2FNFX

C1 domain of nore1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords putative Ras Effector Nore1
publication title GTP-Ras disrupts the intramolecular complex of C1 and RA domains of Nore1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2fnfX01
5FUWA 4UXJA 2GVIA 1XBTA 2E73A 5FUVA 3E2IA 4UXIA 1FARA 2WVJA 4UXHA 1KBEA 3UGDA 2DB6A 1PTQA 2VRWB 1FAQA 2QQ0A 3UEJA 2J87A 3UEYA 2FNFX 3UGLA 2QPOA 1RFHA 1Y8FA 2ORVA 1XX6A 1TBNA 3UGIA 2ORWA 4FKDA 1PTRA 1R79A 2JA1A 4L9MA 2ENNA 2B8TA 1W4RA 1XA6A 2UZ3A 3KY9A 2J9RA 3UFFA 5FUXA 1KBFA 2YUUA 2QQEA 4B6DA 3CXLA 2ROWA 5FUYA 3BJIA 1TBOA 2ENZA 2ELIA
chains in the Genus database with same CATH superfamily
1U5KA 4GI3C 2PQ8A 5FUVA 2KMRA 2N71A 1X4SA 1M8BA 1FY7A 3OL0A 1UHAA 1MJ9A 1DS3I 4UXIA 1FARA 1MJBA 3PDNA 1KBEA 4UXHA 2N17A 3R5BA 3OVOA 1FAQA 1LR7A 1SGPI 2QQ0A 1BMOA 2J87A 3UEYA 2UVOA 1SGRI 3VDUA 5J8CA 2QQDA 1XX6A 2X52A 1SGQI 1SGEI 1AN1I 1K7UA 2NU0I 1CE3A 2B0UC 2OD1A 2A20A 2BUSA 3MEKA 2GIVA 2B8TA 1ULKA 4MPIA 2KMOA 1WGCA 5FUXA 1KBFA 3VE5A 1M8CA 2OU2A 1CGII 3GOXA 4E1PA 1HJAI 3R5DA 2GVIA 2E73A 2KMPA 5E3QA 3VDPA 1CT2I 2ERWA 2WCYA 1R0RI 1H0ZA 1OVOA 1MJAA 2KMQA 1OMTA 2DKVA 3TOBA 1TBQR 1S20A 1PTQA 2W0TA 3R5AA 1TUSA 2RIJA 1Z2IA 5HI7A 4DNCA 3OXGA 1N13A 1TIHA 3D00A 4JCVE 1TGSI 1YU6C 1RFHA 2ORVA 2V1CA 3UGIA 1TBNA 2LUYA 2ORWA 3E59A 4A24A 4AMLA 3OXLA 4FKDA 1UVFA 1R79A 2CWHA 1CHOI 1HPTA 4L9MA 1IY5A 2V1CC 1KMAA 1Y1CA 9WGAA 3TO7A 1ULMA 1SGYI 2NU4I 2YUUA 2X3TA 2V53A 2YQPA 1W3SA 1WTJA 1PCEA 3BJIA 2ENZA 4E1RA 1YTPA 2N52A 1TBRR 2ODDA 1ULNA 2NU3I 1K7TA 2JZMA 3QWPA 5DAEA 1V1HA 1UVGA 2OZUA 1LR9A 2CJSC 1IW4A 1VDDA 4OVOA 2NU1I 2VRWB 2CWGA 3UOEA 2GKVA 1MT1A 1CGJI 1CT4I 2Y0MA 3TO6A 1WGTA 3UGLA 1CT0I 2QPOA 2LEOA 1CSOI 5CCLA 1PTRA 2JA1A 4SGBI 2F3CI 5CCMA 1IY6A 1DS2I 2RC4A 5HQ8A 1W4RA 1V1IA 1XA6A 3KY9A 2J9RA 4WP4A 2NU2I 3SEKC 2LB7A 2XRCA 1BUSA 1K7VA 1OYVI 5E3RA 3CXLA 3SGBI 2ROWA 5FUYA 1P9ZA 2SGDI 2L8EA 3FSXA 5EX3A 2WVJA 5FUWA 1NUBA 1Y1BA 2QQCA 1P9GA 2K9HA 2P6AC 1XBTA 3QTLD 2E5RA 4UXJA 1UUCA 2GKRI 2GKTI 3E2IA 3TO9A 5EX0A 2SGQI 3TJQA 1SGNI 2JYYA 1TOTA 2N1AB 2KCXA 3B4VC 3UGDA 1OMUA 2DB6A 1NXUA 5JHWC 1Q9BA 3UEJA 2SGPI 2WGCA 2L7XA 2JXDA 1WKXA 5E3PA 5J8FA 2FNFX 2ARPF 2CWFA 1Y8FA 1X74A 2SGFI 2OVOA 1HEVA 3HH2C 2DIPA 3SGQI 1PJUA 1TURA 2M5XA 1SGDI 2ENNA 3R5CA 2JW6A 1PPFI 2UZ3A 3OXFA 3QAHA 4HGUA 3TOAA 3UFFA 7WGAA 1FYBA 1LR8A 1Z7KB 2QQEA 3RU0A 4B6DA 3FC3A 1HDLA 2SGEI 1TBOA 3FSYA 2ELIA
