GXPA 3D0SA 3KP5A 1WK4A 4L5JA 5LEJA 3GZ6A 2VT3A 3KETA 3WTWC 1JGSA 4ESFA 2EK5A 1YW9A 3V7RA 3DSBA 2LDUA 3PP9A 3BP8A 3LAJA 3QU3A 3DP7A 5FFXA 1O7LA 1IXCA 4HOBA 4UA3A 1FLIA 4BMHA 4OAEA 3P7NA 2KIMA 2LF7A 4BHPA 3TDZC 1WKMA 4P55A 4PK2A 2Z3YA 1STZA 2EA2A 1B9NA 4IRGA 2ZW5A 1B9MA 4G8XA 1H0MA 1S7FA 2VONA 4R9MA 1FP1D 5KVRA 4XPKA 1IZ1A 3HSFA 3V4GA 1U8RA 5F6FA 3TQNA 2E7XA 1MJBA 1I6XA 3M8FA 2GE3A 4ORFA 1VKCA 3ZP5A 2JT1A 2PMHA 1D5VA 4NCZA 2HUZA 3KZYA 1WI9A 4AB7A 3GUDA 2YSRA 4B8XA 3W6JB 2PEXA 3MQ0A 4Y13A 5JPHA 1FT9A 2XUBA 2BL1A 1P4NA 1BOAA 2Q7BA 2OBPA 4KORA 1A04A 4CRZB 5L3EA 2L01A 4CGZA 1Y9KA 3C26A 1VTNC 3MWMA 1HKTA 3JAMZ 2EFNA 3E5QA 1K4JA 1FWZA 1UFHA 3L2CA 3HYIA 2DQLA 3BDDA 1XF8A 4ENKA 5KTCA 4M6YA 2IA1A 2V6CA 4QWQA 4XSZF 4QUSA 1T98A 2MLKA 4F6AA 4B5PB 2JDCA 3GFLA 3JTHA 4HLXA 4MNUA 2CY2A 2LKPA 3TGNA 2ISZA 2VZZA 4PSWA 1ZN2A 3BPXA 1PP8F 3TCVA 1BC8C 3M8EA 4I01A 2VEZA 1G3YA 1KUXA 4BAYA 1IXSB 2FS5A 4IVNA 1G3WA 2YR2A 4HF0A 3P2FA 1SD4A 2UZKA 1FNNA 1U5TC 4ZH4F 4MTEA 1UHWA 2LSOA 3F8BA 5E17F 2BBYA 1OR7A 2OZHA 1W5SA 2RQPA 4HLYA 4UWJA 2RNJA 3E3VA 2F5CA 3WTVC 3LD2A 2EJRA 2H6CA 2GZWA 1BI2A 1UCRA 2OZ6A 4N0BA 1EV7A 4KOUA 5D5VB 3WE2A 3E0KA 2PMUA 5IT9K 3NE7A 1Z6TA 1YVOA 4A0YA 1S5KA 2MA3A 2PSWA 2D45A 2IA0A 3CUQA 2BEIA 2RKHA 5EEGA 3MFKA 3Q5FA 1YS7A 1J9IA 3FYNA 5HLGA 5D5WB 1SMTA 5HH1A 4R1HA 4FHTA 2ZW6A 2DU9A 3KFWX 4S04A 4NHJA 4KVME 1P6RA 1R22A 5ILUA 2P0WA 5F46A 3QRFF 1FYKA 1QZYA 3DF8A 4EGZA 4ESBA 1MJ9A 4KN7X 5E1WA 2ZNZA 1TNTA 3SQNA 1O3TA 5CVIA 1R57A 4JQFA 1IIDA 3O3KA 1LRZA 3R9GA 5HDGA 4A6DA 1F4KA 4RB1A 4YFNF 2R8VA 2M5WA 1RUOA 3BPVA 1MD0A 1PUAA 1MDMB 3DPTA 4WXDA 4I09A 1Q2YA 2G3AA 1IN8A 4KOYA 4NQWA 4NXYA 3DEUA 1T38A 2M1BA 3SHPA 5TJJA 5CVRA 1XSDA 1S7LA 3KP7A 2K02A 1LEAA 4YFXF 5CLSA 4LFUA 1I1DA 3LWFA 2J8MA 2PR1A 4PGGA 4MQVA 2DXQA 1JHFA 1FSHA 3CJNA 4F0YA 4L9VA 3HIFA 2HQRA 4E0AA 4RGRA 3IL2A 3LA3A 2ACJA 2EFWA 2C27A 4XLPF 2A07F 4LG0B 4B5PA 5K5QA 5ILVA 1FZPB 1W7PB 3N97A 2HYGD 3EY5A 4RB3C 5IB0A 2O61A 2B3UA 2R1IA 1TIQA 4AIJA 5FVJA 4XNHC 2PC1A 4H6ZA 1J2XA 4Q48A 3ZMUA 1R1TA 4ENMA 1K6OA 1CJWA 4CZZA 2D2WA 1WSUA 5C88A 1M44A 2QQAA 3WGIA 3K1PA 5HDNA 4I49A 2MD5A 4MY0A 3B8GA 2ESHA 2PQ8A 1J59A 3KLOA 1QBJA 3FIXA 1SD6A 2VE8A 2QWWA 1RNLA 1IYKA 3HOSA 3V8LA 2NRAC 2QVOA 2X0LA 1OMIA 5EC4A 3K9UA 2X7BA 4M3SA 4IXAA 3DKWA 3HSRA 2Q4VA 3F72A 2FSRA 3JVNA 2A5YB 4D0PA 2B0LA 5E96A 4HF2A 3FXQA 4H6UA 3I54A 3I64A 2L3DA 3K9TA 1WWZA 1S7NA 2J8RA 3CO7C 4ZZDA 4MJ8A 2JRTA 5FB2A 5KK1A 3G73A 3FXRA 1ZHFA 2FA5A 5GCNA 4HNYB 4ZYDA 1RI7A 2ETHA 1REPC 5CVJA 1FY7A 2YU3A 2ZPAA 3F8CA 1Y7RA 3QOPA 2DPDA 2R3SA 3K2ZA 4IF5A 3KLNA 3VWEA 4A6EA 3EXNA 3WU0A 1I5ZA 4L89A 2ELHA 1ZAOA 5BPDA 2CWEA 3EYYA 5FLXK 2VOOA 3IKTA 3LFKA 4KLWA 2P6FA 2BUEA 3GO5A 2CNMA 3T9YA 1H9GA 4G9YA 4WXHA 2PBIA 3QPHA 2Q44A 4EJWA 1K78B 2DO7A 4KT5C 3L00A 1UB9A 1IXRC 5IX3A 3GXOA 2NS0A 4KA4A 3C7JA 3IKVA 1G6NA 3F8KA 5H20A 2FXFA 5BOXA 2ADUA 5LRSA 2Q2EA 2A68F 3CLOA 1KUYA 3BZ6A 1QO0D 5FFZA 2WWYA 2VT2A 4XPDC 1W7PA 3F23A 3ZMSA 2FIWA 2IL4A 2HKOA 3V8IA 3TO7A 3C18A 2CQKA 3R9FA 4II9A 4KDPA 1EH8A 4EJVA 5LEKA 2P6SA 4I0AA 2REEA 2H09A 4GO1A 3EUHA 3F0AA 1D8KA 3RIRA 2L4MA 2FNPA 5D4RA 3ELKA 2AS5F 1V0CA 3EETA 3KEQA 1CGPA 5A2QZ 1XIXA 1SAXA 4HX4A 1ZLJA 2DI3A 2GAUA 1FYLA 1YX0A 2G3TA 2QBYA 3HTSB 3LQRA 5L3GA 3IRRA 5K5RA 2XAJA 5AONA 4M71A 1YREA 2IA2A 1L3LA 4KYWA 4R8HA 1BOBA 3FXUA 1FPQA 3WTSC 2EA4A 2H27A 1R36A 1Z6RA 3UY5A 5D6FA 3W6KB 3DV8A 1KU2A 4PK3A 5TRDA 1XDUA 4L9NA 5DCFA 2JPBA 2YPRA 2B5GA 1ZREA 3CXQA 1M4DA 1FP2A 2Y75A 1G4DA 1OPCA 3S6KA 3SZPA 2P6GA 2GA2A 4I7HA 3SXYA 3JSPA 3GF2A 3I53A 3TO9A 2PLYA 1FX7A 2QECA 1QNTA 2EWNA 1KU3A 1FOKA 1SD5A 1DPUA 4ONUA 4MI4A 1HW2A 4L5IA 4WX9A 3FNCA 1RO5A 1SFUA 5D6EA 4AIHA 1YIOA 2JPCA 4XRFA 3GKRA 2PG4A 3BJAA 2GQQA 3U1DA 2Z9OA 4CICA 1K7AA 2RVCA 3L09A 3FM5A 4EJOA 1P92A 3MEXA 2HQYA 2NNNA 4N9HA 1BI1A 2B4DA 1GHEA 5E20A 4HNXB 3QU6A 2V1UA 5H84A 4U0WA 5DCMA 2XRNA 1IAWA 1S3ZA 2HWVA 3H4QA 1FYMA 2BEOA 1PP7U 2O6GE 2A61A 4YIFA 2VXZA 3J81Z 1U78A 4U0YA 3G3ZA 1YLFA 3CUOA 1E2XA 2HS5A 4GYIA 1Z91A 3CUQB 1U5TA 4ASNA 4IRHA 4NSQA 4YG2F 4Z2YA 3TOBA 2FSWA 3D2PA 2E1NA 3PGPA 2W85A 2XAFA 1QZZA 3T8RA 4PSXA 2BGCA 2W25A 3FZVA 2J5PA 2FOKA 4AWXB 2XV4S 1Y0UA 4A12A 1Q2CA 1QSOA 1QSRA 4BHBA 4JXRA 1J4JA 4EVYA 4NB5A 1BM9A 4YRHA 2C6YA 3SZTA 3WODF 4ZBGA 3R6SA 4Y17A 5ICEA 2P6EA 2PI0A 4KUMA 2JSCA 1U6MA 3RYRA 1Z9CA 3DNSA 3C1DA 1JHHA 1R7JA 2RC4A 4NEXA 3BOQA 3J7AO 5J8FA 3T1BA 2VBWA 4I98B 2HKXA 1X3UA 3FF5A 4A2UA 4DNCA 4KUAA 1ZARA 2OAZA 3FMQA 3I58A 5JQ4A 4Y15A 2Z33A 3H3ZA 2VODA 4IPAA 4A0ZA 1U2WA 5CJ9A 4UUVA 3DPLC 3H3UA 2FU4A 2QQ9A 4G6QA 2A6HF 1ZRCA 4BH9A 2P7VB 4O3MA 2UXNA 4KMUX 2W84A 3VODA 3KP2A 2FE3A 1YS6A 4LK1F 1H9TA 4EV0A 1MJAA 2KIUA 3EYIA 2B4BA 2KIFA 4A5MA 3I71A 4LJZF 2PDOA 2WPWA 4EVIA 4HKFA 4L8AA 5F1RA 4Y49B 4CXFA 3NEUA 2Y48A 3GFJA 3R9EA 1YTYA 4KLVA 5J8CA 