2FNFX

C1 domain of nore1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords putative Ras Effector Nore1
publication title GTP-Ras disrupts the intramolecular complex of C1 and RA domains of Nore1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2fnfX01
2VRWB 1KBEA 1TBOA 1FARA 3UGIA 2YUUA 2WVJA 4UXJA 4UXIA 2DB6A 2QQ0A 3BJIA 3UEYA 1PTRA 1XA6A 5FUWA 2QPOA 2ENZA 4UXHA 2ENNA 1XBTA 2JA1A 1RFHA 1Y8FA 2UZ3A 3UGLA 4FKDA 2ORWA 1FAQA 2J87A 1R79A 1XX6A 1TBNA 5FUYA 3UGDA 3KY9A 3CXLA 5FUXA 3E2IA 3UFFA 1W4RA 4L9MA 2ORVA 1KBFA 2FNFX 2J9RA 1PTQA 5FUVA 3UEJA 2B8TA 2ELIA 2E73A 2GVIA 2ROWA 4B6DA 2QQEA
chains in the Genus database with same CATH superfamily
2GIVA 3OXLA 1M8CA 1KBEA 1FARA 1OVOA 1U5KA 4E1PA 1YTPA 4UXJA 2WVJA 1UHAA 1BMOA 1LR7A 1MJAA 1X74A 2QQ0A 1TUSA 1IY6A 4GI3C 2KCXA 2SGPI 2CJSC 5FUWA 2WCYA 2OU2A 2ENNA 1SGDI 1S20A 1CGJI 1DS2I 2QQDA 3OXGA 4FKDA 2V1CA 2V1CC 1MT1A 1XX6A 2W0TA 4MPIA 5CCLA 5J8FA 1SGRI 1V1HA 2KMQA 2X52A 2ORVA 1X4SA 4L9MA 5EX0A 3FC3A 2DKVA 3TO7A 2P6AC 2V53A 3QAHA 1H0ZA 2GKTI 2F3CI 2J9RA 1CE3A 2E73A 4E1RA 3SGBI 1WKXA 4B6DA 3UOEA 1BUSA 3B4VC 2CWGA 3MEKA 2DIPA 3R5DA 1Y1CA 2KMRA 1LR8A 1PPFI 3QWPA 3TO6A 5HQ8A 1Q9BA 2DB6A 4AMLA 1K7TA 1UVFA 1MJBA 2B0UC 2QPOA 1YU6C 1ULMA 1ULNA 1WGTA 2SGDI 3SGQI 3TOBA 1XBTA 1RFHA 1PCEA 2JXDA 2NU3I 2K9HA 3RU0A 3UGLA 3QTLD 4OVOA 5HI7A 1R79A 1TBNA 3UGDA 4A24A 2LEOA 3D00A 5FUXA 2NU4I 1MJ9A 5JHWC 1HDLA 1WGCA 2SGEI 1KMAA 1P9ZA 2YQPA 1V1IA 1SGEI 2CWHA 3HH2C 1LR9A 2RIJA 1OYVI 3TOAA 2OD1A 2B8TA 2ELIA 2GVIA 2X3TA 3FSYA 1IY5A 1TGSI 2Y0MA 1UUCA 3GOXA 1M8BA 1OMUA 1ULKA 2VRWB 4DNCA 2JYYA 2ODDA 3TJQA 5E3RA 3UEYA 1PTRA 1XA6A 1AN1I 2E5RA 2PQ8A 1TOTA 1TBQR 4UXHA 2SGQI 3VE5A 1IW4A 2UZ3A 2QQCA 1N13A 1Z2IA 2JZMA 2OZUA 2GKRI 3R5CA 5FUYA 3KY9A 1SGPI 1UVGA 3CXLA 1WTJA 3E2IA 3UFFA 5CCMA 1VDDA 2CWFA 2L7XA 1CGII 2GKVA 2FNFX 2L8EA 2N52A 1K7UA 1PJUA 1SGQI 2N71A 1CSOI 2RC4A 3FSXA 4HGUA 3SEKC 3UEJA 1CT4I 2NU0I 1TURA 2LB7A 2ROWA 3R5AA 3PDNA 3OXFA 1NUBA 1Y1BA 2LUYA 1HJAI 1OMTA 1TBOA 1FY7A 1SGYI 3UGIA 2N1AB 2YUUA 1Z7KB 3OL0A 4UXIA 3BJIA 1CT2I 3VDUA 2WGCA 2KMOA 7WGAA 1SGNI 1DS3I 1FYBA 1P9GA 1R0RI 1K7VA 2ENZA 1CHOI 2N17A 2NU1I 2UVOA 2JA1A 1Y8FA 3TO9A 1TIHA 2OVOA 1CT0I 3R5BA 1TBRR 2JW6A 1HPTA 2J87A 2ORWA 4WP4A 5J8CA 1FAQA 2BUSA 5E3PA 5DAEA 1W4RA 5E3QA 1KBFA 3VDPA 3OVOA 4SGBI 5EX3A 2A20A 1NXUA 2ARPF 1PTQA 2NU2I 4JCVE 2KMPA 2XRCA 3E59A 5FUVA 9WGAA 2M5XA 2SGFI 1W3SA 2QQEA 2ERWA 1HEVA