chains in the Genus database with same CATH topology
1U5KA 4GI3C 5FUVA 2KMRA 2N71A 1X4SA 1M8BA 3OL0A 1DS3I 4UXIA 1FARA 3PDNA 1KBEA 4UXHA 2N17A 3OVOA 1FAQA 1LR7A 1SGPI 2QQ0A 1BMOA 2J87A 3UEYA 1SGRI 3VDUA 2QQDA 1XX6A 1SGQI 1SGEI 1AN1I 2NU0I 2B0UC 2OD1A 2A20A 2BUSA 3MEKA 2B8TA 5FUXA 2KMOA 1KBFA 3VE5A 1M8CA 1CGII 3GOXA 4E1PA 1HJAI 2GVIA 2E73A 2KMPA 3VDPA 1CT2I 2ERWA 2WCYA 1R0RI 1H0ZA 1OVOA 2KMQA 1OMTA 1TBQR 2W0TA 1PTQA 1TUSA 5HI7A 3OXGA 1N13A 1TIHA 3D00A 4JCVE 1TGSI 1YU6C 1RFHA 2ORVA 2V1CA 3UGIA 1TBNA 2LUYA 2ORWA 3E59A 4A24A 3OXLA 4FKDA 1UVFA 1R79A 1CHOI 1HPTA 4L9MA 1IY5A 2V1CC 1Y1CA 1SGYI 2NU4I 2YUUA 2YQPA 2V53A 1W3SA 1PCEA 3BJIA 2ENZA 4E1RA 1YTPA 2N52A 1TBRR 2ODDA 2NU3I 2JZMA 3QWPA 5DAEA 1UVGA 1V1HA 1LR9A 2CJSC 1IW4A 1VDDA 4OVOA 2NU1I 2VRWB 2GKVA 1MT1A 1CGJI 1CT4I 3UGLA 1CT0I 2QPOA 2LEOA 1CSOI 5CCLA 1PTRA 2JA1A 4SGBI 2F3CI 5CCMA 1IY6A 1DS2I 1CE3A 1W4RA 1V1IA 1XA6A 3KY9A 2J9RA 2NU2I 3SEKC 2XRCA 1BUSA 1OYVI 3CXLA 3SGBI 2ROWA 5FUYA 2SGDI 5HQ8A 2L8EA 5EX3A 1KMAA 2WVJA 1NUBA 1Y1BA 2QQCA 2P6AC 2K9HA 3QTLD 1XBTA 4UXJA 2E5RA 5FUWA 1UUCA 2GKRI 2GKTI 3E2IA 5EX0A 2SGQI 3TJQA 1SGNI 2JYYA 1TOTA 2N1AB 2KCXA 3B4VC 3UGDA 1OMUA 2DB6A 5JHWC 3UEJA 2SGPI 2L7XA 2JXDA 2FNFX 2ARPF 1Y8FA 1X74A 2SGFI 2OVOA 3HH2C 2DIPA 3SGQI 1PJUA 1TURA 2M5XA 1SGDI 2ENNA 2JW6A 1PPFI 2UZ3A 3OXFA 4HGUA 3UFFA 1FYBA 1LR8A 1Z7KB 2QQEA 3RU0A 4B6DA 3FC3A 1HDLA 2SGEI 1TBOA 2ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUW A;  4UXJ A;  2GVI A;  1XBT A;  2E73 A;  5FUV A;  3E2I A;  4UXI A;  1FAR A;  2WVJ A;  4UXH A;  1KBE A;  3UGD A;  2DB6 A;  1PTQ A;  2VRW B;  1FAQ A;  2QQ0 A;  3UEJ A;  2J87 A;  3UEY A;  2FNF X;  3UGL A;  2QPO A;  1RFH A;  1Y8F A;  2ORV A;  1XX6 A;  1TBN A;  3UGI A;  2ORW A;  4FKD A;  1PTR A;  1R79 A;  2JA1 A;  4L9M A;  2ENN A;  2B8T A;  1W4R A;  1XA6 A;  2UZ3 A;  3KY9 A;  2J9R A;  3UFF A;  5FUX A;  1KBF A;  2YUU A;  2QQE A;  4B6D A;  3CXL A;  2ROW A;  5FUY A;  3BJI A;  1TBO A;  2ENZ A;  2ELI A; 
#chains in the Genus database with same CATH topology
