2FNFX

C1 domain of nore1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GTP-Ras disrupts the intramolecular complex of C1 and RA domains of Nore1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords putative Ras Effector Nore1
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2fnfX01
1W4RA 3CXLA 2QQ0A 1PTRA 3E2IA 5FUYA 2ROWA 2YUUA 4UXIA 2QPOA 2UZ3A 5FUWA 2GVIA 2J87A 2QQEA 3KY9A 4L9MA 5FUXA 4UXHA 2JA1A 2B8TA 2FNFX 2ORWA 1XBTA 3UGDA 1KBFA 1RFHA 2VRWB 2J9RA 3UFFA 2ENZA 3UGIA 3UGLA 2E73A 3BJIA 1PTQA 1XA6A 3UEYA 1TBNA 1KBEA 2ORVA 4FKDA 1FARA 1XX6A 4B6DA 1TBOA 1FAQA 5FUVA 1Y8FA 4UXJA 2WVJA 2DB6A 2ENNA 2ELIA 3UEJA 1R79A
chains in the Genus database with same CATH superfamily
3B4VC 1CSOI 1X4SA 2PQ8A 2QPOA 5FUWA 1PCEA 2J87A 3KY9A 9WGAA 1P9ZA 2B8TA 3PDNA 2CJSC 1XBTA 1Y1CA 3TO7A 3UGDA 2VRWB 3QTLD 1MT1A 1LR9A 2NU4I 1S20A 2UVOA 2ENZA 1V1HA 2RIJA 1MJAA 2E73A 1HEVA 3TJQA 1OVOA 3UEYA 1LR8A 4E1RA 2WGCA 2CWHA 2QQDA 1SGRI 2X52A 2Y0MA 4FKDA 1OMUA 2F3CI 2V53A 2KMQA 4B6DA 2SGQI 1TBOA 2GKTI 1IY6A 2B0UC 2ARPF 2ERWA 2N1AB 4WP4A 2WVJA 1OYVI 4A24A 3SGQI 1WKXA 3VDUA 2NU2I 1TGSI 2JW6A 2RC4A 1YU6C 1Z2IA 5FUYA 2SGPI 4SGBI 1CT4I 2YUUA 4UXIA 4JCVE 1WGTA 4HGUA 5EX0A 2LEOA 1Y1BA 3FSYA 2N52A 1LR7A 1U5KA 1ULMA 2GVIA 2KCXA 1CT2I 1TIHA 4L9MA 4UXHA 2L7XA 4OVOA 3VDPA 2V1CA 2NU3I 1NUBA 1UVGA 3TOAA 2GKRI 2N71A 3TO6A 7WGAA 1K7VA 4AMLA 1X74A 1CGJI 5E3RA 1UHAA 3UFFA 1HPTA 1PTQA 3OL0A 1ULNA 2SGEI 1BMOA 1KBEA 2ORVA 5HQ8A 3OXLA 2CWGA 3TO9A 2QQCA 3HH2C 3SEKC 2DIPA 1Q9BA 1Y8FA 2GKVA 5J8FA 4DNCA 1MJBA 1SGDI 2WCYA 4GI3C 3D00A 1SGNI 4MPIA 2XRCA 3R5AA 2KMOA 2YQPA 4E1PA 1FY7A 1UUCA 2SGFI 1K7TA 3E2IA 1IY5A 2A20A 1OMTA 1TURA 2ROWA 2UZ3A 3GOXA 2P6AC 1CE3A 3E59A 1H0ZA 1VDDA 5FUXA 3VE5A 5E3QA 2ODDA 2LUYA 5E3PA 3RU0A 2E5RA 3OXFA 1KBFA 2KMRA 1RFHA 3QWPA 1WGCA 2M5XA 2OZUA 1MJ9A 2OU2A 2SGDI 5DAEA 3UGLA 3QAHA 1PPFI 5CCLA 1XA6A 2KMPA 1TBNA 1ULKA 2JYYA 3OXGA 1P9GA 5EX3A 1XX6A 1CGII 1IW4A 2NU1I 3OVOA 3SGBI 2N17A 3MEKA 5FUVA 2GIVA 1K7UA 1SGPI 1TBQR 2DB6A 2ELIA 2L8EA 2V1CC 5HI7A 3FC3A 2BUSA 1BUSA 1W4RA 1W3SA 3CXLA 1HJAI 1PTRA 2QQ0A 3TOBA 5JHWC 3R5CA 1NXUA 2DKVA 1PJUA 1TOTA 2X3TA 1DS3I 2OVOA 2JXDA 1TBRR 2QQEA 1TUSA 1M8BA 1SGQI 2JA1A 2FNFX 3UOEA 2ORWA 2OD1A 3R5DA 1HDLA 3FSXA 2CWFA 1M8CA 1FYBA 2J9RA 1UVFA 2LB7A 1SGYI 2JZMA 1WTJA 3UGIA 1DS2I 3BJIA 5CCMA 1Z7KB 2NU0I 5J8CA 1YTPA 1KMAA 1AN1I 1N13A 1FARA 3R5BA 1V1IA 1R0RI 1SGEI 2W0TA 1FAQA 4UXJA 2K9HA 3UEJA 2ENNA 1CT0I 1R79A 1CHOI
