2FNFX

C1 domain of nore1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords putative Ras Effector Nore1
publication title GTP-Ras disrupts the intramolecular complex of C1 and RA domains of Nore1.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2fnfX01
1R79A 1XX6A 3UGIA 5FUWA 4B6DA 2ENZA 2YUUA 3UFFA 2ELIA 1RFHA 4FKDA 2JA1A 1XBTA 2B8TA 5FUVA 2UZ3A 1XA6A 2ROWA 4L9MA 3CXLA 2GVIA 5FUYA 1W4RA 3BJIA 2ORWA 2ORVA 2QQEA 1TBOA 2J87A 1TBNA 1KBEA 1Y8FA 4UXJA 2FNFX 2WVJA 5FUXA 2QQ0A 3KY9A 3UEYA 4UXIA 1PTRA 3UGLA 2J9RA 2DB6A 1FAQA 1FARA 2ENNA 3UGDA 3E2IA 1KBFA 1PTQA 2E73A 2QPOA 4UXHA 3UEJA 2VRWB
chains in the Genus database with same CATH superfamily
1CGII 1S20A 1PPFI 5FUWA 3UGLA 2ENZA 1TIHA 2NU3I 2YUUA 1K7TA 3UFFA 1RFHA 2ODDA 3R5AA 3TJQA 1SGNI 4A24A 1CGJI 1XBTA 2B8TA 2LUYA 5J8FA 1P9GA 1ULKA 1V1IA 1W4RA 2CWHA 2KMRA 4UXJA 3UOEA 1Y8FA 4E1PA 2OD1A 2GIVA 2FNFX 1LR9A 3QAHA 3QTLD 2L7XA 5DAEA 5EX0A 3OXFA 4JCVE 3SGBI 3UEYA 2SGPI 3SGQI 1Z7KB 3VDPA 5CCLA 1N13A 3R5BA 1FY7A 1R0RI 2WGCA 4MPIA 4OVOA 3TOBA 3TO9A 1Z2IA 1IW4A 3UGDA 2GKVA 1U5KA 3PDNA 5HQ8A 1PTQA 2OU2A 2ARPF 2RC4A 5EX3A 4UXHA 5FUXA 5HI7A 2K9HA 1M8BA 2NU1I 1XX6A 1CHOI 1MT1A 3OL0A 2LB7A 3FC3A 1DS3I 2QQDA 4B6DA 2M5XA 2CWGA 3VDUA 2N52A 1SGRI 2KMPA 3TO6A 2JXDA 1X4SA 1UVGA 1PCEA 2JA1A 2YQPA 1HEVA 1HJAI 1MJ9A 1TGSI 3B4VC 5FUYA 2ORWA 1TBOA 2J87A 1TBNA 4AMLA 1P9ZA 2WCYA 2KMOA 3KY9A 5J8CA 2PQ8A 1PJUA 2GKRI 1PTRA 4E1RA 2NU4I 2X3TA 2UVOA 1NXUA 2E5RA 1OVOA 2KMQA 1IY5A 1KBFA 1LR7A 2OVOA 2QQCA 2BUSA 1SGPI 1YU6C 3FSXA 2RIJA 1SGYI 1CE3A 2SGEI 1MJAA 1SGDI 2GKTI 1TBQR 3RU0A 1Q9BA 1H0ZA 1WTJA 1UUCA 2ELIA 4GI3C 4DNCA 1TURA 9WGAA 2ERWA 2JZMA 2CWFA 5FUVA 1CT4I 2UZ3A 1CSOI 1XA6A 2ROWA 2NU2I 2W0TA 1W3SA 3CXLA 3OVOA 5JHWC 1K7UA 3BJIA 3OXLA 1V1HA 2CJSC 3SEKC 2V1CA 2WVJA 2QQ0A 2L8EA 1ULNA 2J9RA 3R5DA 2DB6A 1IY6A 1BMOA 1BUSA 1OMTA 2F3CI 1CT0I 2N1AB 4SGBI 5E3QA 1ULMA 2SGQI 1M8CA 3E2IA 3GOXA 1Y1CA 1VDDA 1TBRR 2QPOA 5E3PA 3MEKA 1HPTA 2B0UC 1R79A 3UGIA 1AN1I 2XRCA 3R5CA 2JYYA 2SGDI 1HDLA 1X74A 3QWPA 1K7VA 5E3RA 3VE5A 4FKDA 2A20A 1TUSA 2NU0I 3HH2C 1WKXA 3OXGA 2KCXA 2LEOA 2DIPA 4L9MA 1SGEI 2GVIA 1OYVI 1SGQI 2JW6A 2V53A 2ORVA 2OZUA 2QQEA 1DS2I 3TOAA 1KBEA 1UHAA 1NUBA 1OMUA 2X52A 7WGAA 2DKVA 4HGUA 1CT2I 2Y0MA 1LR8A 1MJBA 1UVFA 2N17A 2SGFI 1Y1BA 2P6AC 2V1CC 4UXIA 3E59A 1YTPA 1FAQA 1KMAA 5CCMA 1FARA 1WGTA 3FSYA 2ENNA 1TOTA 3D00A 1WGCA 2E73A 4WP4A 1FYBA 3UEJA 2VRWB 3TO7A 2N71A