chains in the Genus database with same CATH topology
3OXLA 1M8CA 1KBEA 1FARA 1OVOA 1U5KA 4E1PA 1YTPA 4UXJA 2WVJA 1BMOA 1LR7A 1X74A 2QQ0A 1TUSA 1IY6A 4GI3C 2KCXA 2SGPI 2CJSC 5FUWA 2WCYA 2ENNA 1SGDI 1CGJI 1DS2I 2QQDA 3OXGA 4FKDA 2V1CA 2V1CC 1MT1A 1XX6A 2W0TA 5CCLA 1SGRI 1V1HA 2KMQA 4L9MA 2ORVA 1X4SA 5EX0A 3FC3A 2P6AC 2V53A 1H0ZA 2GKTI 2F3CI 2J9RA 1CE3A 2E73A 4E1RA 3SGBI 4B6DA 1BUSA 3B4VC 3MEKA 2DIPA 1Y1CA 2KMRA 1LR8A 1PPFI 3QWPA 5HQ8A 2DB6A 1UVFA 2B0UC 2QPOA 1YU6C 2SGDI 3SGQI 1XBTA 1RFHA 1PCEA 2JXDA 2NU3I 2K9HA 3RU0A 3QTLD 4OVOA 5HI7A 1R79A 1TBNA 3UGDA 4A24A 2LEOA 3D00A 5FUXA 2NU4I 1HDLA 1KMAA 2SGEI 2YQPA 1V1IA 1SGEI 3HH2C 1LR9A 1OYVI 2OD1A 2B8TA 2ELIA 2GVIA 1IY5A 1TGSI 1UUCA 3GOXA 1M8BA 1OMUA 2VRWB 2JYYA 2ODDA 3TJQA 3UEYA 1PTRA 1XA6A 1AN1I 2E5RA 4UXHA 1TOTA 1TBQR 1IW4A 2SGQI 3VE5A 2UZ3A 2QQCA 1N13A 2JZMA 2GKRI 5FUYA 3KY9A 1SGPI 1UVGA 3CXLA 5CCMA 3E2IA 3UFFA 1VDDA 2L7XA 5JHWC 1CGII 2GKVA 2FNFX 2L8EA 2N52A 1PJUA 2N71A 1SGQI 4HGUA 1CSOI 3SEKC 3UEJA 1CT4I 2NU0I 1TURA 2ROWA 3PDNA 3OXFA 1Y1BA 1NUBA 2LUYA 1HJAI 1OMTA 1TBOA 1SGYI 3UGIA 2N1AB 2YUUA 1Z7KB 3OL0A 4UXIA 3BJIA 1CT2I 3VDUA 2KMOA 1FYBA 1SGNI 1DS3I 1R0RI 2ENZA 2N17A 1CHOI 2NU1I 2JA1A 1Y8FA 1TIHA 2OVOA 1CT0I 3UGLA 1TBRR 2JW6A 1HPTA 2J87A 2ORWA 1FAQA 2BUSA 5DAEA 1W4RA 1KBFA 3VDPA 3OVOA 4SGBI 5EX3A 2A20A 2ARPF 1PTQA 2NU2I 4JCVE 2KMPA 2XRCA 3E59A 5FUVA 2M5XA 2SGFI 1W3SA 2QQEA 2ERWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRW B;  1KBE A;  1TBO A;  1FAR A;  3UGI A;  2YUU A;  2WVJ A;  4UXJ A;  4UXI A;  2DB6 A;  2QQ0 A;  3BJI A;  3UEY A;  1PTR A;  1XA6 A;  5FUW A;  2QPO A;  2ENZ A;  4UXH A;  2ENN A;  1XBT A;  2JA1 A;  1RFH A;  1Y8F A;  2UZ3 A;  3UGL A;  4FKD A;  2ORW A;  1FAQ A;  2J87 A;  1R79 A;  1XX6 A;  1TBN A;  5FUY A;  3UGD A;  3KY9 A;  3CXL A;  5FUX A;  3E2I A;  3UFF A;  1W4R A;  4L9M A;  2ORV A;  1KBF A;  2FNF X;  2J9R A;  1PTQ A;  5FUV A;  3UEJ A;  2B8T A;  2ELI A;  2E73 A;  2GVI A;  2ROW A;  4B6D A;  2QQE A; 
#chains in the Genus database with same CATH topology
