2FNFX

C1 domain of nore1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GTP-Ras disrupts the intramolecular complex of C1 and RA domains of Nore1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords putative Ras Effector Nore1
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2fnfX01
2J87A 5FUVA 1TBOA 3BJIA 3CXLA 5FUYA 1W4RA 1XA6A 2JA1A 2QPOA 2FNFX 2GVIA 2ENZA 1PTRA 4UXHA 4L9MA 2ORVA 4B6DA 2YUUA 2WVJA 4FKDA 4UXIA 1RFHA 2B8TA 4UXJA 3UEYA 3UFFA 2QQEA 1FAQA 1XBTA 2VRWB 1PTQA 3E2IA 3UGDA 5FUXA 2QQ0A 1KBFA 1TBNA 5FUWA 1FARA 2DB6A 3KY9A 2ELIA 1R79A 2ENNA 1Y8FA 2ORWA 3UGIA 1XX6A 1KBEA 2UZ3A 3UGLA 2ROWA 2J9RA 2E73A 3UEJA
chains in the Genus database with same CATH superfamily
5J8CA 3UOEA 1YU6C 1BMOA 3B4VC 1KMAA 1SGPI 2NU1I 2QPOA 1IW4A 2LEOA 3QTLD 2GVIA 3R5CA 1SGNI 3VDUA 2N17A 2DKVA 1W3SA 2DIPA 2SGFI 4A24A 2KMQA 2YQPA 7WGAA 4UXIA 3UEYA 2QQEA 1FAQA 2ERWA 1M8BA 1Y1CA 3FC3A 2RC4A 3MEKA 2OZUA 1SGYI 1PJUA 2CJSC 1TBNA 4DNCA 1CE3A 5CCLA 1H0ZA 1V1IA 1ULKA 4MPIA 2NU0I 2CWGA 1FYBA 3TO6A 2LUYA 3UGIA 1V1HA 2UZ3A 2ROWA 1VDDA 2LB7A 3SEKC 3RU0A 1BUSA 3BJIA 2GKTI 3R5BA 1HDLA 2V53A 1MT1A 2GKRI 1OVOA 1W4RA 1SGDI 2JA1A 3E59A 5FUYA 5HI7A 1TIHA 1IY5A 1LR8A 1PTRA 3OVOA 4L9MA 1Y1BA 1YTPA 3OXLA 2K9HA 2ORVA 1LR9A 1X74A 5E3QA 1RFHA 2B8TA 3UFFA 1UHAA 1TGSI 2JXDA 4E1PA 1XBTA 2OU2A 1OMUA 2OD1A 2KMRA 2VRWB 1WKXA 2B0UC 2WCYA 3E2IA 1SGEI 2GIVA 2X3TA 3R5DA 1CSOI 1KBFA 1WGTA 4SGBI 2KCXA 5FUWA 1TBRR 1TURA 1FARA 1UUCA 2DB6A 2ELIA 3PDNA 1CT0I 2KMPA 1DS2I 2X52A 2V1CA 2UVOA 2L7XA 2QQCA 3TOAA 1R0RI 1NUBA 1UVFA 3R5AA 1CHOI 1KBEA 1X4SA 2QQDA 5E3PA 2SGDI 4AMLA 4B6DA 2J9RA 2E73A 1CT4I 2N1AB 2J87A 2N52A 5E3RA 5FUVA 1CGII 2CWFA 3TOBA 3QAHA 1S20A 1Q9BA 1XA6A 1WGCA 1Z7KB 1LR7A 9WGAA 4OVOA 1MJAA 2JYYA 2NU2I 2Y0MA 1SGRI 2ARPF 2SGQI 1U5KA 3TJQA 2E5RA 3HH2C 2WVJA 2XRCA 1PCEA 4FKDA 1CT2I 2PQ8A 2L8EA 1MJ9A 4GI3C 1ULMA 1PTQA 2QQ0A 1OMTA 4E1RA 1HJAI 1P9GA 1CGJI 1FY7A 3KY9A 5JHWC 1Z2IA 2F3CI 2SGPI 1UVGA 2NU3I 4HGUA 1Y8FA 2ORWA 2JW6A 2P6AC 3OL0A 1K7VA 1M8CA 1XX6A 2SGEI 2M5XA 3FSXA 1P9ZA 1SGQI 2CWHA 1TBQR 1K7UA 4JCVE 1NXUA 2JZMA 1TBOA 3CXLA 5EX3A 1HPTA 1N13A 2FNFX 1HEVA 2OVOA 2ENZA 1MJBA 2NU4I 4UXHA 3VDPA 5HQ8A 1AN1I 5EX0A 3SGBI 3FSYA 2YUUA 2GKVA 2RIJA 2N71A 4UXJA 3SGQI 1ULNA 3TO9A 2ODDA 5J8FA 2W0TA 3UGDA 5CCMA 5DAEA 3GOXA 3QWPA 5FUXA 1TUSA 3OXGA 3D00A 3OXFA 2KMOA 2BUSA 1TOTA 3VE5A 3TO7A 1K7TA 1IY6A 1R79A 1PPFI 2ENNA 2A20A 2WGCA 1DS3I 4WP4A 2V1CC 3UEJA 3UGLA 1OYVI 1WTJA