4EM0B 4J3GA 3RYPA 2A4NA 4R57A 4HDVA 1I1SA 4LD5A 4BNCA 4M9XA 1XB4A 1XE4A 5D8KB 5ICFA 4M85A 1Z4RA 2D4PA 2JTVA 3ABTA 1BC7C 1I27A 1KZFA 1HW1A 4FD4A 1IN5A 1IUYA 3GX4X 4KICA 3LA7A 1WQ2A 2ZNYA 4AVBA 1MKMA 1WWXA 3S6GA 4XPLA 1TW2A 3O6BB 2E1CA 2F5FA 3ZMDA 2BYVE 1IB1E 4RGUA 3CXSA 3FBUA 4G7HF 3GYHX 4OADA 2NAZA 4AIKA 3IGRA 5DD8A 2M8EA 2NMTA 2F5EA 3E6BA 1N71A 1GHCA 1ZLKA 3QP5A 4H0EA 2WV0A 3FWEA 4AG9A 2GIVA 2QMLA 4WXCA 1Z4EA 2XHKA 5EEHA 4CAXA 4NF1A 2ZW7A 1MZBA 1XGMA 4TV7A 5DDGA 4EJUA 5IT9Z 3BJ7A 4JXQA 1O3QA 3HTUA 3V8KA 4ENNA 4IRIA 1CM0A 2OZGA 3P2HA 3F8FA 3BY6A 4FD6A 1B6AA 4UBRA 4RAZA 2G7HA 3VWDA 5DWNA 3WTUC 4PZJA 1RIOH 3IRQA 3HRMA 3REOA 2RGVA 4HZFA 4G7ZF 2JZYA 5JFRA 2H94A 1P2FA 2FE7A 3Q9SA 2V79A 4WK8F 1W5TA 1QQIA 2CO5A 4YFKF 2EUIA 2HV2A 3GLXA 3ZZIA 2K4BA 3ABUA 4R79A 1F5TA 3HHHA 2VI7A 1IN4A 3NQOA 1LNWA 1YFHA 1HKSA 2OU2A 4FD7A 1IRGA 4BXUA 2HOEA 4L9TA 2CSOA 5FD5A 2GXGA 4H89A 3ZMZA 4I0BA 4HAMA 1P0HA 1M4GA 4YFJA 5FO5A 4LLLA 3ML6A 1I1GA 1J7KA 3NRVA 2WC2A 1TBXA 3I59B 1RXTA 3K1MA 5ICGA 2V9VA 1D8JA 4FX4A 1PDNC 3T8TA 3R0AA 2P7CB 2CFXA 2QQBA 3ERED 4GYGA 4CAWA 1KQ9A 5ISVA 2RV8A 1U6GA 4UVBA 3LA2A 3W6SA 5LHIA 4G6DA 4CRYB 2XAHA 2EV0A 1BIBA 1ZRFA 2CGPA 2FCKA 2PRBA 3KCCA 3L9FA 3KZZA 4HX8A 1XD7A 2QBYB 4EQQA 2BV6A 5E1XA 1HW5A 2IT0A 4CHUA 3RPQA 3KEOA 2B3VA 2ZCWA 3R60A 2M87A 3ZJ0A 2G7UA 5JR3A 4I2OA 4U88A 5J6XA 2Q8KA 3FXTA 4E70A 5E18F 2OD5A 3E6MA 4U9ZA 2CNTA 2R7FA 4KMFA 1L0OC 1ZYRF 3V7CA 2XVCA 1BI0A 2I00A 2YX4A 1PU9A 2B5GB 1Z7UA 1V3FA 4HQMA 2VN2A 1J5YA 5BPIA 3WGGA 5L3BA 5H86A 1BIAA 4PCQA 1P4WA 3F8NA 1SMYF 3EO4A 5C82A 4KUBA 4ENJA 1QSTA 4CAVA 3KE2A 2OA4A 4UV9A 1OYIA 2HZTA 1JE8A 4E2AA 1ON1A 2K5TA 1TQMA 5LGTA 3TDUC 1LVAA 3N7ZA 1NSLA 1WRJA 3GZ5A 1QGPA 4JBAA 3F21A 2G0BA 4UWIA 1XGOA 2OH1A 3K69A 1R5HA 1V4RA 2A3SA 3T90A 1LEBA 2B4DB 5LRRA 2GXBA 4KFCA 2Q4YA 1Z05A 5E8IA 1Z9UA 4HQEA 1NHAA 4KOXA 5DCMB 5EBVA 5FLXZ 2ESNA 2O0YA 5D5XB 2O3FA 2OQRA 5DUKA 1MK4A 2Z5UA 2CYYA 4OLLA 3HRSA 3U2RA 1YQAA 2Z99A 3TKYA 1S7AA 3AAFA 3WE3A 1BI3A 1KYZA 1XCBA 3D3SA 1U5TB 2XAQA 1HKQA 4JJXA 4EM2A 3BJOA 2CNSA 2ZJ2A 2GANA 2VE9A 1O57A 1XGNA 3I59A 1R1UA 2J5OA 5AIQA 5FD6A 2X4HA 1OKRA 2D4OA 4LLNA 2EB7A 4WF2A 4ZYHA 3IWGA 3SXNA 5LLQA 3TO6A 5HDKA 3KP4A 2UWMA 1XDSA 3KP3A 1YLEA 5A2QK 3G3SA 1YW8A 3EQLF 2DBBA 4UV8A 2KJBA 5HS9A 3ZMTA 4RI1A 1B6BA 2ZMEA 5IV0A 3FX3A 2DLLA 3ZN0A 2J8NA 4KVOE 3DXJF 2F5DA 3B02A 2XROA 4YGOA 1FBUA 3RKXA 2XKOA 5KTDA 3JSOA 2EV6A 4S05A 3BWGA 4P9UA 1KU9A 2PJPA 3J80Z 1ZG3A 3IHUA 1RZ4A 4XSXF 2FIAA 1ONVA 2STWA 4HW0A 4KZTA 4Q4ZF 2EVNA 3RI4A 3KKWA 4EGYA 2FL4A 4KIBA 5AIPA 4HV5A 5LBQA 3JW4A 3QB8A 4MY3A 5D5UB 2HDCA 2ZBKA 4F7ZA 4GS4A 1P4XA 1T2KA 5LHGA 1B87A 2QZ8A 1F9NA 2P5VA 4HA8A 5L3FA 1XCVA 1F1ZA 4MBUA 1XGSA 1YGHA 3WG9A 1SD7A 2XAGA 3F3XA 2VXKA 1M4IA 5ICCA 4K2EA 3GFMA 1FBSA 2Q0OA 2BE5F 4IHTA 3OV8A 2KJCA 4PDKA 2IRFG 4OMYA 3SFZA 3S6HA 1KYWA 1K79A 1DDNA 3GY9A 1R23A 5HS7A 2PN6A 3J81K 3TOAA 3MZHA 4XNHB 2VC1A 2RN7A 4FT8A 3QAHA 2KKOA 4GCVA 3FMSA 2MC3A 2Z11A 2I79A 2R7HA 4U5YA 2FT0A 4OIRF 2HQNA 2DFIA 1KQ0A 1XSVA 3DQVC 2XGXA 4IHSA 4OIOF 1B1BA 4O5VA 4M6XA 4OOIA 3I3GA 2OB0A 4MGRA 1J0RA 4B5OA 5HLHA 2HTSA 3HRTA 4B09A 2ZKZA 2DW4A 3W6XA 1G3SA 1T0FA 3KP6A 5F47A 2UXXA 3FHZA 3S2WA 2V1DA 4XBFA 5ERIA 5DV5A 3ZMVA 2DK5A 4JWPA 3FM3A 1Q2DA 1B59A 2LNBA 1QPMA 2M30A 3IWFA 3R4KA 1ZGAA 3P9KA 4KNYA 2RDPA 3DR6A 2R7DA 3C3WA 2D1HA 5JI6A 3OWCA 2ZW4A 1G3TA 3F6OA 3MZYA 3EC4A 4ETSA 2FQ3A 3E6DA 2K86A 4RAYA 4A0XA 3VOEA 3JAMK 2REFA 3T0YA 3MCZA 1YO5C 4OMZA 4UXNA 4LLGF 4ON0A 3BLNA 1LB2A 3N4MA 2M45A 3BJ8A 2ATRA 5LHHA 3RDIA 1YG2A 1LQ1A 4WCGA 1M1DA 4OIQF 4AG7A 2YX7A 1FSEA 4YIIA 2H6BA 4QC6A 4LMYA 2VOPA 5ED4A 3ECHA 3K0LA 3ROUA 4ZZLA 2ARHA 4MEYF 1DUXC 3L7WA 4R3KA 4LX9A 3F22A 3EFAA 2IPQX 4HV6A 3F5BA 3K1NA 3V8JA 1S8NA 4LB6B 2F2EA 2XASA 2G9WA 4CO8A 4FX0A 4LUAA 3CO6C 2IW5A 4XPDB 2DPUA 1B4AA 4AVCA 5CVUA 2FMYA 4MEXF 4L0YB 2P5LC 3RKYA 1TW3A 4BHCA 4LGWA 3I9SA 2STTA 2KCWA 5D4SA 2QYOA 3M1EA 1ZGJA 4RGSA 1DP7P 5FGMA 2P4WA 3GFIA 4M73A 1MGTA 1KGSA 3VFZA 1CF7A 2VBZA 4AVPA 2PFBA 5D8LB 2GWRA 4N9IA 5DWMA 1KUVA 3TTHA 3EDPA 3Q9VA 2HTJA 3RJPA 1QSMA 2Q0YA 4EM1A 3O2PE 1SFEA 1TQIA 5CVVA 2JEVA 4JD6A 2MLGA 2IVMA 2PR8A 4BYYA 5H6QA 4EMSA 2NYXA 4RS8A 4U7BA 1C0WA 4GXOA 1I12A 4EJTA 3GYAA 1Z1DA 2DT5A 2P8TA 4U9YA 2WTEA 1NE9A 2HGCA 1ON0A 2WPXA 1TLHB 2K4JA 4BQAA 4HNWB 2MH9A 1LJ9A 3ULQB 1BO4A 1AOYA 4KOWA 2QM3A 3JUWA 3MGDA 4IUSA 2W57A 2ZFWA 1T6SA 2HEOA 1TNSA 3WU1B 2E7WA 3FMRA 2HR3A 3CTAA 3ZN1A 3FRMA 4Q47A 1W4MA 1XN7A 5CYVA 4JLYA 2V1XA 3LAPA 2Y0MA 2QLZA 3R61A 3PFIA 5IT3A 4RS2A 3ECOA 1YK3A 4A5NA 1IN6A 1BJAA 3GW2A 4PV6A 2ZXVA 1L0CA 1EH6A 1OYWA 3E5UA 3T5XA 1W7PD 3SXOA 2OZUA 1HSJA 2D1VA 2FEZA 1R5GA 4GGGA 5DYMA 3F8MA 5E8GA 4HF1A 4M9ZA 5L3DA 2ZXJA 3ISPA 4L0ZB 2A69F 4FD5A 1SFXA 5I0CA 2P5KA 2FBKA 1UHMA 2FNAA 2FMLA 4OIPF 2CG4A 4L18B 1O3SA 2VBQA 5HVQC 3H92A 1YW7A 3FB3A 2DTRA 1O7FA 2ZMEB 3CUQC 3OOPA 2L54A 1IRFA 2XIGA 3CXPA 1IW7F 1FBQA 2AXLA 1XMTA 5DD4A 5CNPA 1GXQA 4X5KA 1IICA 3D5LA 3F6VA 5BMZA 2MBFA 3JTGA 4MHDA 2O8XA 4P96A 3P9IA 2A6EF 1ZG1A 2L4AA 5E1ZB 3E97A 4U0VA 1E17A 3P9CA 2CW0F 3TE4A 5DEQA 4O6JA 3RKWA 5K1YA 4HBLA 3ZQ7A 1ZG5A 4R3LA 2Z10A 4HYEA 3VEPA 1TQPA 1SQHA 4KVXA 1TTYA 1IYLA 3RYOA 4UVCA 5ILSA 3SHFA 1KU7A 3HOTA 3LSTA 3PZJA 3WTZA 2KRFA 2VBYA