chains in the Genus database with same CATH topology
1CGII 1PPFI 5FUWA 2ENZA 1TIHA 2NU3I 2YUUA 3UFFA 1RFHA 2ODDA 3TJQA 1SGNI 4A24A 1CGJI 1XBTA 2B8TA 2LUYA 1V1IA 1W4RA 2KMRA 4UXJA 4E1PA 1Y8FA 2OD1A 5DAEA 2FNFX 1LR9A 3QTLD 5EX0A 2L7XA 3OXFA 4JCVE 3SGBI 3UEYA 2SGPI 3SGQI 1Z7KB 3VDPA 5CCLA 1N13A 1R0RI 4OVOA 1IW4A 3UGDA 2GKVA 1U5KA 3PDNA 5HQ8A 1PTQA 2ARPF 5EX3A 5FUXA 4UXHA 5HI7A 2K9HA 1M8BA 2NU1I 1XX6A 1CHOI 1MT1A 3OL0A 3FC3A 1DS3I 2QQDA 4B6DA 2M5XA 3VDUA 2N52A 1SGRI 2KMPA 2JXDA 1X4SA 1UVGA 1PCEA 2JA1A 2YQPA 1HJAI 1TGSI 5FUYA 3B4VC 2ORWA 1TBOA 2J87A 1TBNA 2WCYA 2KMOA 3KY9A 1PJUA 2GKRI 1PTRA 4E1RA 2NU4I 2E5RA 1OVOA 2KMQA 1IY5A 1KBFA 1LR7A 2OVOA 2QQCA 2BUSA 1SGPI 1YU6C 1SGYI 1CE3A 2SGEI 1SGDI 2GKTI 1TBQR 3RU0A 1H0ZA 1UUCA 2ELIA 4GI3C 1TURA 2ERWA 2JZMA 5FUVA 1CT4I 2UZ3A 1CSOI 1XA6A 2ROWA 2NU2I 2W0TA 1W3SA 3CXLA 3OVOA 5JHWC 3BJIA 3OXLA 1V1HA 2CJSC 3SEKC 2V1CA 2WVJA 2QQ0A 2L8EA 2J9RA 2DB6A 1IY6A 1BMOA 1BUSA 1OMTA 2F3CI 1CT0I 2N1AB 4SGBI 3E2IA 2SGQI 1M8CA 3GOXA 1Y1CA 1VDDA 1TBRR 2QPOA 3MEKA 1HPTA 2B0UC 1R79A 3UGIA 1AN1I 2XRCA 1HDLA 2JYYA 2SGDI 1X74A 3QWPA 3VE5A 4FKDA 2A20A 1TUSA 2NU0I 3HH2C 3OXGA 2KCXA 2LEOA 2DIPA 4L9MA 1SGEI 2GVIA 1OYVI 1SGQI 2JW6A 2V53A 2ORVA 2QQEA 1DS2I 1KBEA 1NUBA 1OMUA 4HGUA 1CT2I 4UXIA 1LR8A 2N17A 1UVFA 2SGFI 3UGLA 1Y1BA 2P6AC 2V1CC 1FAQA 3E59A 1YTPA 1KMAA 5CCMA 1FARA 2ENNA 1TOTA 3D00A 2E73A 1FYBA 3UEJA 2VRWB 2N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R79 A;  1XX6 A;  3UGI A;  5FUW A;  4B6D A;  2ENZ A;  2YUU A;  3UFF A;  2ELI A;  1RFH A;  4FKD A;  2JA1 A;  1XBT A;  2B8T A;  5FUV A;  2UZ3 A;  1XA6 A;  2ROW A;  4L9M A;  3CXL A;  2GVI A;  5FUY A;  1W4R A;  3BJI A;  2ORW A;  2ORV A;  2QQE A;  1TBO A;  2J87 A;  1TBN A;  1KBE A;  1Y8F A;  4UXJ A;  2FNF X;  2WVJ A;  5FUX A;  2QQ0 A;  3KY9 A;  3UEY A;  4UXI A;  1PTR A;  3UGL A;  2J9R A;  2DB6 A;  1FAQ A;  1FAR A;  2ENN A;  3UGD A;  3E2I A;  1KBF A;  1PTQ A;  2E73 A;  2QPO A;  4UXH A;  3UEJ A;  2VRW B; 
#chains in the Genus database with same CATH topology