chains in the Genus database with same CATH topology
1YU6C 1BMOA 3B4VC 1KMAA 1SGPI 2NU1I 2QPOA 1IW4A 2LEOA 3QTLD 2GVIA 1SGNI 3VDUA 2N17A 1W3SA 2DIPA 2SGFI 4A24A 2KMQA 2YQPA 4UXIA 3UEYA 2QQEA 1FAQA 2ERWA 1M8BA 1Y1CA 3FC3A 3MEKA 1SGYI 1PJUA 2CJSC 1TBNA 1CE3A 1H0ZA 5CCLA 1V1IA 2NU0I 1FYBA 2LUYA 3UGIA 1V1HA 2UZ3A 2ROWA 1VDDA 3SEKC 3RU0A 1BUSA 3BJIA 2GKTI 1HDLA 2V53A 1MT1A 2GKRI 1OVOA 1W4RA 1SGDI 2JA1A 3E59A 5FUYA 5HI7A 1TIHA 1IY5A 1LR8A 1PTRA 3OVOA 4L9MA 1Y1BA 1YTPA 3OXLA 2K9HA 2ORVA 1LR9A 1X74A 1RFHA 2B8TA 3UFFA 4E1PA 1TGSI 2JXDA 1XBTA 2VRWB 1OMUA 2OD1A 2KMRA 2WCYA 3E2IA 2B0UC 1SGEI 1KBFA 1CSOI 4SGBI 2KCXA 5FUWA 1TBRR 1TURA 1FARA 1UUCA 2DB6A 2ELIA 3PDNA 1CT0I 2KMPA 1DS2I 2V1CA 2L7XA 2QQCA 1R0RI 1NUBA 1UVFA 1CHOI 1KBEA 1X4SA 2QQDA 2SGDI 4B6DA 2J9RA 2E73A 1CT4I 2N1AB 2J87A 2N52A 5FUVA 1CGII 1XA6A 1Z7KB 1LR7A 4OVOA 2NU2I 2JYYA 1SGRI 2ARPF 2SGQI 1U5KA 3TJQA 2E5RA 3HH2C 2WVJA 2XRCA 1PCEA 4FKDA 1CT2I 2L8EA 4GI3C 1PTQA 2QQ0A 1OMTA 4E1RA 1HJAI 3KY9A 1CGJI 5JHWC 2F3CI 2SGPI 1UVGA 2NU3I 4HGUA 1Y8FA 2ORWA 2JW6A 2P6AC 3OL0A 1M8CA 2SGEI 1XX6A 2M5XA 1SGQI 1TBQR 4JCVE 2JZMA 1TBOA 3CXLA 5EX3A 1HPTA 1N13A 2FNFX 2OVOA 2ENZA 2NU4I 4UXHA 3VDPA 5HQ8A 1AN1I 5EX0A 3SGBI 2YUUA 2GKVA 2N71A 4UXJA 3SGQI 3GOXA 2ODDA 2W0TA 3UGDA 5CCMA 5DAEA 3QWPA 5FUXA 1TUSA 3OXGA 3D00A 3OXFA 2KMOA 2BUSA 1TOTA 3VE5A 1IY6A 1R79A 1PPFI 2ENNA 2A20A 1DS3I 2V1CC 3UEJA 3UGLA 1OYVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J87 A;  5FUV A;  1TBO A;  3BJI A;  3CXL A;  5FUY A;  1W4R A;  1XA6 A;  2JA1 A;  2QPO A;  2FNF X;  2GVI A;  2ENZ A;  1PTR A;  4UXH A;  4L9M A;  2ORV A;  4B6D A;  2YUU A;  2WVJ A;  4FKD A;  4UXI A;  1RFH A;  2B8T A;  4UXJ A;  3UEY A;  3UFF A;  2QQE A;  1FAQ A;  1XBT A;  2VRW B;  1PTQ A;  3E2I A;  3UGD A;  5FUX A;  2QQ0 A;  1KBF A;  1TBN A;  5FUW A;  1FAR A;  2DB6 A;  3KY9 A;  2ELI A;  1R79 A;  2ENN A;  1Y8F A;  2ORW A;  3UGI A;  1XX6 A;  1KBE A;  2UZ3 A;  3UGL A;  2ROW A;  2J9R A;  2E73 A;  3UEJ A; 
#chains in the Genus database with same CATH topology