chains in the Genus database with same CATH superfamily
4OMEA 3NH5A 2C6PA 1YX5A 3G8WA 1ETXA 4HNVA 2FF4A 3MKLA 4QB9A 4OIWA 5E3OA 1I21A 4QBJA 1OZPA 5CQGA 5KTAA 3OYFA 3BJ6A 3M7GA 4A3FJ 1E3HA 3WTYC 3KX2A 4K30A 4Q7AA 5M5WJ 3RPUD 3B6AA 4YRVA 4LIUA 4V2GA 1XEBA 4KOSA 1UELB 2W4SA 1HSTA 4GXHA 2JBJA 4G7OF 4M72A 2Z0ZA 4NGNA 2FBIA 1LDDA 1X19A 1FJLA 4CYNA 1IRZA 2CJJA 1MIJA 1U9OA 4UB8C 5HMNA 2LF8A 4NGPA 2ZEDA 2LTPA 1JGGA 5THWA 2OQGA 4QLCU 1RESA 2VLAA 2EFPA 4MHYA 2N8GA 2IP2A 4BKXA 1ON2A 2DA6A 3I4PA 4M9SA 2RQQA 1PUEE 3GTGJ 3CJRB 2XEIA 2OV7A 4MFZA 2B58A 2IJLA 4M74A 3CT9A 3S6FA 4IJAA 4MHGA 2L8EA 5C82A 4PXBA 1MDMA 1E3PA 2R98A 2ZSHB 2AJ6A 2CWFA 4Y49C 2KLOA 4PGHA 3H9GA 3TJQA 1Y0NA 3W2WA 2JLMA 2O03A 3K4MA 4HX7A 2KMRA 1TWGJ 1HOMA 1DGRM 1XG1A 3GWZA 4RB0A 4GM5A 1XSXA 4A3JJ 1XMKA 4XLNF 4XLHA 3CMEI 1WTJA 4A38A 4U7DA 1KMAA 3DR8A 2K9SA 1EH7A 1LDJA 3FXKA 1WJBA 4JK1X 2WAFA 4KS9A 1QSNA 2L7MP 1OYYA 2AE6A 1RRJA 4A3BJ 4MFJA 2HYFA 4LK0F 4AD9A 3MVPA 3K70D 3KL9A 3V7ZA 2EFQA 3RNZA 2E60A 2EFOA 5HS8A 3B3VA 2VC0A 1Q1HA 1TT0A 3DDDA 3G1OA 1Y8RB 2HOAA 3GZNB 4OU0A 4M6IA 2L02A 3R95A 1S6LA 2ZEOA 4PPZA 4BQNA 4E8OA 2GOXB 2COMA 4OINF 1FEXA 2LUYA 4RGXA 5BS6A 4QVTA 2VB6A 3UNGC 3LQQA 5F64A 2LBFB 1OCOH 4LG0A 4C3IJ 1W0TA 1F43A 1VHSA 2YGWA 3FMCA 4CGMA 5BNGA 3PQJA 3S9LA 2AFWA 4B3AA 2AQFA 2HYJA 1B8IA 1HQCA 4XKBA 1KA8A 2MABA 4P4DA 5EG0A 5LRJA 3I1UA 4KOVA 2QKMB 3GTQJ 1HXDA 4UNOA 4A2ZA 3ABKH 4OP4A 1DPRA 4DYRA 1Z3YA 1W36D 5F49A 2QIRA 3GVAA 3PUBA 1I6HJ 3IFEA 3PQKA 3FXOA 1APLC 1N13A 2DA1A 3LODA 1FOXA 3QYEA 1MH3A 4WWCA 2DFHA 1ZH5A 1R43A 4AVAA 2V26A 4JX6A 3LSGA 3U9GA 5HODA 3LSRA 2R7UA 4KOTA 4MTDA 1P4AA 3R1KA 2LY9A 3KHZA 3M9AA 3WTXC 1XA6A 1UFMA 1R3NA 4Q5SF 3BROA 2V1CC 1LDKB 2H5MA 1Q7LA 5FUVA 2FBHA 4MQ9F 1S60A 2F5IA 3IAM2 1IW4A 2NU2I 5H6RA 1YITI 4HPQA 1ERDA 1R79A 2MH2A 4IF4A 1TZLA 2FQ4A 2X6YA 3IP4B 3CP2A 5K5OA 2RFHA 4ZX9A 1BBYA 2Y0SA 4JCVE 3JRCA 2NNYA 1YR0A 2M0CA 4KN4X 3B73A 4KIGA 3D8PA 1R00A 2X85A 2Q1ZB 4NJRA 5JHUA 2NOJB 3PNVA 3J80K 2FRHA 3GEZA 2LREA 3E5XA 3CDIA 4A33A 3BR2A 2P6TA 1D1BA 3ZPLA 3HB9A 2H1KA 4ESJA 1O3RA 1VDDA 5F48A 2CUZA 4XR6A 2R7WA 3LSJA 1V1HA 2BCOA 4PFPA 4I02A 1S7KA 3B3WA 1ORKA 1JXSA 2VI6A 1HBXG 1V54H 2BXZA 3GTOJ 4OAZA 3V38A 3LWUA 1F57A 3PBBA 4PJLA 4UVAA 2WAQN 1YVKA 2IGKA 4DJLA 4L9JA 5JHFA 1R58A 3IUOA 2XF6A 3SJMA 4ZY2A 1S3JA 1Z77A 2FD5A 2BSWA 3IWZA 4AYBN 2JDDA 3W91A 2K27A 2LOOA 2W24A 3I0TA 3OSFA 4YIRX 2CMPA 3E6CC 5JVTA 1LANA 1USSA 3S8PA 5DUIA 4CS0B 1KQ8A 1Q9BA 3VB2A 3WTTC 1RUNA 1XPXA 3LACA 1S29A 3HBLA 3TFYA 2O28A 2XKPA 3BR6A 3KYCB 4C3JJ 1LFUP 2Q43A 2CUJA 3HSEA 3I5UA 1AWCA 1RKTA 2QUFA 3S1QJ 3WR7A 3QODA 3K4CA 1I39A 4P9FA 4CYDA 1XRYA 4R7MA 1FT7A 3A01B 2K40A 3ASNH 3QP6A 3GTKJ 2TDXA 1Z2IA 3KR4A 1Y9WA 4C30A 5LGUA 4P5OA 3MAJA 2Z2SB 4BE2A 3OXGA 4I99C 1IRXA 2P6AC 4A32A 1USTA 3S2DJ 3GUXA 3QPTA 1TL8A 4ITVA 4A3EJ 1IF1A 2PJ8A 3HUGA 3H9JA 2GOMA 4XLCA 3HRUA 3RQIA 3FDYA 1FC3A 4C7IA 2R5ZB 2DK8A 2ISYA 1R1VA 2EV5A 2NU4I 1J75A 3HC7A 1VQ7I 2V77A 3JCUC 1S7OA 5HLIA 3RPUA 2XEJA 2VZYA 4D7MA 2VBXA 4RB2C 1MSFC 4O23A 2ZO4A 4UIAA 3SJFA 3IC7A 4HDUA 3HHGA 1IC8A 1BN5A 3K4NA 3R0JA 2CIJA 1ZR2A 1DTDA 4G94A 4R87A 2EO8A 5LGNA 2HI3A 4LB5A 2NYQA 4HPSA 4P4JA 4ZYEA 1VQ8I 3CDHA 2ZEHA 5G1ZA 2GA1A 4FBEA 1XMAA 3L2NA 4UHTA 3DFGA 3K10A 5KCMA 1ZTRA 2DAOA 1U3EM 1MBKA 1ODDA 4CDGA 1YYVA 2EIMH 5J1QA 4ZYGA 3BLYA 3RBUA 4FAIA 4LIVA 5CBMA 2ICWG 3V7SA 1X1DA 4C3HJ 1ULYA 1GVJA 1NMTA 3LSMA 3S15J 2VKHA 1IN7A 1K78A 2K7LA 4KIFA 1CF7B 3PP9A 3R96A 3HJEA 3D1NI 3SZGA 4F92B 4E1PA 3TT2A 1D3YA 2DQRA 3DU6A 5BQTA 1T39A 4DQ2A 4MLOA 3ZQCA 2VQYA 2HFHA 1LR8A 3WGHA 3HL2A 2QENA 4P4EA 1A5JA 1G2HA 2Q04A 1TKHA 3FJUA 2ZEMA 1NG7A 5L3CA 3RTRA 2CW8A 2FXAA 1ZRDA 6PAXA 3S1RJ 4M3EA 4HNUA 3D2MA 5HOOA 1HCRA 3HOUJ 3JRHA 2E1MC 3COAC 1GXPA 1LOKA 3OYHA 4R6TA 3D0SA 3KP5A 5FUWA 1WK4A 1UZCA 4L5JA 5LEJA 2R7TA 3GZ6A 3RZOJ 4E1RA 2VT3A 3KETA 3WTWC 2XPWA 1JGSA 5GADJ 4KITB 5G20A 1T95A 1YW9A 2EK5A 2MC4A 3V7RA 2LDUA 4ESFA 2IS4A 3BP8A 3R5CA 3LAJA 1Z5RA 3QU3A 4MFQA 3I9V2 3DP7A 5FFXA 5J4YA 1O7LA 1IXCA 4HOBA 5FRNA 1FLIA 4UA3A 4BMHA 4OAEA 3P7NA 2KIMA 2LF7A 2MG4A 4BHPA 3AFHA 2E5NA 3TDZC 3UGLA 3ZGKA 4UIBA 1WKMA 4P55A 4GFBA 4PK2A 2Z3YA 1D0YA 1STZA 2EA2A 2LMDA 1B9NA 2CJSC 1Y8QB 2B8TA 3CQZJ 1A6IA 4IRGA 2ZW5A 1B9MA 4G8XA 1H0MA 2YQPA 2UUZA 1S7FA 2VONA 4R9MA 1FP1D 5KVRA 3D7GA 1IZ1A 4XPKA 3HSFA 3V4GA 2AFUA 4HSTA 3ISXA 4B48A 2NU1I 1GVDA 1U8RA 3Q0VA 1IJWC 2LRDA 5F6FA 