 1U5K A;  4GI3 C;  2PQ8 A;  5FUV A;  2KMR A;  2N71 A;  1X4S A;  1M8B A;  1FY7 A;  3OL0 A;  1UHA A;  1MJ9 A;  1DS3 I;  4UXI A;  1FAR A;  1MJB A;  3PDN A;  1KBE A;  4UXH A;  2N17 A;  3R5B A;  3OVO A;  1FAQ A;  1LR7 A;  1SGP I;  2QQ0 A;  1BMO A;  2J87 A;  3UEY A;  2UVO A;  1SGR I;  3VDU A;  5J8C A;  2QQD A;  1XX6 A;  2X52 A;  1SGQ I;  1SGE I;  1AN1 I;  1K7U A;  2NU0 I;  1CE3 A;  2B0U C;  2OD1 A;  2A20 A;  2BUS A;  3MEK A;  2GIV A;  2B8T A;  1ULK A;  4MPI A;  2KMO A;  1WGC A;  5FUX A;  1KBF A;  3VE5 A;  1M8C A;  2OU2 A;  1CGI I;  3GOX A;  4E1P A;  1HJA I;  3R5D A;  2GVI A;  2E73 A;  2KMP A;  5E3Q A;  3VDP A;  1CT2 I;  2ERW A;  2WCY A;  1R0R I;  1H0Z A;  1OVO A;  1MJA A;  2KMQ A;  1OMT A;  2DKV A;  3TOB A;  1TBQ R;  1S20 A;  1PTQ A;  2W0T A;  3R5A A;  1TUS A;  2RIJ A;  1Z2I A;  5HI7 A;  4DNC A;  3OXG A;  1N13 A;  1TIH A;  3D00 A;  4JCV E;  1TGS I;  1YU6 C;  1RFH A;  2ORV A;  2V1C A;  3UGI A;  1TBN A;  2LUY A;  2ORW A;  3E59 A;  4A24 A;  4AML A;  3OXL A;  4FKD A;  1UVF A;  1R79 A;  2CWH A;  1CHO I;  1HPT A;  4L9M A;  1IY5 A;  2V1C C;  1KMA A;  1Y1C A;  9WGA A;  3TO7 A;  1ULM A;  1SGY I;  2NU4 I;  2YUU A;  2X3T A;  2V53 A;  2YQP A;  1W3S A;  1WTJ A;  1PCE A;  3BJI A;  2ENZ A;  4E1R A;  1YTP A;  2N52 A;  1TBR R;  2ODD A;  1ULN A;  2NU3 I;  1K7T A;  2JZM A;  3QWP A;  5DAE A;  1V1H A;  1UVG A;  2OZU A;  1LR9 A;  2CJS C;  1IW4 A;  1VDD A;  4OVO A;  2NU1 I;  2VRW B;  2CWG A;  3UOE A;  2GKV A;  1MT1 A;  1CGJ I;  1CT4 I;  2Y0M A;  3TO6 A;  1WGT A;  3UGL A;  1CT0 I;  2QPO A;  2LEO A;  1CSO I;  5CCL A;  1PTR A;  2JA1 A;  4SGB I;  2F3C I;  5CCM A;  1IY6 A;  1DS2 I;  2RC4 A;  5HQ8 A;  1W4R A;  1V1I A;  1XA6 A;  3KY9 A;  2J9R A;  4WP4 A;  2NU2 I;  3SEK C;  2LB7 A;  2XRC A;  1BUS A;  1K7V A;  1OYV I;  5E3R A;  3CXL A;  3SGB I;  2ROW A;  5FUY A;  1P9Z A;  2SGD I;  2L8E A;  3FSX A;  5EX3 A;  2WVJ A;  5FUW A;  1NUB A;  1Y1B A;  2QQC A;  1P9G A;  2K9H A;  2P6A C;  1XBT A;  3QTL D;  2E5R A;  4UXJ A;  1UUC A;  2GKR I;  2GKT I;  3E2I A;  3TO9 A;  5EX0 A;  2SGQ I;  3TJQ A;  1SGN I;  2JYY A;  1TOT A;  2N1A B;  2KCX A;  3B4V C;  3UGD A;  1OMU A;  2DB6 A;  1NXU A;  5JHW C;  1Q9B A;  3UEJ A;  2SGP I;  2WGC A;  2L7X A;  2JXD A;  1WKX A;  5E3P A;  5J8F A;  2FNF X;  2ARP F;  2CWF A;  1Y8F A;  1X74 A;  2SGF I;  2OVO A;  1HEV A;  3HH2 C;  2DIP A;  3SGQ I;  1PJU A;  1TUR A;  2M5X A;  1SGD I;  2ENN A;  3R5C A;  2JW6 A;  1PPF I;  2UZ3 A;  3OXF A;  3QAH A;  4HGU A;  3TOA A;  3UFF A;  7WGA A;  1FYB A;  1LR8 A;  1Z7K B;  2QQE A;  3RU0 A;  4B6D A;  3FC3 A;  1HDL A;  2SGE I;  1TBO A;  3FSY A;  2ELI A; 