 1CGI I;  1S20 A;  1PPF I;  5FUW A;  3UGL A;  2ENZ A;  1TIH A;  2NU3 I;  2YUU A;  1K7T A;  3UFF A;  1RFH A;  2ODD A;  3R5A A;  3TJQ A;  1SGN I;  4A24 A;  1CGJ I;  1XBT A;  2B8T A;  2LUY A;  5J8F A;  1P9G A;  1ULK A;  1V1I A;  1W4R A;  2CWH A;  2KMR A;  4UXJ A;  3UOE A;  1Y8F A;  4E1P A;  2OD1 A;  2GIV A;  2FNF X;  1LR9 A;  3QAH A;  3QTL D;  2L7X A;  5DAE A;  5EX0 A;  3OXF A;  4JCV E;  3SGB I;  3UEY A;  2SGP I;  3SGQ I;  1Z7K B;  3VDP A;  5CCL A;  1N13 A;  3R5B A;  1FY7 A;  1R0R I;  2WGC A;  4MPI A;  4OVO A;  3TOB A;  3TO9 A;  1Z2I A;  1IW4 A;  3UGD A;  2GKV A;  1U5K A;  3PDN A;  5HQ8 A;  1PTQ A;  2OU2 A;  2ARP F;  2RC4 A;  5EX3 A;  4UXH A;  5FUX A;  5HI7 A;  2K9H A;  1M8B A;  2NU1 I;  1XX6 A;  1CHO I;  1MT1 A;  3OL0 A;  2LB7 A;  3FC3 A;  1DS3 I;  2QQD A;  4B6D A;  2M5X A;  2CWG A;  3VDU A;  2N52 A;  1SGR I;  2KMP A;  3TO6 A;  2JXD A;  1X4S A;  1UVG A;  1PCE A;  2JA1 A;  2YQP A;  1HEV A;  1HJA I;  1MJ9 A;  1TGS I;  3B4V C;  5FUY A;  2ORW A;  1TBO A;  2J87 A;  1TBN A;  4AML A;  1P9Z A;  2WCY A;  2KMO A;  3KY9 A;  5J8C A;  2PQ8 A;  1PJU A;  2GKR I;  1PTR A;  4E1R A;  2NU4 I;  2X3T A;  2UVO A;  1NXU A;  2E5R A;  1OVO A;  2KMQ A;  1IY5 A;  1KBF A;  1LR7 A;  2OVO A;  2QQC A;  2BUS A;  1SGP I;  1YU6 C;  3FSX A;  2RIJ A;  1SGY I;  1CE3 A;  2SGE I;  1MJA A;  1SGD I;  2GKT I;  1TBQ R;  3RU0 A;  1Q9B A;  1H0Z A;  1WTJ A;  1UUC A;  2ELI A;  4GI3 C;  4DNC A;  1TUR A;  9WGA A;  2ERW A;  2JZM A;  2CWF A;  5FUV A;  1CT4 I;  2UZ3 A;  1CSO I;  1XA6 A;  2ROW A;  2NU2 I;  2W0T A;  1W3S A;  3CXL A;  3OVO A;  5JHW C;  1K7U A;  3BJI A;  3OXL A;  1V1H A;  2CJS C;  3SEK C;  2V1C A;  2WVJ A;  2QQ0 A;  2L8E A;  1ULN A;  2J9R A;  3R5D A;  2DB6 A;  1IY6 A;  1BMO A;  1BUS A;  1OMT A;  2F3C I;  1CT0 I;  2N1A B;  4SGB I;  5E3Q A;  1ULM A;  2SGQ I;  1M8C A;  3E2I A;  3GOX A;  1Y1C A;  1VDD A;  1TBR R;  2QPO A;  5E3P A;  3MEK A;  1HPT A;  2B0U C;  1R79 A;  3UGI A;  1AN1 I;  2XRC A;  3R5C A;  2JYY A;  2SGD I;  1HDL A;  1X74 A;  3QWP A;  1K7V A;  5E3R A;  3VE5 A;  4FKD A;  2A20 A;  1TUS A;  2NU0 I;  3HH2 C;  1WKX A;  3OXG A;  2KCX A;  2LEO A;  2DIP A;  4L9M A;  1SGE I;  2GVI A;  1OYV I;  1SGQ I;  2JW6 A;  2V53 A;  2ORV A;  2OZU A;  2QQE A;  1DS2 I;  3TOA A;  1KBE A;  1UHA A;  1NUB A;  1OMU A;  2X52 A;  7WGA A;  2DKV A;  4HGU A;  1CT2 I;  2Y0M A;  1LR8 A;  1MJB A;  1UVF A;  2N17 A;  2SGF I;  1Y1B A;  2P6A C;  2V1C C;  4UXI A;  3E59 A;  1YTP A;  1FAQ A;  1KMA A;  5CCM A;  1FAR A;  1WGT A;  3FSY A;  2ENN A;  1TOT A;  3D00 A;  1WGC A;  2E73 A;  4WP4 A;  1FYB A;  3UEJ A;  2VRW B;  3TO7 A;  2N71 A; 