1J09A 1MBEA 1Y1BA 3TQNA 2K85A 4BE0A 1TURA 2E7XA 2KISA 3ESWB 3FX6A 1MJBA 1I6XA 3M8FA 1R9TJ 2QQCA 3V42A 2GE3A 4ORFA 1CT0I 3ZP5A 2JT1A 1VKCA 1GDTA 3FC3A 4JYKA 2PMHA 1D5VA 4NCZA 2HUZA 3KZYA 1WI9A 4XORA 5FROA 3B3SA 4R76A 1T33A 3GUDA 2YSRA 4DGWB 2W0TA 3MKYB 4B8XA 2R93J 3W6JB 2PEXA 3MQ0A 3GMEA 4Y13A 2Y30A 5JPHA 1FT9A 4IOAF 2XUBA 2BL1A 1Z3XA 1P4NA 2J9AA 1XX5A 1BOAA 1ZO0A 2Q7BA 4WWVA 2PE3A 2OBPA 4KORA 1A04A 4CRZB 5L3EA 2L01A 3SI0A 4CGZA 1Y9KA 3C26A 3S32A 3PB7X 4MFKA 3ZXSA 3MWMA 1VTNC 2GM4A 2M9HA 1HKTA 3B35A 3JAMZ 2EFNA 3E5QA 5EYRA 1K4JA 2ABZA 1FWZA 4NFRA 3IV5A 1UFHA 3L2CA 3HYIA 4F0XA 5DS0A 2CQXA 2DQLA 2W1OA 3BDDA 4RM3A 3DTIA 1XF8A 4ENKA 1M4LA 5KTCA 2JSPA 3VYSB 4M6YA 2IA1A 1ETQA 2V6CA 2R7QA 4QWQA 4XSZF 2XB0X 4QUSA 3OL3A 2K9QA 1GUUA 3LSHA 4JX5A 4B6DA 1ETWA 1T98A 2MLKA 1E0EA 4F6AA 2E2IJ 3A4CA 4B5PB 2JDCA 4KSAA 3GFLA 3JTHA 4HLXA 4MNUA 4XKWA 2CY2A 4MFDA 2LKPA 3TGNA 2ISZA 4FUUA 2VZZA 4OC0A 2KZVA 3W6VA 4PSWA 2VIXA 1ZN2A 2LKXA 3CPAA 3BPXA 4W97A 1PP8F 3TCVA 2RREA 1BC8C 3M8EA 1YLOA 4I01A 2QCOA 4DZPA 2VEZA 1G3YA 3CCEI 1KUXA 4BAYA 1IXSB 4C2YA 1TT5B 1YOVB 4IVNA 1TP4A 2LYCA 1G3WA 2ZJPF 1VQOI 2FS5A 3I4MJ 2YR2A 4HF0A 2JBKA 4AM3A 3P2FA 1IG7A 1HEEA 4Y3OA 3CESA 1SD4A 2UZKA 1FNNA 1U5TC 4ZH4F 4MTEA 3RO0A 3O8HA 1X3WB 4B4CA 4CCJA 1UHWA 2LSOA 3F8BA 4CUGA 3BC8A 5E17F 2BBYA 1OR7A 4I76A 2OZHA 2DJIA 4UUSA 1W5SA 2VPRA 3KASA 2RQPA 4HLYA 4UWJA 2RNJA 1SC7A 2RAEA 3E3VA 2JZMA 5F08A 3PBEA 2F5CA 3CJQB 3WTVC 3LD2A 2PJ7A 2E34A 2BW3B 2EJRA 2H6CA 1QVUA 5AG7A 3WABA 2HB6A 2GZWA 3MZ8A 2EINH 1BI2A 1UCRA 2OZ6A 4XICA 4N0BA 1EV7A 5EF6A 2KHMA 2IMOA 4KOUA 3CCQI 5IB9A 5D5VB 3WE2A 1FMVA 1SVLA 3PO2J 1ARLA 3E0KA 4P4BA 1AHDP 1U5KA 2PMUA 4P44A 2WADA 5EJCA 3C2HA 1JKQC 4W1UA 5IT9K 3NE7A 1Z6TA 2ECCA 1YVOA 4A0YA 2CUFA 1S5KA 2MA3A 2RB7A 3DGVA 3FXMA 4OC1A 1OJLA 1RC9A 2ME0A 1D5YA 2O4HA 2D45A 3GTMJ 2IQ6A 2PSWA 2XSDC 1IOFA 2QQEA 2IA0A 1WVRA 5LFAA 3CUQA 2BEIA 2RKHA 1X4OA 5EEGA 3MFKA 3Q5FA 1P7JA 3UGDA 1EE3P 1YS7A 3LMMA 1J9IA 1ETOA 5CCMA 5HLGA 3FYNA 2OC6A 5D5WB 1SMTA 3CC7I 2I3CA 5HH1A 5HNHA 4R1HA 2ZOFA 4FHTA 2J9RA 1YIJI 2XPUA 2ZW6A 2DU9A 3KFWX 4S04A 4NHJA 2OF7A 3CZXA 2VRWB 2DODA 2H8WA 2HDWA 4IHXA 1S20A 4KVME 4ZY1A 3PFOA 1P6RA 1R22A 5ILUA 2PIYA 4TWEA 2P0WA 4CPAA 5F46A 3QRFF 5A27A 1FYKA 1QZYA 4P45A 3DF8A 4EGZA 4IHMA 3FBIB 1MJ9A 2PX9A 4XKVA 4ESBA 4KN7X 5E1WA 2ZNZA 2JN6A 4X0GA 4QIWN 2H8RA 2EIJH 1TNTA 2K9LA 3FKIJ 3SQNA 1O3TA 5CVIA 1MBFA 1R57A 4JQFA 1IIDA 1CE3A 2B7EA 2A6TA 2HQAA 3O3KA 1LRZA 3R9GA 5HDGA 3TL4X 4B1RA 3UEYA 1Y7EA 4CA0A 4A6DA 4FQGA 1F4KA 2DMTA 1Y6IA 2P81A 2HVRA 4RB1A 4YFNF 4DW6A 2R8VA 2R7RA 4FWUA 2M5WA 2CWHA 2PJ6A 1RUOA 2SGQI 3BPVA 4X3RA 1MD0A 1PUAA 2PJ5A 9ANTA 4E7KA 1MDMB 3DTKA 3DPTA 4WXDA 2JK3A 4I09A 3SGQI 5EGOA 4ABZA 1Q2YA 4JOMA 4NNJA 1IY7A 2DMQA 5JLXA 3VDPA 2DF5A 5EDNA 2G3AA 1ULNA 2V8VA 4RN7A 1IN8A 4KOYA 1PTRA 2XB5A 5F27A 2ZXWH 2DDBA 3LL7A 4NQWA 2ZELA 1FIPA 3UGIA 2PVVA 2X3TA 4E7ZA 4NXYA 4XKCA 1N25A 3WHBA 4BY7J 1F2PA 2CUEA 3M8JA 2POKA 1BR1A 2WB1A 3DEUA 1T38A 2LK2A 3M07A 2M1BA 3G4SI 5TJJA 3SHPA 5CVRA 4IOCF 5F0CA 1XSDA 1IDZA 1S7LA 3KP7A 5AGEA 2K02A 1LEAA 4RAGA 4YFXF 2EZHA 5CLSA 4LFUA 3B4VC 3LWFA 2M5XA 1MMAA 2DA2A 3IAS2 1I1DA 2J8MA 2PR1A 4PGGA 1TIHA 4ZJZA 4MQVA 2DXQA 1JHFA 3WT4A 1FSHA 3FF3A 3CJNA 4F0YA 4L9VA 3HIFA 2HQRA 4MCPA 1JQGA 4E0AA 4RGRA 1BJZA 3IL2A 3LA3A 4CH7A 1VHEA 1R5ID 2ACJA 2L7KA 2EFWA 2G0EA 2Q2EB 2QQ8A 2C27A 4XLPF 2A07F 4LG0B 4CGPA 1K4TA 4B5PA 2AQEA 5EX3A 2DB6A 5K5QA 5ILVA 1FZPB 4OAYA 5M5YJ 2K9NA 1W7PB 1B8IB 3N97A 2KMUA 2HYGD 5EG0B 1K6YA 1UG0A 3CCSI 1VQ9I 1HDUA 4KSFA 2GU2A 4F8ZA 3EY5A 4RB3C 5GAEJ 2LH9A 1TF9A 2JA1A 2L9NA 4XOPA 3AL0B 2R7VA 2QQDA 2O61A 2B3UA 2ZEPA 5IB0A 2BVMA 2R1IA 2WYRA 4HRIA 2EIKH 2VJ5A 1TIQA 4AIJA 2O5RA 5FVJA 3VYUB 2EQRA 4XNHC 2PC1A 4H6ZA 4XRMA 4ZGYB 1J2XA 3JTKA 3PB9X 2X48A 4Q48A 1R71A 2EK9A 2CW7A 3ZMUA 2G9DA 1VGYA 3J7AY 1R1TA 3HEFA 4BACA 4ENMA 5E3NA 2NXNB 2E1OA 3O8GA 3ZQIA 1K6OA 1CJWA 4CZZA 2HQ5A 5J47A 2D2WA 2OD1A 1VQLI 3HOVJ 1ZLIA 4F93B 1WSUA 5C88A 1GYTA 1M44A 3PB6X 5K8NA 2QQAA 3WGIA 4UF4A 3K1PA 3VARA 2CU7A 5FJ8J 5C4XJ 5HDNA 2DA7A 4I49A 2MD5A 4MY0A 5K8OA 5K7HA 1EJ9A 3B8GA 2ESHA 2PQ8A 1J59A 3KLOA 2PJ4A 3T8WA 2KP6A 1QBJA 4BEHB 3FIXA 1W5CC 3RZDJ 1SD6A 2VE8A 2QWWA 5CPRB 3QPSA 4NBQA 1RNLA 1IYKA 3HOSA 1MW7A 3V8LA 3OYLA 2NRAC 5JHWC 3NH4A 3DSBA 2OPTA 2QVOA 2X0LA 4JP0A 1OMIA 3MD2A 5C4JJ 1U9NA 3NH8A 1SGPI 4MXUA 5EC4A 2VQCA 1XTAA 3K9UA 1W4RA 5E3MA 4RLFA 2X7BA 3BG6A 1LFBA 4M3SA 4IXAA 3DKWA 1SEUA 3HGYA 3HG9A 4MO7A 3HSRA 3RQ4A 2Q4VA 3F72A 2Y0SN 2F7VA 2FSRA 4AUXA 2V1CA 3JVNA 3TW6A 2A5YB 4D0PA 3VWBA 1FYBA 3OL0A 2B0LA 5E96A 4V2FA 4HF2A 3M3YJ 1ZELA 3FXQA 4GI3C 4H6UA 3I54A 3I64A 2L3DA 3K9TA 1LPQA 5IYDJ 1PCEA 1WWZA 3DLLF 1ARMA 3BXMA 5JVGF 1S7NA 4EWTA 2J8RA 3A9LA 3CO7C 4ZZDA 4MJ8A 2JRTA 5FB2A 2QSGX 5KK1A 3G73A 3FXRA 1OMUA 1XMBA 3KZWA 1ZHFA 