#chains in the Genus database with same CATH homology
 1U5K A;  4GI3 C;  5FUV A;  2KMR A;  2N71 A;  1X4S A;  1M8B A;  3OL0 A;  1DS3 I;  4UXI A;  1FAR A;  3PDN A;  1KBE A;  4UXH A;  2N17 A;  3OVO A;  1FAQ A;  1LR7 A;  1SGP I;  2QQ0 A;  1BMO A;  2J87 A;  3UEY A;  1SGR I;  3VDU A;  2QQD A;  1XX6 A;  1SGQ I;  1SGE I;  1AN1 I;  2NU0 I;  2B0U C;  2OD1 A;  2A20 A;  2BUS A;  3MEK A;  2B8T A;  5FUX A;  2KMO A;  1KBF A;  3VE5 A;  1M8C A;  1CGI I;  3GOX A;  4E1P A;  1HJA I;  2GVI A;  2E73 A;  2KMP A;  3VDP A;  1CT2 I;  2ERW A;  2WCY A;  1R0R I;  1H0Z A;  1OVO A;  2KMQ A;  1OMT A;  1TBQ R;  2W0T A;  1PTQ A;  1TUS A;  5HI7 A;  3OXG A;  1N13 A;  1TIH A;  3D00 A;  4JCV E;  1TGS I;  1YU6 C;  1RFH A;  2ORV A;  2V1C A;  3UGI A;  1TBN A;  2LUY A;  2ORW A;  3E59 A;  4A24 A;  3OXL A;  4FKD A;  1UVF A;  1R79 A;  1CHO I;  1HPT A;  4L9M A;  1IY5 A;  2V1C C;  1Y1C A;  1SGY I;  2NU4 I;  2YUU A;  2YQP A;  2V53 A;  1W3S A;  1PCE A;  3BJI A;  2ENZ A;  4E1R A;  1YTP A;  2N52 A;  1TBR R;  2ODD A;  2NU3 I;  2JZM A;  3QWP A;  5DAE A;  1UVG A;  1V1H A;  1LR9 A;  2CJS C;  1IW4 A;  1VDD A;  4OVO A;  2NU1 I;  2VRW B;  2GKV A;  1MT1 A;  1CGJ I;  1CT4 I;  3UGL A;  1CT0 I;  2QPO A;  2LEO A;  1CSO I;  5CCL A;  1PTR A;  2JA1 A;  4SGB I;  2F3C I;  5CCM A;  1IY6 A;  1DS2 I;  1CE3 A;  1W4R A;  1V1I A;  1XA6 A;  3KY9 A;  2J9R A;  2NU2 I;  3SEK C;  2XRC A;  1BUS A;  1OYV I;  3CXL A;  3SGB I;  2ROW A;  5FUY A;  2SGD I;  5HQ8 A;  2L8E A;  5EX3 A;  1KMA A;  2WVJ A;  1NUB A;  1Y1B A;  2QQC A;  2P6A C;  2K9H A;  3QTL D;  1XBT A;  4UXJ A;  2E5R A;  5FUW A;  1UUC A;  2GKR I;  2GKT I;  3E2I A;  5EX0 A;  2SGQ I;  3TJQ A;  1SGN I;  2JYY A;  1TOT A;  2N1A B;  2KCX A;  3B4V C;  3UGD A;  1OMU A;  2DB6 A;  5JHW C;  3UEJ A;  2SGP I;  2L7X A;  2JXD A;  2FNF X;  2ARP F;  1Y8F A;  1X74 A;  2SGF I;  2OVO A;  3HH2 C;  2DIP A;  3SGQ I;  1PJU A;  1TUR A;  2M5X A;  1SGD I;  2ENN A;  2JW6 A;  1PPF I;  2UZ3 A;  3OXF A;  4HGU A;  3UFF A;  1FYB A;  1LR8 A;  1Z7K B;  2QQE A;  3RU0 A;  4B6D A;  3FC3 A;  1HDL A;  2SGE I;  1TBO A;  2ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...