#chains in the Genus database with same CATH homology
 1CGI I;  1PPF I;  5FUW A;  2ENZ A;  1TIH A;  2NU3 I;  2YUU A;  3UFF A;  1RFH A;  2ODD A;  3TJQ A;  1SGN I;  4A24 A;  1CGJ I;  1XBT A;  2B8T A;  2LUY A;  1V1I A;  1W4R A;  2KMR A;  4UXJ A;  4E1P A;  1Y8F A;  2OD1 A;  5DAE A;  2FNF X;  1LR9 A;  3QTL D;  5EX0 A;  2L7X A;  3OXF A;  4JCV E;  3SGB I;  3UEY A;  2SGP I;  3SGQ I;  1Z7K B;  3VDP A;  5CCL A;  1N13 A;  1R0R I;  4OVO A;  1IW4 A;  3UGD A;  2GKV A;  1U5K A;  3PDN A;  5HQ8 A;  1PTQ A;  2ARP F;  5EX3 A;  5FUX A;  4UXH A;  5HI7 A;  2K9H A;  1M8B A;  2NU1 I;  1XX6 A;  1CHO I;  1MT1 A;  3OL0 A;  3FC3 A;  1DS3 I;  2QQD A;  4B6D A;  2M5X A;  3VDU A;  2N52 A;  1SGR I;  2KMP A;  2JXD A;  1X4S A;  1UVG A;  1PCE A;  2JA1 A;  2YQP A;  1HJA I;  1TGS I;  5FUY A;  3B4V C;  2ORW A;  1TBO A;  2J87 A;  1TBN A;  2WCY A;  2KMO A;  3KY9 A;  1PJU A;  2GKR I;  1PTR A;  4E1R A;  2NU4 I;  2E5R A;  1OVO A;  2KMQ A;  1IY5 A;  1KBF A;  1LR7 A;  2OVO A;  2QQC A;  2BUS A;  1SGP I;  1YU6 C;  1SGY I;  1CE3 A;  2SGE I;  1SGD I;  2GKT I;  1TBQ R;  3RU0 A;  1H0Z A;  1UUC A;  2ELI A;  4GI3 C;  1TUR A;  2ERW A;  2JZM A;  5FUV A;  1CT4 I;  2UZ3 A;  1CSO I;  1XA6 A;  2ROW A;  2NU2 I;  2W0T A;  1W3S A;  3CXL A;  3OVO A;  5JHW C;  3BJI A;  3OXL A;  1V1H A;  2CJS C;  3SEK C;  2V1C A;  2WVJ A;  2QQ0 A;  2L8E A;  2J9R A;  2DB6 A;  1IY6 A;  1BMO A;  1BUS A;  1OMT A;  2F3C I;  1CT0 I;  2N1A B;  4SGB I;  3E2I A;  2SGQ I;  1M8C A;  3GOX A;  1Y1C A;  1VDD A;  1TBR R;  2QPO A;  3MEK A;  1HPT A;  2B0U C;  1R79 A;  3UGI A;  1AN1 I;  2XRC A;  1HDL A;  2JYY A;  2SGD I;  1X74 A;  3QWP A;  3VE5 A;  4FKD A;  2A20 A;  1TUS A;  2NU0 I;  3HH2 C;  3OXG A;  2KCX A;  2LEO A;  2DIP A;  4L9M A;  1SGE I;  2GVI A;  1OYV I;  1SGQ I;  2JW6 A;  2V53 A;  2ORV A;  2QQE A;  1DS2 I;  1KBE A;  1NUB A;  1OMU A;  4HGU A;  1CT2 I;  4UXI A;  1LR8 A;  2N17 A;  1UVF A;  2SGF I;  3UGL A;  1Y1B A;  2P6A C;  2V1C C;  1FAQ A;  3E59 A;  1YTP A;  1KMA A;  5CCM A;  1FAR A;  2ENN A;  1TOT A;  3D00 A;  2E73 A;  1FYB A;  3UEJ A;  2VRW B;  2N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...