 2GIV A;  3OXL A;  1M8C A;  1KBE A;  1FAR A;  1OVO A;  1U5K A;  4E1P A;  1YTP A;  4UXJ A;  2WVJ A;  1UHA A;  1BMO A;  1LR7 A;  1MJA A;  1X74 A;  2QQ0 A;  1TUS A;  1IY6 A;  4GI3 C;  2KCX A;  2SGP I;  2CJS C;  5FUW A;  2WCY A;  2OU2 A;  2ENN A;  1SGD I;  1S20 A;  1CGJ I;  1DS2 I;  2QQD A;  3OXG A;  4FKD A;  2V1C A;  2V1C C;  1MT1 A;  1XX6 A;  2W0T A;  4MPI A;  5CCL A;  5J8F A;  1SGR I;  1V1H A;  2KMQ A;  2X52 A;  2ORV A;  1X4S A;  4L9M A;  5EX0 A;  3FC3 A;  2DKV A;  3TO7 A;  2P6A C;  2V53 A;  3QAH A;  1H0Z A;  2GKT I;  2F3C I;  2J9R A;  1CE3 A;  2E73 A;  4E1R A;  3SGB I;  1WKX A;  4B6D A;  3UOE A;  1BUS A;  3B4V C;  2CWG A;  3MEK A;  2DIP A;  3R5D A;  1Y1C A;  2KMR A;  1LR8 A;  1PPF I;  3QWP A;  3TO6 A;  5HQ8 A;  1Q9B A;  2DB6 A;  4AML A;  1K7T A;  1UVF A;  1MJB A;  2B0U C;  2QPO A;  1YU6 C;  1ULM A;  1ULN A;  1WGT A;  2SGD I;  3SGQ I;  3TOB A;  1XBT A;  1RFH A;  1PCE A;  2JXD A;  2NU3 I;  2K9H A;  3RU0 A;  3UGL A;  3QTL D;  4OVO A;  5HI7 A;  1R79 A;  1TBN A;  3UGD A;  4A24 A;  2LEO A;  3D00 A;  5FUX A;  2NU4 I;  1MJ9 A;  5JHW C;  1HDL A;  1WGC A;  2SGE I;  1KMA A;  1P9Z A;  2YQP A;  1V1I A;  1SGE I;  2CWH A;  3HH2 C;  1LR9 A;  2RIJ A;  1OYV I;  3TOA A;  2OD1 A;  2B8T A;  2ELI A;  2GVI A;  2X3T A;  3FSY A;  1IY5 A;  1TGS I;  2Y0M A;  1UUC A;  3GOX A;  1M8B A;  1OMU A;  1ULK A;  2VRW B;  4DNC A;  2JYY A;  2ODD A;  3TJQ A;  5E3R A;  3UEY A;  1PTR A;  1XA6 A;  1AN1 I;  2E5R A;  2PQ8 A;  1TOT A;  1TBQ R;  4UXH A;  2SGQ I;  3VE5 A;  1IW4 A;  2UZ3 A;  2QQC A;  1N13 A;  1Z2I A;  2JZM A;  2OZU A;  2GKR I;  3R5C A;  5FUY A;  3KY9 A;  1SGP I;  1UVG A;  3CXL A;  1WTJ A;  3E2I A;  3UFF A;  5CCM A;  1VDD A;  2CWF A;  2L7X A;  1CGI I;  2GKV A;  2FNF X;  2L8E A;  2N52 A;  1K7U A;  1PJU A;  1SGQ I;  2N71 A;  1CSO I;  2RC4 A;  3FSX A;  4HGU A;  3SEK C;  3UEJ A;  1CT4 I;  2NU0 I;  1TUR A;  2LB7 A;  2ROW A;  3R5A A;  3PDN A;  3OXF A;  1NUB A;  1Y1B A;  2LUY A;  1HJA I;  1OMT A;  1TBO A;  1FY7 A;  1SGY I;  3UGI A;  2N1A B;  2YUU A;  1Z7K B;  3OL0 A;  4UXI A;  3BJI A;  1CT2 I;  3VDU A;  2WGC A;  2KMO A;  7WGA A;  1SGN I;  1DS3 I;  1FYB A;  1P9G A;  1R0R I;  1K7V A;  2ENZ A;  1CHO I;  2N17 A;  2NU1 I;  2UVO A;  2JA1 A;  1Y8F A;  3TO9 A;  1TIH A;  2OVO A;  1CT0 I;  3R5B A;  1TBR R;  2JW6 A;  1HPT A;  2J87 A;  2ORW A;  4WP4 A;  5J8C A;  1FAQ A;  2BUS A;  5E3P A;  5DAE A;  1W4R A;  5E3Q A;  1KBF A;  3VDP A;  3OVO A;  4SGB I;  5EX3 A;  2A20 A;  1NXU A;  2ARP F;  1PTQ A;  2NU2 I;  4JCV E;  2KMP A;  2XRC A;  3E59 A;  5FUV A;  9WGA A;  2M5X A;  2SGF I;  1W3S A;  2QQE A;  2ERW A;  1HEV A; 