 5J8C A;  3UOE A;  1YU6 C;  1BMO A;  3B4V C;  1KMA A;  1SGP I;  2NU1 I;  2QPO A;  1IW4 A;  2LEO A;  3QTL D;  2GVI A;  3R5C A;  1SGN I;  3VDU A;  2N17 A;  2DKV A;  1W3S A;  2DIP A;  2SGF I;  4A24 A;  2KMQ A;  2YQP A;  7WGA A;  4UXI A;  3UEY A;  2QQE A;  1FAQ A;  2ERW A;  1M8B A;  1Y1C A;  3FC3 A;  2RC4 A;  3MEK A;  2OZU A;  1SGY I;  1PJU A;  2CJS C;  1TBN A;  4DNC A;  1CE3 A;  5CCL A;  1H0Z A;  1V1I A;  1ULK A;  4MPI A;  2NU0 I;  2CWG A;  1FYB A;  3TO6 A;  2LUY A;  3UGI A;  1V1H A;  2UZ3 A;  2ROW A;  1VDD A;  2LB7 A;  3SEK C;  3RU0 A;  1BUS A;  3BJI A;  2GKT I;  3R5B A;  1HDL A;  2V53 A;  1MT1 A;  2GKR I;  1OVO A;  1W4R A;  1SGD I;  2JA1 A;  3E59 A;  5FUY A;  5HI7 A;  1TIH A;  1IY5 A;  1LR8 A;  1PTR A;  3OVO A;  4L9M A;  1Y1B A;  1YTP A;  3OXL A;  2K9H A;  2ORV A;  1LR9 A;  1X74 A;  5E3Q A;  1RFH A;  2B8T A;  3UFF A;  1UHA A;  1TGS I;  2JXD A;  4E1P A;  1XBT A;  2OU2 A;  1OMU A;  2OD1 A;  2KMR A;  2VRW B;  1WKX A;  2B0U C;  2WCY A;  3E2I A;  1SGE I;  2GIV A;  2X3T A;  3R5D A;  1CSO I;  1KBF A;  1WGT A;  4SGB I;  2KCX A;  5FUW A;  1TBR R;  1TUR A;  1FAR A;  1UUC A;  2DB6 A;  2ELI A;  3PDN A;  1CT0 I;  2KMP A;  1DS2 I;  2X52 A;  2V1C A;  2UVO A;  2L7X A;  2QQC A;  3TOA A;  1R0R I;  1NUB A;  1UVF A;  3R5A A;  1CHO I;  1KBE A;  1X4S A;  2QQD A;  5E3P A;  2SGD I;  4AML A;  4B6D A;  2J9R A;  2E73 A;  1CT4 I;  2N1A B;  2J87 A;  2N52 A;  5E3R A;  5FUV A;  1CGI I;  2CWF A;  3TOB A;  3QAH A;  1S20 A;  1Q9B A;  1XA6 A;  1WGC A;  1Z7K B;  1LR7 A;  9WGA A;  4OVO A;  1MJA A;  2JYY A;  2NU2 I;  2Y0M A;  1SGR I;  2ARP F;  2SGQ I;  1U5K A;  3TJQ A;  2E5R A;  3HH2 C;  2WVJ A;  2XRC A;  1PCE A;  4FKD A;  1CT2 I;  2PQ8 A;  2L8E A;  1MJ9 A;  4GI3 C;  1ULM A;  1PTQ A;  2QQ0 A;  1OMT A;  4E1R A;  1HJA I;  1P9G A;  1CGJ I;  1FY7 A;  3KY9 A;  5JHW C;  1Z2I A;  2F3C I;  2SGP I;  1UVG A;  2NU3 I;  4HGU A;  1Y8F A;  2ORW A;  2JW6 A;  2P6A C;  3OL0 A;  1K7V A;  1M8C A;  1XX6 A;  2SGE I;  2M5X A;  3FSX A;  1P9Z A;  1SGQ I;  2CWH A;  1TBQ R;  1K7U A;  4JCV E;  1NXU A;  2JZM A;  1TBO A;  3CXL A;  5EX3 A;  1HPT A;  1N13 A;  2FNF X;  1HEV A;  2OVO A;  2ENZ A;  1MJB A;  2NU4 I;  4UXH A;  3VDP A;  5HQ8 A;  1AN1 I;  5EX0 A;  3SGB I;  3FSY A;  2YUU A;  2GKV A;  2RIJ A;  2N71 A;  4UXJ A;  3SGQ I;  1ULN A;  3TO9 A;  2ODD A;  5J8F A;  2W0T A;  3UGD A;  5CCM A;  5DAE A;  3GOX A;  3QWP A;  5FUX A;  1TUS A;  3OXG A;  3D00 A;  3OXF A;  2KMO A;  2BUS A;  1TOT A;  3VE5 A;  3TO7 A;  1K7T A;  1IY6 A;  1R79 A;  1PPF I;  2ENN A;  2A20 A;  2WGC A;  1DS3 I;  4WP4 A;  2V1C C;  3UEJ A;  3UGL A;  1OYV I;  1WTJ A; 