2FA5A 5GCNA 2QPOA 3VYTB 1YSJA 1MMSA 3JRAA 5DAEA 3DLJA 1TWHJ 2ECBA 3DEWA 4HNYB 4ZYDA 1RI7A 2ETHA 1REPC 5CVJA 4MCQA 1FY7A 2YU3A 1Z8WA 2X6XA 2J87A 2ZPAA 2CV1A 1BR2A 3F8CA 1Y7RA 4DYOA 3HUGB 1SAUA 4PJ0C 5F09A 3BG3A 1O4XA 2ORVA 3QOPA 1Z8TA 2CRGA 3OYGA 2DPDA 2R3SA 3K2ZA 4IF5A 3KLNA 3VWEA 4UXIA 3J7ZI 4A6EA 3EXNA 3WU0A 2PJBA 1I5ZA 4ONWA 4L89A 2ELHA 2NSMA 1ZAOA 5BPDA 2CWEA 1WJCA 3BR1A 3EYYA 2ZOGA 5FLXK 1GLNA 4BDZA 2BY1A 4UFXA 1FIAA 2VOOA 2VJIA 3IKTA 3HOYJ 3LFKA 1A36A 4KLWA 2P6FA 2F4MB 1BA5A 3CXLA 2BUEA 4XIDA 2LP0A 1XS9A 1MBJA 2VQGA 3S3NA 3S1NJ 3GO5A 3SFIA 2M2EA 2O9LA 2CNMA 3CCJI 3T9YA 1H9GA 4LG3A 1WPKA 4G9YA 1JJ6C 1V5FA 1YE9A 4WXHA 1UUCA 2PBIA 4ZI6A 3QPHA 2L9VA 4EJWA 1K78B 2Q44A 1DE4C 2DO7A 4KT5C 1ETVA 1CSOI 2GVIA 3L00A 2GREA 3GTJJ 1QVTA 1PPFI 1UB9A 3DEEA 4G1PA 3QTLD 1IXRC 2C6GA 5IX3A 1JTYA 3GXOA 2NS0A 4KA4A 1AN1I 1WI3A 5D8NA 3C7JA 3RZAA 1QA6A 1WGTA 3IKVA 3H8FA 1G6NA 2CQQA 2DJNA 2NS8A 3Q0WA 4FISA 1UG2A 4XM3A 3HOWJ 3F8KA 5H20A 2FXFA 5BOXA 3MN8A 2ADUA 5LRSA 2CFOA 2Q2EA 2A68F 3CLOA 3HXLA 4OC4A 1DU6A 1KUYA 4A39A 3BZ6A 1QO0D 4LITA 5FFZA 1UHSA 2WWYA 2VT2A 1LCPA 4UB6C 4XPDC 4C2XA 1OLTA 1W7PA 3F23A 3OYIA 3ZMSA 3NFZA 4XL9A 2FIWA 2WY8Q 5FUXA 1XC5A 1OCZH 5F0FA 1TWFJ 2BY2A 2IL4A 2HKOA 2JA2A 3D4UA 3PL8A 3V8IA 3TO7A 3C18A 2CQKA 2AFOA 2BOAA 3R9FA 4II9A 4KDPA 3KQZA 1EH8A 4EJVA 5LEKA 2P6SA 4I0AA 2REEA 2EZLA 2H09A 4KJZA 4GO1A 3EUHA 3F0AA 1D8KA 4UFWA 2MD0A 3RIRA 4BUPA 3G2BA 2L4MA 3IWWA 2FNPA 5D4RA 3ELKA 2AS5F 3QAYA 1UJ8A 1SANA 2CS3A 2DN0A 1V0CA 4TNUA 3OMYA 3EETA 3KEQA 4RAFA 1CGPA 1W3SA 2BVLA 1SGRI 4FTHA 5A2QZ 1XIXA 3IU2A 2X1CA 1SAXA 4MMOA 3ABMH 4HX4A 1ZLJA 2DI3A 2GAUA 1FYLA 1YX0A 2G3TA 5AG5A 5C3EJ 2QBYA 3HTSB 3LFUA 3G1LA 3LQRA 5L3GA 3PIPF 1WJDA 5LRGA 1UAAA 3B7IA 3KZIC 3IRRA 3K4BA 1ZQ3P 2EPFA 1EKEA 5K5RA 2M34A 3AG3H 3JRBA 2XAJA 4BEHA 5G21A 5M5XJ 5AONA 2DPTA 2QF7A 3LSIA 1BMOA 1V5GA 2TRTA 2Y2ZA 4M71A 3E7LA 3ZR8X 4CCKA 3E59A 1YREA 2IA2A 1L3LA 2LKSA 3ZQQA 1OCPA 4KYWA 4R8HA 1BOBA 4CYCB 4WP4A 3FXUA 1FPQA 3WTSC 1FNOA 2EA4A 2H27A 1R36A 1Z6RA 3UY5A 5D6FA 1YRNB 3W6KB 3DV8A 3HLPA 4B10A 1KU2A 4PK3A 5TRDA 1XDUA 4L9NA 3R5AA 3LSKA 5DCFA 1Y39A 4E7HA 5JM6A 2OOTA 2JPBA 4A3KJ 2YPRA 3DTEA 2B5GA 2LLKA 3FECA 5FKMA 1ZREA 1CT2I 2ZEEA 1TOTA 3CXQA 2WV1A 2E2JJ 2PJCA 2WAEA 1Z7KB 1M4DA 1FP2A 2Y75A 1G4DA 1OPCA 3S6KA 1XBTA 5J1RA 3SZPA 1ZLHA 2P6GA 2GA2A 3S9MA 4I7HA 2V4JC 3SXYA 1K7TA 3CCMI 4LOCA 3AG1H 4CCLA 3JSPA 5TISC 3GF2A 3I53A 3TO9A 2V8GA 5EEAA 2PLYA 5IOYA 1FX7A 2Z3KA 3G6EI 2QECA 2L0KA 3TC8A 1QNTA 2EWNA 2QA4I 3EPZA 1KU3A 4J00A 2V7FA 2V9KA 1FOKA 3QYBA 1SD5A 1ZGWA 1DPUA 2OVOA 1H8LA 2EK8A 3K2KA 4ONUA 4A37A 4MI4A 5JGFA 2NS7A 1HW2A 4L5IA 4WX9A 3FNCA 3U1KA 1RO5A 1SFUA 1UVGA 5D6EA 4AIHA 5J1YA 1YIOA 2JPCA 2DDAA 4XRFA 2B9SA 2PG4A 3HGGA 1VQ5I 4I6ZA 3GKRA 3OYKA 1LFWA 4A30A 3BJAA 2GQQA 4HGUA 3U1DA 2Z3MA 2Z9OA 2IEKA 4CICA 1K7AA 1IO2A 5HI7A 3VYRB 3FVLA 1K7UA 2RVCA 4UUSB 1I3QJ 5IPAA 2GLJA 3L09A 4L8AA 3FM5A 1PUFA 4EJOA 1P92A 1VQKI 3MEXA 4SGBI 2HQYA 2NNNA 4N9HA 1LE8A 5B66C 1ELLP 4C68A 5A28A 1BI1A 5IOZA 3TW7A 4BJ5C 3G71I 1GHEA 2B4DA 2DYSH 3HPGA 5E20A 3S1MJ 4HNXB 3QU6A 2V1UA 2WZNA 3SJGA 4YELA 5H84A 4U0WA 5DCMA 1JJ8C 4UEZA 2K3FA 2XRNA 1IAWA 1SGEI 2PMZA 1ETYA 1S3ZA 2HWVA 4C9YA 3H4QA 1FYMA 2BEOA 1PP7U 3BTLA 2O6GE 2A61A 2VL8A 3ZOBA 4E4HA 4EMEA 4YIFA 2VXZA 3J81Z 3Q3SA 2D5VA 3D5RC 1U78A 1HC8A 4U0YA 3G3ZA 1YLFA 2SGFI 2VKDA 3CUOA 4CGOA 4CYPA 1E2XA 2HS5A 4GYIA 4AU7A 1CHOI 1Z91A 2ZC2A 3CUQB 5AG6A 2JUGA 1U5TA 7WGAA 1SVOA 4ASNA 1BUSA 4DJAA 2MSYA 4IRHA 4YU9A 4NSQA 5ELYA 1R6RA 4YG2F 4Z2YA 3TOBA 3VDXA 2EBJA 2FSWA 4NGSA 2IXSA 4QPOA 3JRDA 2E1NA 3D2PA 1QHGA 2ZMEC 2ELIA 3WC7A 3PGPA 2W85A 2XAFA 3OOUA 1QZZA 1S9HA 3N05A 3T8RA 3NARA 2BGCA 4PSXA 2W25A 5B1AH 4OC2A 1YX3A 2Q4ZA 3FZVA 2J5PA 4F91B 2N52A 5B3SH 2FOKA 2PJRA 4AWXB 2XV4S 2YNCC 1Y0UA 5EZHA 3VH9A 1R0RI 3KR5A 2HU9A 4A12A 1Q2CA 1QSOA 1QSRA 3BI0A 3H8EA 3OY9A 3PO3J 2DMUA 2EBIA 4BHBA 4JXRA 1J4JA 4EVYA 4NB5A 4NUBA 2LVSA 2WVJA 1BM9A 1SFOJ 4YRHA 4DYCA 2E5RA 2C6YA 3BG5A 2QEXI 1RETA 3SZTA 2BY3A 3WODF 5KAIC 2OTJI 4ZBGA 3R6SA 4C7HA 4Y17A 5ICEA 2P6EA 3H0GJ 4CCNA 3WU2C 2JYYA 3ONQA 2PI0A 2B4BA 4KUMA 2JSCA 1U6MA 3RYRA 2Q51A 4PK4A 1Z9CA 2UVOA 3DNSA 2HXOA 5FKNA 3C1DA 1JHHA 1R7JA 2RC4A 2VJ4A 4NEXA 5BWAB 1S5LC 2LG4A 3BOQA 3J7AO 5J8FA 2BXYA 3T1BA 5D29A 3J7YJ 2VBWA 4I98B 2W7NA 2HKXA 5EGOB 1X3UA 3MEKA 1G8XA 3FF5A 4A2UA 1R49A 1WJ5A 4DNCA 4KUAA 1ZARA 2OAZA 3FMQA 3I58A 1EF4A 1BPNA 5JQ4A 2CQ7A 4Y15A 3QQAA 2Z33A 2NVQJ 3H3ZA 2VODA 4XONA 3RKQA 1KWMA 4IPAA 4NQWB 3WG7H 4K3NA 1FARA 4A0ZA 1U2WA 3GCMA 5CJ9A 4IHWA 4UUVA 1NUBA 1HPTA 3DPLC 3H3UA 2WBMA 4JX4A 4CYCA 3H0DA 2YNEA 2FU4A 4D7NA 1ULKA 2QQ9A 4G6QA 2ZJQF 2A6HF 2F48A 1ZRCA 3W3CA 3S16J 2OJED 1KBFA 5GTHC 2EH3A 6CPAA 5E3PA 4BH9A 1HEVA 1YRNA 2P7VB 4O3MA 1F36A 2UXNA 5E79C 3S3MA 4KMUX 1X4SA 2W84A 3B3TA 3GBGA 3VODA 