#chains in the Genus database with same CATH homology
 3OXL A;  1M8C A;  1KBE A;  1FAR A;  1OVO A;  1U5K A;  4E1P A;  1YTP A;  4UXJ A;  2WVJ A;  1BMO A;  1LR7 A;  1X74 A;  2QQ0 A;  1TUS A;  1IY6 A;  4GI3 C;  2KCX A;  2SGP I;  2CJS C;  5FUW A;  2WCY A;  2ENN A;  1SGD I;  1CGJ I;  1DS2 I;  2QQD A;  3OXG A;  4FKD A;  2V1C A;  2V1C C;  1MT1 A;  1XX6 A;  2W0T A;  5CCL A;  1SGR I;  1V1H A;  2KMQ A;  4L9M A;  2ORV A;  1X4S A;  5EX0 A;  3FC3 A;  2P6A C;  2V53 A;  1H0Z A;  2GKT I;  2F3C I;  2J9R A;  1CE3 A;  2E73 A;  4E1R A;  3SGB I;  4B6D A;  1BUS A;  3B4V C;  3MEK A;  2DIP A;  1Y1C A;  2KMR A;  1LR8 A;  1PPF I;  3QWP A;  5HQ8 A;  2DB6 A;  1UVF A;  2B0U C;  2QPO A;  1YU6 C;  2SGD I;  3SGQ I;  1XBT A;  1RFH A;  1PCE A;  2JXD A;  2NU3 I;  2K9H A;  3RU0 A;  3QTL D;  4OVO A;  5HI7 A;  1R79 A;  1TBN A;  3UGD A;  4A24 A;  2LEO A;  3D00 A;  5FUX A;  2NU4 I;  1HDL A;  1KMA A;  2SGE I;  2YQP A;  1V1I A;  1SGE I;  3HH2 C;  1LR9 A;  1OYV I;  2OD1 A;  2B8T A;  2ELI A;  2GVI A;  1IY5 A;  1TGS I;  1UUC A;  3GOX A;  1M8B A;  1OMU A;  2VRW B;  2JYY A;  2ODD A;  3TJQ A;  3UEY A;  1PTR A;  1XA6 A;  1AN1 I;  2E5R A;  4UXH A;  1TOT A;  1TBQ R;  1IW4 A;  2SGQ I;  3VE5 A;  2UZ3 A;  2QQC A;  1N13 A;  2JZM A;  2GKR I;  5FUY A;  3KY9 A;  1SGP I;  1UVG A;  3CXL A;  5CCM A;  3E2I A;  3UFF A;  1VDD A;  2L7X A;  5JHW C;  1CGI I;  2GKV A;  2FNF X;  2L8E A;  2N52 A;  1PJU A;  2N71 A;  1SGQ I;  4HGU A;  1CSO I;  3SEK C;  3UEJ A;  1CT4 I;  2NU0 I;  1TUR A;  2ROW A;  3PDN A;  3OXF A;  1Y1B A;  1NUB A;  2LUY A;  1HJA I;  1OMT A;  1TBO A;  1SGY I;  3UGI A;  2N1A B;  2YUU A;  1Z7K B;  3OL0 A;  4UXI A;  3BJI A;  1CT2 I;  3VDU A;  2KMO A;  1FYB A;  1SGN I;  1DS3 I;  1R0R I;  2ENZ A;  2N17 A;  1CHO I;  2NU1 I;  2JA1 A;  1Y8F A;  1TIH A;  2OVO A;  1CT0 I;  3UGL A;  1TBR R;  2JW6 A;  1HPT A;  2J87 A;  2ORW A;  1FAQ A;  2BUS A;  5DAE A;  1W4R A;  1KBF A;  3VDP A;  3OVO A;  4SGB I;  5EX3 A;  2A20 A;  2ARP F;  1PTQ A;  2NU2 I;  4JCV E;  2KMP A;  2XRC A;  3E59 A;  5FUV A;  2M5X A;  2SGF I;  1W3S A;  2QQE A;  2ERW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...