chains in the Genus database with same CATH topology
3B4VC 1CSOI 1X4SA 2QPOA 5FUWA 1PCEA 2J87A 3KY9A 2B8TA 3PDNA 2CJSC 1XBTA 1Y1CA 3UGDA 2VRWB 3QTLD 1MT1A 1LR9A 2NU4I 2ENZA 1V1HA 2E73A 3TJQA 1OVOA 3UEYA 1LR8A 4E1RA 2QQDA 1SGRI 4FKDA 1OMUA 2F3CI 2V53A 2KMQA 4B6DA 2SGQI 1TBOA 2GKTI 1IY6A 2B0UC 2ARPF 2ERWA 2N1AB 4A24A 2WVJA 1OYVI 3SGQI 3VDUA 2NU2I 1TGSI 2JW6A 1YU6C 5FUYA 2SGPI 4SGBI 1CT4I 2YUUA 4UXIA 4JCVE 4HGUA 5EX0A 2LEOA 1Y1BA 4E1PA 2N52A 1LR7A 1U5KA 2GVIA 2KCXA 4L9MA 1CT2I 1TIHA 4UXHA 2L7XA 4OVOA 3VDPA 2V1CA 2NU3I 1NUBA 1UVGA 2GKRI 2N71A 1X74A 1CGJI 3UFFA 1HPTA 1PTQA 3OL0A 2SGEI 1BMOA 1KBEA 2ORVA 5HQ8A 3OXLA 2QQCA 3HH2C 3SEKC 2DIPA 1Y8FA 2GKVA 2WCYA 1SGDI 4GI3C 3D00A 1SGNI 2XRCA 2KMOA 2YQPA 1UUCA 2SGFI 3E2IA 1IY5A 2A20A 1OMTA 1TURA 2ROWA 2UZ3A 3GOXA 2P6AC 1CE3A 3E59A 1H0ZA 1VDDA 5FUXA 3VE5A 2ODDA 2LUYA 3RU0A 2E5RA 3OXFA 1KBFA 2KMRA 1RFHA 3QWPA 2M5XA 2SGDI 5DAEA 3UGLA 1PPFI 5CCLA 1XA6A 2KMPA 1TBNA 2JYYA 3OXGA 5EX3A 1XX6A 1CGII 1IW4A 2NU1I 3OVOA 3SGBI 2N17A 3MEKA 5FUVA 1SGPI 1TBQR 2DB6A 2ELIA 2L8EA 2V1CC 5HI7A 3FC3A 2BUSA 1BUSA 1W4RA 1W3SA 3CXLA 1HJAI 1PTRA 2QQ0A 5JHWC 1PJUA 1TOTA 1DS3I 2OVOA 2JXDA 1TBRR 2QQEA 1TUSA 1M8BA 1SGQI 2JA1A 2FNFX 1HDLA 2ORWA 2OD1A 1FYBA 1M8CA 2J9RA 1UVFA 1SGYI 2JZMA 3UGIA 1DS2I 3BJIA 5CCMA 1Z7KB 2NU0I 1YTPA 1KMAA 1AN1I 1N13A 1FARA 1V1IA 1R0RI 1SGEI 2W0TA 1FAQA 4UXJA 2K9HA 3UEJA 2ENNA 1CT0I 1R79A 1CHOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4R A;  3CXL A;  2QQ0 A;  1PTR A;  3E2I A;  5FUY A;  2ROW A;  2YUU A;  4UXI A;  2QPO A;  2UZ3 A;  5FUW A;  2GVI A;  2J87 A;  2QQE A;  3KY9 A;  4L9M A;  5FUX A;  4UXH A;  2JA1 A;  2B8T A;  2FNF X;  2ORW A;  1XBT A;  3UGD A;  1KBF A;  1RFH A;  2VRW B;  2J9R A;  3UFF A;  2ENZ A;  3UGI A;  3UGL A;  2E73 A;  3BJI A;  1PTQ A;  1XA6 A;  3UEY A;  1TBN A;  1KBE A;  2ORV A;  4FKD A;  1FAR A;  1XX6 A;  4B6D A;  1TBO A;  1FAQ A;  5FUV A;  1Y8F A;  4UXJ A;  2WVJ A;  2DB6 A;  2ENN A;  2ELI A;  3UEJ A;  1R79 A; 
#chains in the Genus database with same CATH topology