4N4NB 4BXFA 4IHYA 1ETKA 3KP2A 2FE3A 2RNGA 2YNDA 2ZXHA 1YS6A 1Z8LA 4LK1F 4B43A 1H9TA 5J4VA 4EV0A 1T56A 1D0ZA 1MJAA 2KIUA 2UV1A 5JLWA 4FCYA 3K4LA 3FK7A 3EYIA 2KIFA 4A5MA 3A0BC 3I71A 4N4OB 4PQAA 5IP7J 3OIPA 3SDGA 1MH4A 1CGJI 4EEFG 4XMYA 1SVMA 4LJZF 2PDOA 3C2BA 2WPWA 2K9MA 1S7EA 4EVIA 3QOEA 5F1RA 4AC0A 1AKHB 4A3CJ 4CXFA 3BTCA 3NEUA 4BY1J 4Y49B 2WB1N 2Y48A 3GFJA 3R9EA 1YTYA 5K8PA 1M8BA 5J8CA 1GT0C 2XRCA 3GLLA 2ENZA 3HOZJ 1HDQA 1QHHD 4CCOA 3RYPA 4EM0B 2A4NA 2DT6A 1OCRH 3HH2C 4J3GA 4R57A 1AUGA 4HDVA 1I1SA 2C1CA 4LD5A 3OR1C 4BNCA 4M9XA 1XB4A 2R0QC 4L9MA 1XE4A 5D8KB 1QMUA 4UCPA 2DPSA 5ICFA 3M4OJ 2KMOA 2CXAA 4M85A 1Z4RA 1OVOA 2D4PA 1X1CA 3ZQLA 2JTVA 3KIOA 4ZTJA 3ABTA 1BC7C 1I27A 1FMWA 1KZFA 1HW1A 4A3IJ 4BXXJ 1IN5A 2CV0A 1UHAA 1IUYA 2DTZA 4FD4A 3GX4X 1MSEC 4B11A 1N75A 4KICA 3LA7A 1TWAJ 1WQ2A 2ZNYA 1MNMC 2Z3LA 2E36A 4GDFA 2R5YA 5H2FC 4AVBA 1MKMA 1WWXA 3S6GA 3QWPA 1TW2A 3OS0A 2XC7A 4XPLA 1X2NA 3O6BB 2DXIA 2E1CA 4IQJA 2F5FA 3IH3A 2BYVE 3ZMDA 4RGUA 1IB1E 3CXSA 8CPAA 3FBUA 4IZZA 4G7HF 3PSIA 2KDOA 1TBOA 3GYHX 4OADA 2A05A 3K70C 2KMPA 1RR8C 2NAZA 4AIKA 3IGRA 2N1AB 5DD8A 2M8EA 5KNLA 4M6HA 2NMTA 1KZHA 4D9JA 2F5EA 4OIDA 3E6BA 1N71A 1SFKA 4UUTA 1GHCA 1ZLKA 3GLJA 3DPUA 1T0FC 2M4KA 1KBEA 5LYFA 5EMIA 3QP5A 4H0EA 4IKFA 1CP7A 2WV0A 3FWEA 5FLVA 3H8GA 4AG9A 5LYLA 1OYVI 5TGTA 4OKOA 2GIVA 1P9GA 5JH9A 1Y0YA 1Y0RA 2TCTA 1MBGA 2QMLA 2HNHA 4GRIA 4WXCA 2CV2A 2V9PA 3JRGA 1Z4EA 2XHKA 2PCUA 5EEHA 4M3GA 2VUMJ 4CAXA 4NF1A 1BR4A 1LUJB 1TXRA 3BR0A 2ZW7A 1Z2LA 2I5UA 1YW4A 1MZBA 1XGMA 4TV7A 1JUSA 5DDGA 4C2UA 4EJUA 4D5CA 5IT9Z 3BJ7A 4JXQA 1O3QA 3HTUA 3V8KA 2X51A 4ENNA 4IRIA 1CM0A 4EATA 5IP9J 2OZGA 3P2HA 2WGCA 3F8FA 2JA6J 3IH2A 4FETA 3BY6A 4FD6A 3KHXA 1B6AA 4UBRA 4RAZA 5J3LA 3KGQA 3SI1A 3BCAA 3R5DA 2OCCH 2G7HA 5G22A 3VWDA 3WC5A 4B13A 1XJOA 2FNFX 5DWNA 4EFDA 3WTUC 4PZJA 2JWTA 4BGDA 3ERMA 1FOYA 3HRMA 3REOA 3IRQA 1RIOH 3D7FA 2VQLA 2RGVA 2BY0A 4HZFA 4G7ZF 1M1EB 3H35A 4FKDA 5HVHA 5GPAA 1RFHA 2I8DA 2JZYA 1X58A 5JFRA 2ELJA 2H94A 1P2FA 1FTZA 2FE7A 3Q9SA 2V79A 4WK8F 1W5TA 2GKRI 2KMQA 1QQIA 4G6TB 1VI0A 2CO5A 1YTPA 2OUMA 4ZDOA 1T8IA 4ZY0A 4AMLA 2ERWA 5AG4A 4YFKF 1YJNI 3OYDA 2EUIA 3SDBA 4IHVA 2HV2A 3PB4X 2IJZA 3GLXA 2Z1DA 2A20A 4ZDLA 2ID3A 3ZZIA 2K4BA 3ABUA 4R79A 3GTPJ 3HDDA 4OVOA 3CDLA 3HHHA 1F5TA 4P6YA 3BHXA 2VI7A 1IN4A 1CPXA 3NQOA 3OYEA 2N71A 1SGYI 2AHQA 1LNWA 1YFHA 1HKSA 4IX7A 3BCBA 2OU2A 3S14J 5DTDA 3VPRA 3S2HJ 4FD7A 5CKTA 1IRGA 4XOTA 2M7BA 2HOEA 4BXUA 2AO9A 1DP3A 2DA4A 4L9TA 2CSOA 2N17A 1KONA 5FD5A 1X1BA 2GXGA 2DFFA 1X1PA 4YEJA 4H89A 4KSIA 3JREA 4NC7A 3ZMZA 4A31A 1MBHA 4I0BA 4HAMA 3S9NA 3A0HC 5HXDA 4PJJA 2R7ZJ 1P0HA 3BTJA 3OYAA 4X1EA 1M4GA 4YFJA 2BHZA 5K7FA 5FO5A 2ME6A 4LLLA 2L9SA 1I1GA 3ML6A 1AKHA 3H3VK 1ELMP 1OCCH 1J7KA 3NRVA 2WC2A 1TBXA 4PJNA 1Y1WJ 3EUKL 3CCRI 3I59B 2ZSIB 2HOTA 3S3OA 3IEHA 1RXTA 3D00A 3K1MA 5ICGA 2V9VA 1D8JA 3CMYA 4FX4A 1PDNC 3NA6A 3T8TA 4NGQA 2KDZA 3PFEA 2LR8A 3R0AA 1VQ6I 2MFZA 1MT1A 2P7CB 2CFXA 2QQBA 2HVSA 3ERED 4GYGA 1TBNA 2DEAA 1WJFA 2I10A 4CAWA 1KQ9A 5ISVA 4UXHA 2RV8A 2BUSA 1U6GA 4UVBA 3LA2A 3W6SA 5LHIA 1WHUA 4G6DA 4CRYB 4AIDA 1WJEA 2XAHA 2EV0A 3F0CA 1BIBA 4A3LJ 1ZRFA 4LQGA 2CGPA 1LR7A 4II2A 1QZEA 2FCKA 3KCCA 3L9FA 2PRBA 2XEFA 3KZZA 1OFCX 4XN3A 4HX8A 2QSHX 1XD7A 4XK4A 1PTQA 4HNTA 2QBYB 3OS2A 2QQ0A 2E19A 4NJQA 2DOAA 4EQQA 5FLMJ 3PJRA 2BV6A 5E1XA 4F55A 2HOSA 1HW5A 2GXAA 3ABLH 2IT0A 2E1MB 3CCLI 3DKYA 2F5VA 4BE1A 5KHDA 4CHUA 1G59A 3S17J 4OC5A 3RPQA 2IBDA 3K4KA 3KEOA 1UMQA 2B3VA 2LB7A 2ZCWA 3R60A 2M87A 3ZJ0A 2G7UA 5JR3A 2VL1A 4XLAA 4XQFA 4U88A 5J6XA 4I2OA 2XGCA 2Q8KA 2EILH 3FXTA 3CF2A 1ZR4A 4E70A 1MMGA 1X4PA 5E18F 2OD5A 2Y69H 3E6MA 1FTTA 4U9ZA 1HDDC 2F6CA 2CNTA 4OWRB 1GV5A 4NDLA 5GAGJ 2R7FA 2IGMA 4BS9A 4KMFA 4JYWA 1L0OC 4CGLA 3TEDA 1ZYRF 3MMYB 1LKXA 3V7CA 2XVCA 1BI0A 2L7XA 3ASOH 3GOXA 1I3AA 2B0UC 2YX4A 1PU9A 2I00A 2B5GB 1Z7UA 1BW6A 2NVUB 3PFYA 1V3FA 3BR5A 2ZB9A 1LR9A 1HDLA 2WA0A 2VKEA 4HQMA 2VN2A 4Y52J 1J5YA 5CCLA 4CGNA 3BZKA 3WGGA 5BPIA 1PJUA 2ZEFA 4WJBA 2O8KA 5L3BA 5H86A 1BIAA 1YHQI 1ENHA 4MFPA 2JVGA 4PCQA 1P4WA 3F8NA 2WCYA 1IGNA 1SMYF 4E7SA 3CLQA 3FSXA 3KY9A 4FE4A 2VXDA 3EO4A 2AFXA 2SGPI 4IAVA 5CPAA 3OXLA 4C2MJ 4KUBA 4ENJA 1YI2I 4V19K 1QSTA 3PB8X 4CAVA 3KE2A 2CTCA 2OA4A 2JMWA 2XF7A 4UV9A 3MKWB 1OYIA 2HZTA 1JE8A 2F4OB 1Y1VJ 5IY5H 4E2AA 5B1BH 1ON1A 2K5TA 1TQMA 5LGTA 4HEA2 2H1LA 3S93A 3TDUC 3HKZA 2JQ7A 1LVAA 3N7ZA 3IIBA 2VKVA 1NSLA 1WRJA 3CZ6A 3GZ5A 5E3QA 3L2WA 4J19A 2JW6A 3NAUA 1P7IA 1QGPA 3SEKC 4JBAA 3F21A 2Y9ZA 2G0BA 2L5QA 1FOWA 4A3MJ 4C2ZA 1PYVA 1XGOA 4UWIA 3PNTA 1VZ0A 3TBIA 2OH1A 3HUVA 3K69A 3OR2C 2NVTJ 5LD2C 2YUSA 1PUFB 2KT0A 4ZX8A 1R5HA 1V4RA 1LE8B 4Q38A 2A3SA 2X6OA 1LEBA 3OYBA 3T90A 2B4DB 4NGMA 3K2AA 1N78A 2ODFA 5LRRA 3OYJA 2GXBA 4KFCA 2Q4YA 3U21A 1Z05A 5E8IA 2NU3I 3PM1A 3OS1A 4HQEA 3RU0A 1Z9UA 4U87A 1BPMA 