#chains in the Genus database with same CATH homology
 1YU6 C;  1BMO A;  3B4V C;  1KMA A;  1SGP I;  2NU1 I;  2QPO A;  1IW4 A;  2LEO A;  3QTL D;  2GVI A;  1SGN I;  3VDU A;  2N17 A;  1W3S A;  2DIP A;  2SGF I;  4A24 A;  2KMQ A;  2YQP A;  4UXI A;  3UEY A;  2QQE A;  1FAQ A;  2ERW A;  1M8B A;  1Y1C A;  3FC3 A;  3MEK A;  1SGY I;  1PJU A;  2CJS C;  1TBN A;  1CE3 A;  1H0Z A;  5CCL A;  1V1I A;  2NU0 I;  1FYB A;  2LUY A;  3UGI A;  1V1H A;  2UZ3 A;  2ROW A;  1VDD A;  3SEK C;  3RU0 A;  1BUS A;  3BJI A;  2GKT I;  1HDL A;  2V53 A;  1MT1 A;  2GKR I;  1OVO A;  1W4R A;  1SGD I;  2JA1 A;  3E59 A;  5FUY A;  5HI7 A;  1TIH A;  1IY5 A;  1LR8 A;  1PTR A;  3OVO A;  4L9M A;  1Y1B A;  1YTP A;  3OXL A;  2K9H A;  2ORV A;  1LR9 A;  1X74 A;  1RFH A;  2B8T A;  3UFF A;  4E1P A;  1TGS I;  2JXD A;  1XBT A;  2VRW B;  1OMU A;  2OD1 A;  2KMR A;  2WCY A;  3E2I A;  2B0U C;  1SGE I;  1KBF A;  1CSO I;  4SGB I;  2KCX A;  5FUW A;  1TBR R;  1TUR A;  1FAR A;  1UUC A;  2DB6 A;  2ELI A;  3PDN A;  1CT0 I;  2KMP A;  1DS2 I;  2V1C A;  2L7X A;  2QQC A;  1R0R I;  1NUB A;  1UVF A;  1CHO I;  1KBE A;  1X4S A;  2QQD A;  2SGD I;  4B6D A;  2J9R A;  2E73 A;  1CT4 I;  2N1A B;  2J87 A;  2N52 A;  5FUV A;  1CGI I;  1XA6 A;  1Z7K B;  1LR7 A;  4OVO A;  2NU2 I;  2JYY A;  1SGR I;  2ARP F;  2SGQ I;  1U5K A;  3TJQ A;  2E5R A;  3HH2 C;  2WVJ A;  2XRC A;  1PCE A;  4FKD A;  1CT2 I;  2L8E A;  4GI3 C;  1PTQ A;  2QQ0 A;  1OMT A;  4E1R A;  1HJA I;  3KY9 A;  1CGJ I;  5JHW C;  2F3C I;  2SGP I;  1UVG A;  2NU3 I;  4HGU A;  1Y8F A;  2ORW A;  2JW6 A;  2P6A C;  3OL0 A;  1M8C A;  2SGE I;  1XX6 A;  2M5X A;  1SGQ I;  1TBQ R;  4JCV E;  2JZM A;  1TBO A;  3CXL A;  5EX3 A;  1HPT A;  1N13 A;  2FNF X;  2OVO A;  2ENZ A;  2NU4 I;  4UXH A;  3VDP A;  5HQ8 A;  1AN1 I;  5EX0 A;  3SGB I;  2YUU A;  2GKV A;  2N71 A;  4UXJ A;  3SGQ I;  3GOX A;  2ODD A;  2W0T A;  3UGD A;  5CCM A;  5DAE A;  3QWP A;  5FUX A;  1TUS A;  3OXG A;  3D00 A;  3OXF A;  2KMO A;  2BUS A;  1TOT A;  3VE5 A;  1IY6 A;  1R79 A;  1PPF I;  2ENN A;  2A20 A;  1DS3 I;  2V1C C;  3UEJ A;  3UGL A;  1OYV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...