 3B4V C;  1CSO I;  1X4S A;  2PQ8 A;  2QPO A;  5FUW A;  1PCE A;  2J87 A;  3KY9 A;  9WGA A;  1P9Z A;  2B8T A;  3PDN A;  2CJS C;  1XBT A;  1Y1C A;  3TO7 A;  3UGD A;  2VRW B;  3QTL D;  1MT1 A;  1LR9 A;  2NU4 I;  1S20 A;  2UVO A;  2ENZ A;  1V1H A;  2RIJ A;  1MJA A;  2E73 A;  1HEV A;  3TJQ A;  1OVO A;  3UEY A;  1LR8 A;  4E1R A;  2WGC A;  2CWH A;  2QQD A;  1SGR I;  2X52 A;  2Y0M A;  4FKD A;  1OMU A;  2F3C I;  2V53 A;  2KMQ A;  4B6D A;  2SGQ I;  1TBO A;  2GKT I;  1IY6 A;  2B0U C;  2ARP F;  2ERW A;  2N1A B;  4WP4 A;  2WVJ A;  1OYV I;  4A24 A;  3SGQ I;  1WKX A;  3VDU A;  2NU2 I;  1TGS I;  2JW6 A;  2RC4 A;  1YU6 C;  1Z2I A;  5FUY A;  2SGP I;  4SGB I;  1CT4 I;  2YUU A;  4UXI A;  4JCV E;  1WGT A;  4HGU A;  5EX0 A;  2LEO A;  1Y1B A;  3FSY A;  2N52 A;  1LR7 A;  1U5K A;  1ULM A;  2GVI A;  2KCX A;  1CT2 I;  1TIH A;  4L9M A;  4UXH A;  2L7X A;  4OVO A;  3VDP A;  2V1C A;  2NU3 I;  1NUB A;  1UVG A;  3TOA A;  2GKR I;  2N71 A;  3TO6 A;  7WGA A;  1K7V A;  4AML A;  1X74 A;  1CGJ I;  5E3R A;  1UHA A;  3UFF A;  1HPT A;  1PTQ A;  3OL0 A;  1ULN A;  2SGE I;  1BMO A;  1KBE A;  2ORV A;  5HQ8 A;  3OXL A;  2CWG A;  3TO9 A;  2QQC A;  3HH2 C;  3SEK C;  2DIP A;  1Q9B A;  1Y8F A;  2GKV A;  5J8F A;  4DNC A;  1MJB A;  1SGD I;  2WCY A;  4GI3 C;  3D00 A;  1SGN I;  4MPI A;  2XRC A;  3R5A A;  2KMO A;  2YQP A;  4E1P A;  1FY7 A;  1UUC A;  2SGF I;  1K7T A;  3E2I A;  1IY5 A;  2A20 A;  1OMT A;  1TUR A;  2ROW A;  2UZ3 A;  3GOX A;  2P6A C;  1CE3 A;  3E59 A;  1H0Z A;  1VDD A;  5FUX A;  3VE5 A;  5E3Q A;  2ODD A;  2LUY A;  5E3P A;  3RU0 A;  2E5R A;  3OXF A;  1KBF A;  2KMR A;  1RFH A;  3QWP A;  1WGC A;  2M5X A;  2OZU A;  1MJ9 A;  2OU2 A;  2SGD I;  5DAE A;  3UGL A;  3QAH A;  1PPF I;  5CCL A;  1XA6 A;  2KMP A;  1TBN A;  1ULK A;  2JYY A;  3OXG A;  1P9G A;  5EX3 A;  1XX6 A;  1CGI I;  1IW4 A;  2NU1 I;  3OVO A;  3SGB I;  2N17 A;  3MEK A;  5FUV A;  2GIV A;  1K7U A;  1SGP I;  1TBQ R;  2DB6 A;  2ELI A;  2L8E A;  2V1C C;  5HI7 A;  3FC3 A;  2BUS A;  1BUS A;  1W4R A;  1W3S A;  3CXL A;  1HJA I;  1PTR A;  2QQ0 A;  3TOB A;  5JHW C;  3R5C A;  1NXU A;  2DKV A;  1PJU A;  1TOT A;  2X3T A;  1DS3 I;  2OVO A;  2JXD A;  1TBR R;  2QQE A;  1TUS A;  1M8B A;  1SGQ I;  2JA1 A;  2FNF X;  3UOE A;  2ORW A;  2OD1 A;  3R5D A;  1HDL A;  3FSX A;  2CWF A;  1M8C A;  1FYB A;  2J9R A;  1UVF A;  2LB7 A;  1SGY I;  2JZM A;  1WTJ A;  3UGI A;  1DS2 I;  3BJI A;  5CCM A;  1Z7K B;  2NU0 I;  5J8C A;  1YTP A;  1KMA A;  1AN1 I;  1N13 A;  1FAR A;  3R5B A;  1V1I A;  1R0R I;  1SGE I;  2W0T A;  1FAQ A;  4UXJ A;  2K9H A;  3UEJ A;  2ENN A;  1CT0 I;  1R79 A;  1CHO I; 