2PRQA 1NHAA 2IAIA 2VBYA 4AVZA 5DCMB 4KOXA 3G1MA 5FLXZ 5EBVA 3PNYA 2ESNA 2O0YA 5D5XB 4D1QA 1DS2I 2AXTC 2ROWA 2O3FA 2OQRA 5DUKA 2XGDA 1MK4A 4ANJA 3H5ZA 2Z5UA 4PUSA 2CYYA 4OLLA 3RCOA 3HRSA 1TWCJ 4M3DA 3U2RA 1YJ9I 1YQAA 3D66A 4XLFA 2Z99A 3TKYA 4DUKA 4BQOA 4UXJA 1S7AA 3AAFA 1UWYA 1X12A 3LOCA 2X1DA 3WE3A 5KAFC 1BI3A 1KYZA 1XCBA 1JT6A 1X1AA 3D3SA 1U5TB 2W00A 3KYDB 4ZDPA 5J1UA 3CCVI 2XAQA 3BI1A 2K9HA 1HKQA 4CYOA 4A24A 1X74A 3I4NJ 4JJXA 2Y31A 2ZFUA 3ZQGA 4Z6YA 3DKXA 4EM2A 3BJOA 4HSRA 4BBRJ 2BHYA 2CNSA 2ZJ2A 2GANA 2VE9A 3FEEA 4RBOA 4RUHA 1O57A 1XGNA 2YS9A 2JA8J 2PMZN 3I59A 2HVQA 4MFEA 1CGII 2ZEGA 4MHZA 1NXUA 4PFOA 3I3LA 1R1UA 4H4KC 2PJRB 4M3FA 1PJRA 2J5OA 5AIQA 3ZQHA 5FD6A 3FXJA 5M3MJ 4P4FA 1IU8A 5E3LA 2X4HA 2VPLA 2KCXA 5HNFA 1OKRA 1HJAI 4LLNA 2D4OA 4QPQA 2EB7A 2ZXIA 3I55I 2AFSA 4WF2A 4ZYHA 2R4GA 3IWGA 3PRTA 5GPCA 3SXNA 1X10A 1JKOC 5LLQA 1K7VA 3TO6A 1WH7A 5HDKA 3KP4A 1H89C 2UWMA 3BZCA 1XDSA 4FASD 2QJ8A 4P1WA 3KP3A 1YLEA 5A2QK 2LC2A 3G3SA 1YW8A 3FBNB 2DIPA 2GFQA 3EQLF 2KPMA 2V6EA 2DBBA 4CYQA 4QSHA 3BQYA 4UV8A 1LVKA 2KJBA 1JKPC 3SJEA 2M8GX 2M3AA 5HS9A 4S0HB 3ZMTA 1W1WE 3JRUA 4RI1A 2GIZA 1K61A 1B6BA 2PJ9A 3VSLA 2ZMEA 2BOLA 5IV0A 5LYDA 1QRYA 3FX3A 1D1CA 2DLLA 3A1YA 2XDVA 4PXCA 5F1JA 5E3RA 1H8AC 1IOIA 3ZN0A 4P4IA 5J40A 2J8NA 4B44A 9WGAA 3CDXA 2PJ0A 2YNCA 4E7LA 4KVOE 3DXJF 1RR7A 2F5DA 2HPIA 3B02A 4NC6A 2XROA 1FBUA 3OYCA 3CCYA 4YGOA 3RKXA 1QU3A 2XKOA 4MFLA 5KTDA 1T08B 3PEIA 3JSOA 2EV6A 4S05A 2V1NA 4KT6A 3BWGA 1OISA 1KU9A 4P9UA 2PJPA 1CG2A 3J80Z 2A5WA 1ZG3A 3IHUA 1RZ4A 2O7OA 4DBRA 2JVHA 2IS6A 2K3PA 5F0HA 4XSXF 4IEJA 4MCSA 3I56I 2FIAA 1ONVA 2STWA 2R7OA 4HW0A 3PIOF 4ZC3A 4C2TA 4KZTA 4Q4ZF 2PJ3A 3PSFA 2RIJA 2EVNA 3RI4A 1R4MB 1AMPA 2E2HJ 2ODDA 3TMOA 3KKWA 4EGYA 3KQXA 5IYBJ 2FL4A 4KIBA 5AIPA 4HV5A 5LBQA 2IS2A 1N77A 3JW4A 3DBLB 5FRMA 3QB8A 1OBRA 4MY3A 5D5UB 2HDCA 2X52A 4E7IA 3H5RA 2R7SA 2ZBKA 4NGRA 4F7ZA 4RMNA 4GS4A 1P4XA 3L2RA 1T2KA 1YMEA 1SGNI 5LHGA 1GV2A 4UY8I 1B87A 1ZG8A 2QZ8A 1Z21A 2DMNA 1F9NA 3BR3A 3MN2A 2P5VA 1TBQR 4HA8A 5L3FA 2SGDI 1ZG9A 2COBA 1DU0A 2NOGA 1ACIA 1XCVA 1F1ZA 1JUMA 3DBHB 4MBUA 3GIUA 1D0XA 1XGSA 3AG4H 1YGHA 4MRIA 2XAUA 1UVFA 1U8BA 4BINA 2PJ1A 2R5YB 4HG2A 3WG9A 3DCFA 1SD7A 2XAGA 3OWTA 3F3XA 3SEZA 1V55H 1DGWY 2VXKA 3DU5A 4F52A 1M4IA 5ICCA 2BO9A 4K2EA 3SEQA 1HDPA 4UEFA 3GFMA 1FBSA 2DA5A 3Q0UA 3CP8A 2Q0OA 2BE5F 1WGCA 2WY7Q 4IHTA 3QPLA 3TX8A 3OV8A 2KJCA 4L5EA 4PDKA 2IRFG 4OMYA 3FK6A 3SFZA 3S6HA 1KYWA 3C2GA 2XF5A 3KYLA 1LAPA 3H5NA 1K79A 1ZG7A 7CPAA 1DDNA 3GY9A 2V8DA 1R23A 5HS7A 2PN6A 3J81K 1VHOA 3AL0C 3TOAA 4M6VA 3MZHA 5HLTA 4XNHB 2VC1A 1NG6A 3BT9A 2RN7A 2E5ZA 4FT8A 4E6KG 3RAMA 3OIOA 2KKOA 3QAHA 4DOZA 4GCVA 3FMSA 2MC3A 3PUFA 1NK3P 1TBRR 5DS9A 2I79A 2E73A 2R7HA 2Z11A 4UCNA 2Q7SA 1LFPA 3CJTB 1YJWI 2DYRH 2XSJC 4OIRF 2FT0A 1Z7LA 2HQNA 4U5YA 4PXDA 2DFIA 3EUHC 2HPMA 1K83J 5LYIA 1KQ0A 1XSVA 1CPSA 3DQVC 4DBQA 2XGXA 2CH0A 3OVOA 5K8MA 1WJAA 4IHSA 1M8CA 2ENNA 4OIOF 3D7HA 1B1BA 5EZGA 4O5VA 4M6XA 2GKVA 4BJTA 3E1SA 4OOIA 3I3GA 2DT7B 3VSKA 1BL0A 2DA3A 3DWLE 3H9QA 2IS1A 3UOEA 2OB0A 4MGRA 1J0RA 4B5OA 2M4GA 4XN0A 2LBFA 5HLHA 3CD6I 3VDUA 2HTSA 3HRTA 1ZK8A 3BG7A 4B09A 2AFMA 2ZKZA 2ZENA 2DW4A 4UEEA 1YU6C 3OXFA 1IUFA 1VQPI 3B2YA 3W6XA 1T0FA 1G3SA 5FKOA 5I4MA 4P10A 3KP6A 5F47A 2UXXA 3FHZA 3S2WA 4LQ6A 1IV8A 2X1EA 2V1DA 3B6CA 1QQ9A 4MHNA 4XBFA 5ERIA 1HLVA 4ZYQA 3X2QH 5DV5A 4B14A 3E0JB 1Z0XA 3QWLA 1HA8A 3ZMVA 2DK5A 1VFCA 3FM3A 4JWPA 4B6ZA 1Q2DA 1B59A 3W2VA 2LNBA 1QPMA 2JRMA 2QVPA 3ZQFA 2M30A 3IWFA 3R4KA 1BAVA 1ZGAA 3DLAA 3P9KA 1IV6A 4KNYA 4UFVA 2RDPA 3DR6A 3NE8A 2CWGA 1CT4I 2R7DA 1WFXA 3K6GA 3KPHA 2JJ7A 3C3WA 2UZ3A 1PCAA 2AFZA 2D1HA 5JI6A 3OWCA 2ZW4A 1G3TA 4XLEA 3F6OA 2C6CA 3L2UA 3OIQA 4A94A 1PVEA 3LNQA 1A6QA 3MZYA 2F3CI 3EC4A 1P9ZA 4ETSA 2WAQA 2FQ3A 3E6DA 3CF5F 2L9RA 3FKJA 2K86A 4BD9A 4KLVA 4RAYA 4IO9F 3HM5A 4A0XA 4AYBA 3VOEA 3JAMK 2REFA 3SGBI 2ELKA 3T0YA 3MCZA 1OQYA 1IY5A 1V1IA 1TF8A 3VE5A 3D5SC 4OMZA 1YO5C 2L7ZA 4UXNA 3CCUI 1F2OA 4LLGF 3PDNA 4ON0A 3L2VA 3R5BA 3FISA 4F9UA 3BLNA 1LB2A 2HXIA 4Q36A 3N4MA 2M45A 1E3OC 4CAEA 3BJ8A 3H1CA 2ATRA 4BBHA 4IL6C 4XNFA 5IYCJ 5LHHA 1TGSI 3D7DA 3RDIA 3ZCOA 1CBXA 1TKJA 4R8FA 3UEJA 1YG2A 5HQ8A 1A31A 3FSYA 1CX8A 2GLFA 4XRSA 3OYMA 1LQ1A 4WCGA 1M1DA 1XMXA 4D5FA 4OIQF 4AG7A 4IK2A 2YX7A 1FSEA 4YIIA 2H6BA 4QC6A 1ULMA 4LMYA 2VOPA 5ED4A 3CC4I 3ECHA 3JRIA 4RLQA 2L7FP 3K0LA 1MMDA 3ROUA 4ZZLA 1B72B 4MEYF 4X6AJ 2ARHA 2KFDA 1VQ4I 3MRUA 2NVXJ 2BZTA 1DUXC 3L7WA 1R4NB 2M0MA 4R3KA 4LX9A 3FXLA 3LSPA 3F22A 1Z67A 3EFAA 4AB7A 2IPQX 3HZJA 1Y1CA 3A01A 4HV6A 2WSAA 2DMPA 1NK2P 2JA7J 3F5BA 3H36A 3K1NA 4G12A 2JXDA 2DOEA 3V8JA 4DIQA 1S8NA 4LB6B 5M3FJ 2F2EA 2XASA 3ZRGA 2R7XA 2M7AA 4A69C 1QPIA 3FH4A 5HVGA 1NTCA 2G9WA 4CO8A 4FX0A 2R5ZA 3CO6C 4LUAA 2IW5A 3OYNA 4BQQA 4XPDB 2DPUA 2YUUA 3EUAA 1B4AA 4YWYA 1DQUA 2MW8A 