#chains in the Genus database with same CATH homology
 3B4V C;  1CSO I;  1X4S A;  2QPO A;  5FUW A;  1PCE A;  2J87 A;  3KY9 A;  2B8T A;  3PDN A;  2CJS C;  1XBT A;  1Y1C A;  3UGD A;  2VRW B;  3QTL D;  1MT1 A;  1LR9 A;  2NU4 I;  2ENZ A;  1V1H A;  2E73 A;  3TJQ A;  1OVO A;  3UEY A;  1LR8 A;  4E1R A;  2QQD A;  1SGR I;  4FKD A;  1OMU A;  2F3C I;  2V53 A;  2KMQ A;  4B6D A;  2SGQ I;  1TBO A;  2GKT I;  1IY6 A;  2B0U C;  2ARP F;  2ERW A;  2N1A B;  4A24 A;  2WVJ A;  1OYV I;  3SGQ I;  3VDU A;  2NU2 I;  1TGS I;  2JW6 A;  1YU6 C;  5FUY A;  2SGP I;  4SGB I;  1CT4 I;  2YUU A;  4UXI A;  4JCV E;  4HGU A;  5EX0 A;  2LEO A;  1Y1B A;  4E1P A;  2N52 A;  1LR7 A;  1U5K A;  2GVI A;  2KCX A;  4L9M A;  1CT2 I;  1TIH A;  4UXH A;  2L7X A;  4OVO A;  3VDP A;  2V1C A;  2NU3 I;  1NUB A;  1UVG A;  2GKR I;  2N71 A;  1X74 A;  1CGJ I;  3UFF A;  1HPT A;  1PTQ A;  3OL0 A;  2SGE I;  1BMO A;  1KBE A;  2ORV A;  5HQ8 A;  3OXL A;  2QQC A;  3HH2 C;  3SEK C;  2DIP A;  1Y8F A;  2GKV A;  2WCY A;  1SGD I;  4GI3 C;  3D00 A;  1SGN I;  2XRC A;  2KMO A;  2YQP A;  1UUC A;  2SGF I;  3E2I A;  1IY5 A;  2A20 A;  1OMT A;  1TUR A;  2ROW A;  2UZ3 A;  3GOX A;  2P6A C;  1CE3 A;  3E59 A;  1H0Z A;  1VDD A;  5FUX A;  3VE5 A;  2ODD A;  2LUY A;  3RU0 A;  2E5R A;  3OXF A;  1KBF A;  2KMR A;  1RFH A;  3QWP A;  2M5X A;  2SGD I;  5DAE A;  3UGL A;  1PPF I;  5CCL A;  1XA6 A;  2KMP A;  1TBN A;  2JYY A;  3OXG A;  5EX3 A;  1XX6 A;  1CGI I;  1IW4 A;  2NU1 I;  3OVO A;  3SGB I;  2N17 A;  3MEK A;  5FUV A;  1SGP I;  1TBQ R;  2DB6 A;  2ELI A;  2L8E A;  2V1C C;  5HI7 A;  3FC3 A;  2BUS A;  1BUS A;  1W4R A;  1W3S A;  3CXL A;  1HJA I;  1PTR A;  2QQ0 A;  5JHW C;  1PJU A;  1TOT A;  1DS3 I;  2OVO A;  2JXD A;  1TBR R;  2QQE A;  1TUS A;  1M8B A;  1SGQ I;  2JA1 A;  2FNF X;  1HDL A;  2ORW A;  2OD1 A;  1FYB A;  1M8C A;  2J9R A;  1UVF A;  1SGY I;  2JZM A;  3UGI A;  1DS2 I;  3BJI A;  5CCM A;  1Z7K B;  2NU0 I;  1YTP A;  1KMA A;  1AN1 I;  1N13 A;  1FAR A;  1V1I A;  1R0R I;  1SGE I;  2W0T A;  1FAQ A;  4UXJ A;  2K9H A;  3UEJ A;  2ENN A;  1CT0 I;  1R79 A;  1CHO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...