3A02A 4AVCA 5CVUA 2FMYA 2FUG2 1VQMI 4MEXF 3CPXA 4L0YB 2P5LC 3UFFA 4CAFA 3RKYA 1TW3A 4BHCA 1TC3C 2OR4A 3ISZA 3E2IA 4LGWA 2LFBA 3I9SA 3HOXJ 2MGQA 1A2ZA 2STTA 3OL4A 5GAHJ 1IGBA 1Z8XA 2KQRA 2KCWA 5D4SA 3IH4A 1H0ZA 2QYOA 3M1EA 2EWBA 1ZGJA 2GBYA 2FOWA 4RGSA 1DP7P 5FGMA 2R92J 2P4WA 3GFIA 4M73A 1MGTA 4MPIA 1KGSA 4X8IA 3RSNA 3BQZA 4NGTA 3VFZA 1CF7A 1VIXA 2QGUA 2VBZA 4AVPA 2JA5J 2PFBA 4E7JA 5D8LB 2FVGA 4M3BA 3UR3C 5IP6A 1W36C 2GWRA 1TUSA 3BG9A 1WGXA 4N9IA 5DWMA 1KUVA 3TTHA 4ZYAA 3EDPA 3Q9VA 1XFOA 2HTJA 4BDYA 1V5EA 3IO1A 3D67A 3RJPA 1QSMA 2Q0YA 1POGA 1X2MA 4EM1A 2E35A 4Y7NJ 3O2PE 1JTXA 1SFEA 1TQIA 1JUPA 1X3ZB 5CVVA 4IQ4A 2JEVA 3KI9A 2MLGA 4JD6A 2IVMA 4BL0B 2LEOA 1JI8A 2PR8A 4BYYA 5H6QA 4EMSA 5GTIC 2NYXA 2XGEA 4RS8A 4U7BA 2ANPA 2HDDA 2SGEI 2DOFA 4M6GA 1C0WA 4Y33A 2X9DA 3L2QA 1MNEA 3NWSA 4GXOA 4KISA 1I12A 2OCEA 2W82A 4EJTA 1XBUA 3GYAA 2FJ1A 3N5FA 3KEYA 3AG2H 1Y8FA 1Z1DA 2DT5A 2P8TA 3P5JA 4U9YA 2Z3PA 4A3DJ 2WTEA 1I50J 1NE9A 2HGCA 2MYSA 1ON0A 1IY6A 5K7ZA 2WPXA 1TLHB 2K4JA 4BQAA 3VATA 4HNWB 4H2KA 4UCMA 2OTLI 2F4IA 3L1PA 2L2OA 2MH9A 2IGNA 1CP6A 1LJ9A 3ULQB 1BO4A 1MNDA 2KZGA 1AOYA 2QM3A 2CF4A 3JUWA 4KOWA 4B12A 2LY1A 3DBRB 3UKGA 1AU7A 3MGDA 4DZJA 2V53A 3IU1A 4IUSA 5C44J 1JWQA 4PJMA 2W57A 1EA3A 2CTBA 2LY2A 2ZFWA 2KIQA 1AA7A 4CZCA 1BW5A 1T6SA 3F9KA 1TNSA 2HEOA 2QYVA 3WU1B 3OSGA 2E7WA 3FMRA 2IGOA 1HF0A 2B63J 2PJAA 2HR3A 3CTAA 3ZN1A 3FRMA 1SGDI 4RM2A 4Q47A 1W4MA 3HKZN 1XN7A 5CYVA 1ITYA 4JLYA 2VASA 2Y9YA 2V1XA 5DM7F 2PJ2A 3LAPA 2Y0MA 5FKKA 1WZ2A 2QLZA 2FX0A 2VJJA 3R61A 3PFIA 5F04A 4DYQA 5IT3A 4FE7A 1YQEA 1NSAA 5CQEA 2NU0I 1XX6A 4RS2A 3ECOA 2ZJRF 1SGQI 4BU2A 1DS3I 3FHNA 1YK3A 4A5NA 3JR9A 1IN6A 4A93J 1OMTA 4A95A 1VQNI 1D1AA 3CMMA 1BJAA 3GW2A 4PV6A 3QYFA 3W2AA 3GTLJ 2VQHA 2XEGA 5HVFA 1WCMJ 2Z16A 2ZXVA 1L0CA 3SJXA 2YU9J 1WH5A 1EH6A 4XRSG 1OYWA 3AKZA 3E5UA 1RTQA 3T5XA 3LMSA 1OR7C 4MHPA 1W7PD 1MMNA 4HKFA 4RDUA 3TP0A 2K5CA 3K7AJ 4JZ0A 5FKLA 2OZUA 3SXOA 1HSJA 2DKVA 2D1VA 1WKXA 2FEZA 5GP9A 1R5GA 4ZTFA 4GGGA 5DYMA 3CMAI 3F8MA 5E8GA 3MKZA 1B72A 4HF1A 4M9ZA 2Z3NA 5L3DA 2ZXJA 1IDYA 2LD5A 1LAMA 4W9YA 2DFEA 1VNDA 2DCEA 3ISPA 4L0ZB 1TKFA 2A69F 4FD5A 1SFXA 4X2TA 3NWTA 3SI2A 5I0CA 2P5KA 2XRLA 2FBKA 1UHMA 2FNAA 4BJ6C 1U0JA 2ORWA 5EX0A 1YW6A 2JEWA 4QTRA 2Z3OA 1K4SA 2PVWA 3IC1A 2FMLA 4OIPF 2CG4A 3WHCA 4L18B 1O3SA 3A2KA 4RA2A 3TP3A 2VBQA 5HVQC 3H92A 4Z65A 2WUUA 1YW7A 3FB3A 1S72I 2DTRA 1A35A 1O7FA 1W0UA 2V8HA 2QKLB 2ZMEB 3BTIA 3CUQC 3OOPA 4MIMA 2L54A 2KL4A 2GLOA 1IRFA 2ARPF 5FUYA 3H5AA 2ID6A 2XIGA 4AXVA 3WC6A 4A3GJ 1ZKGA 3IJ3A 1OCTC 3CXPA 1IW7F 1FBQA 3A03A 2AXLA 5B5EC 1H88C 1JT0A 5DD4A 1XMTA 1GXQA 5CNPA 3K4JA 4J01A 4X5KA 1IICA 3D5LA 3F6VA 5BMZA 2MBFA 4CCMA 1Y56A 2HZDA 2PIZA 3JTGA 4MHDA 2O8XA 1RKWA 4P96A 3P9IA 3IWEA 2BW3A 2EZKA 1AYEA 2A6EF 1FAQA 3JRFA 2W48A 1ZG1A 3D68A 4II3A 3QNVA 3HPHA 4NC8A 2L4AA 2E71A 2GKTI 4Y4RA 4OC3A 1JKRC 1RPWA 3B3CA 5DM6F 5E1ZB 2QSFX 2EZIA 1BLLE 3E97A 4U0VA 1E17A 3FIWA 4PXEA 3P9CA 2CW0F 3TE4A 5DEQA 2XPVA 4BBSJ 1XOVA 1P9QC 4O6JA 3RKWA 5K1YA 3GB0A 2F8HA 4B3XA 2O53A 4HBLA 3ZQ7A 2JUCA 1ZG5A 4B47A 2CQNA 2KRCA 3BJIA 3CC2I 4R3LA 1Q1VA 3M1CA 2Z10A 3FEDA 1CQTA 4HYEA 3VEPA 4F9VA 1PYTB 1TQPA 1SQHA 4KVXA 4CSWA 1TTYA 1IYLA 4F3QA 3SYTA 3RYOA 4UVCA 5ILSA 3SHFA 5LRKA 1KU7A 2HC9A 3HOTA 1VF9A 4MCRA 3LSTA 1NH3A 3PZJA 2KRHA 3WTZA 2X6WA 2KRFA 2NVYJ
chains in the Genus database with same CATH topology
3G8WA 2FF4A 4QB9A 1I21A 4QBJA 1OZPA 5KTAA 3BJ6A 3M7GA 4K30A 3WTYC 4KOSA 1XEBA 1HSTA 4G7OF 4M72A 2Z0ZA 2FBIA 1LDDA 4CYNA 5HMNA 2LF8A 2OQGA 4QLCU 2EFPA 2IP2A 1ON2A 3I4PA 4M9SA 1PUEE 4MFZA 3S6FA 2B58A 2IJLA 4M74A 4IJAA 4MHGA 1MDMA 2R98A 2AJ6A 4Y49C 4PGHA 2JLMA 2O03A 4HX7A 3GWZA 4RB0A 1XSXA 1XMKA 4XLNF 4U7DA 3DR8A 1EH7A 1LDJA 4JK1X 4KS9A 1QSNA 1OYYA 2AE6A 4MFJA 2HYFA 4LK0F 4AD9A 2EFQA 2EFOA 5HS8A 2VC0A 1Q1HA 3DDDA 4OU0A 2L02A 3R95A 1S6LA 4E8OA 4OINF 2COMA 4RGXA 5BS6A 4QVTA 3LQQA 5F64A 4LG0A 4CGMA 1VHSA 2YGWA 3PQJA 1HQCA 1KA8A 4KOVA 1HXDA 4UNOA 4A2ZA 1DPRA 5F49A 2QIRA 3GVAA 3PQKA 3LODA 4WWCA 1ZH5A 4AVAA 3U9GA 4KOTA 4MTDA 1P4AA 3R1KA 3M9AA 3WTXC 1UFMA 4Q5SF 3BROA 1LDKB 2H5MA 2FBHA 4MQ9F 1S60A 2F5IA 5H6RA 2MH2A 4IF4A 5K5OA 1BBYA 2NNYA 1YR0A 4KN4X 3B73A 4KIGA 3D8PA 1R00A 5JHUA 3J80K 2FRHA 3GEZA 3E5XA 4A33A 2P6TA 3ZPLA 5F48A 4ESJA 1O3RA 4I02A 1S7KA 1JXSA 1HBXG 4UVAA 1YVKA 4L9JA 1R58A 1S3JA 2BSWA 3IWZA 2JDDA 3W91A 2K27A 2W24A 3I0TA 3E6CC 5JVTA 1USSA 5DUIA 4CS0B 1KQ8A 3VB2A 3WTTC 1RUNA 1S29A 3TFYA 2O28A 2XKPA 3HSEA 3I5UA 1AWCA 2QUFA 3WR7A 4P9FA 4CYDA 3QP6A 2TDXA 1Y9WA 5LGUA 4P5OA 3MAJA 4A32A 1USTA 3QPTA 1IF1A 3HUGA 3HRUA 4C7IA 1FC3A 2DK8A 2ISYA 1R1VA 2EV5A 1J75A 1S7OA 5HLIA 3RPUA 2VZYA 2VBXA 4RB2C 2ZO4A 3IC7A 4HDUA 3HHGA 1BN5A 3R0JA 4G94A 4R87A 5LGNA 4LB5A 4ZYEA 3CDHA 5G1ZA 2GA1A 1XMAA 4UHTA 3DFGA 2DAOA 1U3EM 1ODDA 4CDGA 1YYVA 4ZYGA 3V7SA 1ULYA